4N5ED

42f3 tcr pcpa12/h-2ld complex
Total Genus 60
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
60
sequence length
239
structure length
239
Chain Sequence
AVTQSPRNKVTVTGGNVTLSCRQTNSHNYMYWYRQDTGHGLRLIHYSYGAGNLQIGDVPDGYKATRTTQEDFFLLLELASPSQTSLYFCASSDAPGQLYFGEGSKLTVLEDLKNVFPPEVAVFEPSEAEISHTQKATLVCLATGFYPDHVELSWWVNGKEVHSGVCTDPQPLKEQPALNDSRYALSSRLRVSATFWQNPRNHFRCQVQFYGLSENDEWTQDRAKPVTQIVSAEAWGRAD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Immune system
molecule keywords 42F3 alpha VmCh
publication title Structural interplay between germline interactions and adaptive recognition determines the bandwidth of TCR-peptide-MHC cross-reactivity.
pubmed doi rcsb
source organism Mus musculus, homo sapiens
total genus 60
structure length 239
sequence length 239
ec nomenclature
pdb deposition date 2013-10-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
D PF07686 V-set Immunoglobulin V-set domain
D PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4n5eD01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4n5eD02
4J1UA 2AV7B 5C3TA 3K7UA 4KUCF 4GW5A 4S0TD 4G8GD 2AEQL 3TBYB 1U95A 1BQLL 1WC7A 1UB6B 3T2PA 3VMPA 3F7QA 2CDGB 4QXGH 3RWFB 2DBJA 2DQUL 2PCPA 2P42B 1GOGA 5IMOB 1MIEL 1FE8L 1T7YA 4QWWD 2AKRA 4D3CL 1IAOA 3WNNA 3MNWA 1S7WB 2J4WL 1WICA 4PLJD 3ARRA 3HG1B 4QRPB 2BC4B 1NAMB 1NCDL 5H37G 1C5DB 4HXAL 4PJCF 3SY0A 1BFOA 5MEPA 3GK8L 1TZHB 4OCYL 2CH8A 1HHHA 5FYLL 5KAQG 1KJ3H 3P30H 5C09D 4U6HB 1F3RB 5DHVA 3C5JA 1QBMH 2G2RB 1OGTA 4NN5C 1JNNH 3EHBC 5HHNB 3WKNA 2D03H 3B3IB 5BMFH 1GGIH 3UDWC 4PJBE 2IMNA 5HD8C 3PXJA 4TNVK 2E8YA 3VXME 1JIBA 5D2NB 4XMPH 5BZWA 3W0WE 3UAJC 2J1KA 2RHEA 1ZLWH 1CLYL 3QXAB 3HMXL 4F57H 1C16B 4R97B 3C2AH 3FQRA 4ZFZA 3U7WH 1BECA 3BN9D 3BKMH 4DJMA 1RVFL 5CJOL 3HS0B 1D5IH 4KH2A 3TNMB 4KHTH 4XP5H 1MJJA 4U2YA 4XNUH 1JL8A 5K9OB 2Q87A 2NY1C 2F8OA 5JR1H 3QQ3B 4XPGL 4E5XA 2Z91B 3BSZL 1TVBA 4K9EC 1G7PA 1LP9A 3BDYH 4PPTA 3VXSA 4K7PH 2DL2A 1HHJB 1U42A 1JTPA 3S88H 4M43H 5CEZL 4OI7A 2YMXH 3QJHA 1WBZA 5FA3A 1S9XB 2G9HA 4X6BB 5T3XH 1FQ9C 3TWCL 3FRPA 3PG2A 3LMJH 5IBUG 5DI8B 1C08A 1PEWA 4JZNB 4X6DA 5JOFA 3E1F1 4UQ3B 2VDMH 2HKHH 4P46B 2R0WL 4OGYL 2DQJL 2G5BA 1JHKL 3MRGA 4ZUTA 5D2LB 2F8XC 2K3TA 5J6HA 3DX6B 4OB5L 3KG5A 4FQ1H 3T0XA 4YEFA 2P5ED 4NDMA 5FEBA 4LSPH 1I7UB 3ULUE 2ICCA 5CGYC 4NO2A 4RGNB 4G8EB 2OSLA 1OLZA 3VD4A 1T0NB 4KHXL 4KK8C 4UT9H 5J12B 1CD0A 3O6FB 4RMSA 4BKLB 5KS9A 5JXEA 4K3GA 4QEGA 5AWNL 5CJ5A 1CVSC 4LSSH 4RMUA 4QHNA 3ZTNL 1Y0LB 5CEYB 5DD3H 1QSEB 3ETBF 4LLVA 1UB5B 4MD5B 5IFJB 4NQXA 1RPQA 1SYVA 4EUPG 3GI8L 2EIDA 3WS6C 1SY6H 3EOAB 3GSNH 4ALAH 2H32A 4NRZA 3ELAT 4ZXBA 3C8KB 2QTEA 2FEDC 2AV1A 2OMNA 3TV3L 2XPGA 4EQ3A 1WCQA 4JFOA 5BVJB 3NPSC 3QI9A 1OTSD 3SKJH 2H3NA 3RY5A 4KI5D 5DVKA 3F65A 3HC4L 3TNNA 1W2KT 5MEND 1AO7E 5I76B 3DWTA 1CGYA 5C07D 1EFXB 5T3ZL 2IH1B 4UUJB 4Z7VF 3EDDA 4U1NA 4HWBH 1YN7A 4G8GE 5DC4B 3PWPA 1RZJC 1H15A 1SJVA 1J1PL 5DK2B 43CAA 3BT2H 2CLRA 3FT2A 2Q86B 1G7JA 3ZKQD 2AJVL 5HY9A 1S7RA 4JZJC 4XNMA 3BPOC 1ES0B 4M6AA 1OARH 4OGAD 3A67H 5D1XB 2YBRB 4GOSA 3MODL 4NHCL 5TF1H 3WXWL 5KSAB 3HZMB 4OI9A 3EYSL 1W8OA 4YO0B 1ZGLP 4WWID 2P8PA 4HH9A 4JPKH 3WLWC 1BF2A 1O0VA 5B3NA 3MV01 1FV1A 4E42A 2GQHA 4WV1C 4QHUA 3HNSH 1E4XH 3O8XA 1JP5A 2FX8H 3LKNB 5D7JC 5AD0B 1G9NC 2PW1B 1T2JA 1L4IA 3T3PE 2AJXL 2X9WA 2D7TL 4OTXH 5BXFA 4FZEL 1WV7T 1DBKH 1U8JA 4GRLB 5C09E 3T2OA 1A3QA 1ZS8A 5C9KA 2AEPL 1NEZA 3WKMH 2NY0D 4TQEL 3NCYP 1DUZA 2FBJL 1OSPH 3MO1B 4ELME 2X89A 3T4AA 3HAEA 2PXYB 4P99A 4RGMC 1MAMH 3F7RA 2HMID 4U6VL 5GS0H 5KSVB 3S37H 2XQYG 3MRQB 4WFGD 4H26B 2X4QA 2D7PA 1MLCA 4LKCB 4WW2B 2X4RB 3WNLA 5E08L 4XPAH 2PTTB 1OWRM 2LU3A 2WQRA 2D9CA 4G42B 3RWJB 4TVSa 3MRNA 5F7WC 4FQPA 4PUBL 3QCTH 5E8EB 4RFEB 5J9PB 3QH3A 1S9VA 5B39A 2W60A 4JHWL 3S35L 2CSPA 1N6VA 3I2CL 4ODBD 2BOCA 2FGZA 4C56A 3FRPG 4XP9L 1ZHKA 1FYHB 2XNAB 3ARVA 3OPZL 1ZK9A 4U2ZA 2ITDB 1MREH 2Y6SD 4YFLF 1ZSDA 3DUSB 3T8XA 1QO3A 1UENA 4I9WD 4LSUL 3ULUL 3DO7A 1MUJB 3N9GH 4U3CA 1AHWA 4UIKL 2BSSB 1CGUA 4G7YH 3WFEH 1UWXH 3I50H 1MVUA 3SDAC 1L7TH 4QT5A 3JWDL 1I85C 3N50A 3C8DA 1ADQA 3LKOB 4GKSA 4K7PY 3NABH 4JO2H 2EDDA 2P5EE 4HHAB 1UVQB 3QDGB 4PJBB 4NQTA 4FQCL 5IBTH 4UDTB 2BFVH 4PY7B 3CX5J 3SE4A 2YS4A 4I4WA 3QDJD 1HI6A 1QPXA 4G8IA 1X5AA 3SGKC 4GRWH 4H5SA 1SJEB 4P2OB 2PETA 4Z77B 1L9MA 4ISVA 4Y19D 1GIGL 2JJUA 4M5YH 4D2NA 1LK2B 2VITA 4X6CF 5KVFL 2YRZA 3MUZ1 4QRRA 3GJFH 4NZRL 2Z4QB 4EZMA 2OR8A 5HHOA 2XKNA 3ARBA 3FN0H 4KUZL 4JPIA 4HS6B 5ID0B 5E1AB 1NAKL 2VN4A 3V52H 4ZSOA 4P5KB 3QCUL 5IB2B 4PREB 4PRID 5DEFA 3GI9H 2PNDA 2E6JA 2XTJD 3H9SB 4F7MA 1J0HA 1WFNA 4CNIA 2XICA 3QEHB 4KI5E 5J6GA 1EHXA 4JVUA 2CUMA 5DS8B 5MENE 5JNYB 4PJDE 1WIPA 1UT9A 4MCZB 3KR3H 4MVBD 1JVKA 1JK8B 1PJ9A 3HRZA 5C07E 4HUNB 3FB5B 5CILH 4ZO7A 4OCWH 3OAYH 1FFOB 4P23B 3W5NA 2Q3AA 4U3XA 1YY8A 4XPFH 5D96C 2DMBA 3MV8D 3TH3T 1XIWD 2CKBH 3T0EB 2NY7L 4KZEL 1DLFH 3TYFB 4NKDB 5GHWH 2ATKB 3DECA 4TYUA 3TBWA 1E28A 5L0QC 5HYIA 4BSWA 1AXSB 4EI5C 1A0QH 1LE5B 4I0KA 5D5MF 2P5WD 2F9BT 5D1ZD 2JIXB 1JRHI 2BCKA 3MLVL 2WP3O 4M48L 2R29H 4QKXB 1GHFL 4G6MH 4KROD 4F2MA 2ESVD 3NA9H 4L4TA 1NEZG 5EBGA 1HHKA 3B83A 3RWGA 5KAQF 4NCC1 5SV3A 4O9HH 5GGVL 1QYGH 3HAEG 1CFQA 1DBJL 4AEFA 3L95A 2Z8VC 2EYTA 3TCLB 3O3DA 5DJAA 5EOCH 1A9EA 4IRSC 4LQFL 4PG2C 1T4KA 4AEIL 2QADC 5C0FA 4OCRL 2R1WB 5E99L 5K9JH 1N0XL 3CX5K 1A3LL 3K0WA 5DJ2A 4WFGE 1A3RH 1IC4L 1TZIB 1S7XA 2O5XL 1QR1B 4K2UH 3PDOB 3LKQB 5CZXC 4ZMAT 1RU9L 3P4LA 1NCCH 5LKNA 3VWJA 3NGBC 3V4UH 2CGRH 1Z9LA 4K71B 1Q9KA 4G8GB 5B39G 5ILTL 4JY6B 4UQ2A 3L3IA 5C0IB 2DM7A 2XV6B 2AXFB 3RZCC 3VRIA 3F58H 1QKZL 3LRSB 1U8NA 4PJHF 3STBA 1E6JH 1RUPH 3PJSB 4X7FC 1D6EB 3GKZA 1WISA 1A7QL 4L4VA 1JRHL 1TJIH 2K1MA 4FFWD 2BSTA 1BAFH 2EEAA 5K9QG 1FZOA 3ZKSD 1E27A 4U7MA 1KFAL 4JFDA 1CN4A 2GTWB 4I9WE 4LLYA 1Q72L 2VDOH 2FWOB 4V2BA 1FC2D 2YOCA 3O11B 1N8ZA 2L0DA 4YXHH 1KT2A 4PRBA 4EI6B 3QDAA 1KTLB 1KN4L 1C5BH 4OLXL 1VKXB 2HRPH 2QKIB 4ELMB 3K1KC 5D8JH 4JHBA 2WUCH 3EZJB 5IWLC 1U8LB 4HAFA 2FYYB 4O2CB 3QDJE 3SGDH 4GAYA 1QFWL 1EIBA 3JUYA 3MRHA 3H6JA 5E2TH 3VA2C 3IU3A 3S5LB 2EC8A 4NQDA 3KYAA 4Y19E 1DQJB 4U1IA 1EMTL 1JGDB 3PWUB 1EAPB 3HCVB 4DEPC 3GMNB 1MJUL 2OMBA 3L3HA 4Z7QF 4RBPH 5EO1A 5TPWL 3SCMB 4DKDC 4AIOA 4D9LL 1LDPL 5FM5M 4JREC 1J1XH 4D9QD 1MHPH 4QF1B 5JDJA 1WBXB 5JIPA 1FNAA 1LE9B 3U7YH 4PRIE 1S78D 3ILPA 4FFYL 2XTJE 2IFFL 5LGHH 1UQSA 3WYRA 3MTRA 2HFTA 4NT6A 3QSKB 3CH1A 3ARDD 4ZAKB 5HDBE 4U1MA 1S7VA 2V17H 3MCLH 4Q9RL 2MMXA 2JJTC 3T65B 4OGXL 1WBYA 4EDWL 1MHEB 2QSTA 4NPYA 1ZTXH 4UU9A 3SKUD 1F4HA 2KL6A 4CVZB 4OQTH 3K4ZA 4OIIL 3GMLB 3FQTA 1AGFB 5D7SL 5BS0B 2R0ZL 1U8MA 4X9FA 4ZFGL 1XGQA 3MV8E 1I1AD 3RNQA 5GQBA 3C60C 4EDXA 1KLGA 4R8WH 3MXVL 5HGHA 3PWLB 4Y1AD 3I6GB 5GS0C 3L3KA 2F5AH 1GH7A 1IQDA 4LMQI 5AAWA 3CLEL 3DV4B 2EIZA 5JPNB 2FIKB 2P5WE 3MUGB 4Z5RA 5IB5B 5LQBH 1AGCB 4WDIB 5IF0A 2HFGL 3CMOL 4ETYA 3S96B 2O61A 1SJHB 2J88H 2ESVE 4KK9C 2CD0A 2OI9C 2XXMB 3QEQA 5DTFA 4ODTL 5SV4A 2X4OB 4I1NB 5AUMB 1QSZA 1XGTA 3IFLH 5TDNB 4GG6E 2JB6A 1FO0L 3NZHH 5HYSG 4J8RB 4HV8A 2BVPB 3R0NA 1VB9A 4M7KH 2Y36L 4LBEA 4YC2C 5E8NB 2VQ1A 3WS6A 4BUHA 4K3HA 5DJYA 2VDKL 32C2A 4JFZH 3VGFA 5MENB 2RGSA 1O5DT 3I9GL 3CC5B 5FO7A 3FO0L 1UCBL 3NIDF 3I84A 1DVFC 1A6UH 4FQQB 3QXUA 4UB0H 1BD2D 4YHPA 1D5XB 3HE6C 2YUWA 4Y8DC 1LP9F 5C8JB 2P4AB 3DUUB 4DOHB 3MROA 1I8IA 5F7YC 5L7XH 3OKOB 5C0AA 4CVUA 1LILA 3DMMD 8FABB 2GK0A 3GSXB 3HI1A 2CDFB 1VA9A 3QXVA 1UFUA 5DRXB 3EFDH 4XC3H 2QQKH 1WT5A 4U49A 4PJXA 5JIKA 3BE1H 3L7EB 3G6JE 1R3HA 3CSYB 1NMCC 2ZG1A 5DRWB 2EYRA 1IM3B 3F62A 2FX9L 2F53B 2ED7A 3X12A 1KEML 2GSIA 4MQ7B 4XBEH 5H35B 1G6VK 4WV1A 4GMTL 2C1OB 1VDGA 3SDDD 2DM2A 2AGJH 5ABDE 3NACH 4DCQB 3CFBB 5FGRA 5C0NC 4HF5L 2K7PA 3MREA 1CYGA 3WIFB 4LP5A 3MRCA 1F2QA 3OF6A 5E6ZA 1RUAH 3GGWB 5KS9F 2DWDA 5FDWB 5ADPH 3GBMH 3BQUD 1HDMA 5DJ0B 1PGRB 2H8PA 4XWOD 4RWYL 3DRQB 1IMHC 2JLLA 3GIZH 3Q1SH 4HWZA 4N0FA 2QQQA 5J11C 1KCRL 4RNRB 2B2XH 1FO0B 3UC0L 3CLFH 2VDQH 4XTRC 3H3PH 3UYRH 5MEQA 3X3GH 2FRGP 3A6CL 3NCJL 1F8TH 2XN9D 4D9QE 4DN4L 5GRJL 2WMPA 2XZCH 4KRPB 2P47B 3VI3E 4PJ7A 1F3DH 3MRRA 2Q7NA 3HNVH 3B9EA 3E8UH 2YEZB 3QPXH 1INQB 4L4JA 4WI4A 3AVEA 1ZLSL 3OBAA 1ACYL 2LVCA 2FGWH 5GGSB 1BLNB 3P73B 1KB5L 2Z9TA 1VGKA 3IFOA 3QIUD 1CI5A 3ZO0A 2BSRB 2IQ9H 1NGZB 4KKCC 1W0WB 3NBNA 1YMHB 5KW9L 1T3FA 2AQ3A 4XBPA 3SDAA 5IUSA 4TRPL 1JYXA 4Z95L 3WMSA 2IEPA 3REWA 5KN5B 4Y1AE 3TBVB 2MFNA 3QDJB 1KJ2A 3TZVD 1NCBL 3W2DH 2EXYC 3B2VL 5D5MB 1A6PA 2NY3D 2Y4SA 1EGJL 2BDNL 3EOYG 2AK1L 4PIRF 4N0UB 3SGKA 4P57B 3U9PH 1GGBH 1WUNT 1JPSH 3LB6D 3DV6A 1JWSB 4IIQC 4E0RB 1D9KC 2IBZY 3MOQA 3NTCL 1ZXQA 2EDTA 4MQXD 4KRLB 2IALA 2BRQA 2OTWA 5SWSA 4YDVB 5DT1L 3V8OA 1P7KB 5DURD 2UWEF 3PP3K 4N90D 3MBXL 3VGAC 1AP2A 1EO7A 1SVZA 3UTOA 2HRLA 2AJ3A 5I8KL 2NR6D 5DWUL 4X4XB 1A6WH 4ORGA 2WWMC 3MV7D 1QLEL 2ZUWA 4I3RH 5AYUH 4DAGH 1LEKA 4WI9A 2EXWC 1BD2E 3C9NA 5GS1B 5BRZD 4RMTA 4HPYL 1VEOA 3CXDL 1YEKL 4I48B 1XIWB 3GHEH 4WJ5B 4V1DD 4UTBH 4XP1L 1WAAA 1OD7A 3PGFL 4KTEH 4XP6L 3TT3L 5ACZB 3N06B 5HJ3B 5ICZA 1ZLVK 2FECL 3L9RB 3KPLA 5JQ6H 3EYUH 5SWQB 3NCFB 1MRCL 1PDKA 3OSKA 2FH8A 5CZVH 4LLUA 4P59H 5C0RH 3GB7B 4I0PD 1C12B 1GAFH 4GXUN 2ICEA 4GH7B 1JGEB 4E9LA 4KROB 5IBUB 2ESVB 3RL2B 4PRPB 1RK0B 4NRYA 1K8IA 5DZLA 5HVGB 4PGZA 4XP4L 3AB0C 1AGEA 3IDJA 1A4JB 4JDZB 4L8CA 3MLYH 3ES6B 4GFTB 4DVBA 5EUOA 1E4WH 5E6IB 3ZHKA 5KVMC 4DW2H 2VTFA 4I2XA 1P4LA 5GGUB 3D0VB 4OZHA 5I2IB 3LQZA 1A6AB 4P49A 1FL3B 3HLAA 4KK5C 4PG2A 4M02A 5CD3B 3QEGH 4PJ9D 4JPVL 1WEJH 3SN6N 2WM0A 1YEDA 4LKXB 1JHTA 3ZE0E 4XWGH 4YBQD 4ONHB 3TJEH 4ZUWA 2R1XA 3VMNA 4OAWA 3FO2B 3SO3B 4CN1A 3V6OC 4HX1A 1P9MC 1M05B 3QEUB 2DQFB 2XN9E 5CD5D 5GZND 4OF8A 3S34L 1HWGB 3FFCB 1IGMH 1WWAX 1Q0YL 2VXVL 4OIAA 1RZ7H 3T1FB 1TJHH 2V7HB 4WI5A 1FNEA 1NSNH 2Z35A 4U6YA 4PYGA 4M5ZL 5J3HC 3UTTD 3VXNA 4WUUD 4JPWH 1ORSB 1G6RH 5DQJB 1N4XH 4ODWB 1IL1A 3D6GA 4JDTH 5DSCB 2DYPA 3I3EA 4WIQA 2RR3A 2FD6L 1R24B 3IS1X 4Z78B 2DKSA 3GSRB 3BPNB 1M7DB 3RDTA 1X4YA 3MJ9H 2LE9A 4PJ8D 4G3YH 1KPRA 5E00B 2OZ4L 4L8BA 1FVEB 3MA9H 1IEHA 2W59A 5E5MB 5L6YH 2CUIA 1EERB 3GSNA 5EWIH 2VXQH 4HGWA 4JN1H 5EDXA 1IGFL 3QULA 3F7PC 2VXUH 4IOIB 1Y18A 4JKPH 1NLBH 4OGZA 3VGGA 3PIQB 3G5VB 1NDMA 5C2BH 5D6CA 5IWLA 2APWA 3MACL 1TENA 5DHYB 3FAXA 1HILA 4YIQA 3HUJB 4HS8H 3QAZB 5I30L 3WEXB 2C3VB 2IAMC 4MAUH 2BY3A 3TIEB 2H2SD 5BO1L 4WHTA 2NXYD 4FHBD 4WFED 3BIBX 4HWBA 4P5TD 1T22B 1JPTH 1AGBA 3IDYB 3MNVB 2X4UB 4G80A 4XPTL 4XCEB 3LEVL 4W4NA 5B8CA 2J6EA 1DQLH 4OLZH 5IKCB 43C9A 1P5VA 4OZFH 5DA4A 2X1QA 4N90E 5EC2A 4BZ2H 5GISL 1V7MH 4AK1A 1V8HA 1LEIA 5I17A 3P4MA 3LHPH 4N9GB 4AENA 5D7LD 3SBWC 4Y4FA 2FZ3A 3MV7E 5I9QC 1CXIA 4X0KA 2JKXA 3BGFC 4MMZC 4XC1L 3HMWH 3UPRA 3VD5A 3TEUA 1ZV5A 5BRZE 2JJTA 4H0GA 5I1AA 3RGVC 4G9FA 4Z0XB 3CFCL 4V1DE 3FFDA 1I7ZA 2Q8BL 3OAUH 4WO4C 4Y8AA 4DGYL 4TUKL 3C6LB 3FQUA 3ESUF 4HMDA 1U92A 1QR4A 3P9MB 3LN4B 2W9LA 1A7PH 4PJFF 1RHHA 4EN3C 5IIEB 3UJIL 4K7FA 2AEIT 3MRIB 1T5WB 2E5EA 5EOQH 3QWOB 4P2RA 2VABB 3U0WH 1NAMH 1FYTB 2AERT 2DJ4A 1ORQB 3CIQA 1GYAA 4TPRH 4KKAC 2VAAA 2DWEA 5I1KL 1MLBB 1IQWL 1YNKL 3P9LB 3VG0H 3TGXA 2JCCA 3BEVA 3ZT6A 1BVKA 1EXUB 4P2QD 4OUOA 5EZLB 1IARB 5K9QI 3KPSB 4FP8L 2VLKD 1NFDB 1UH3A 4FXLA 4MXQC 4PP1C 4ZODA 2XY1A 5GZOD 3ZE1F 4OKVA 1FGVL 5GGTH 5KOMC 5IMMB 1F00I 2APVA 2R56H 5TQ2H 1UZ8A 3GO1H 5F1SA 5IHBA 1NUFA 1AD9B 3VA6A 5C08B 1U8OB 3IB4A 1AY1H 3PGDB 1OAYL 1CL7H 4GXVH 3RTQA 2QR0A 4DZBB 3QIWC 4RFOL 5DD1L 5DC9B 3DTXA 5FUCC 3EO1A 4X4MA 4HDIB 5TH2A 1J0ZA 4C59B 4U1HB 1HHIA 4B7IA 4P2CG 1N64H 3CFKB 2XWJA 5FYJH 1ETZA 4Y4HD 3MBED 1AQKL 4HKZB 1CDCA 4XBGB 5ETUA 4XVUD 3UTTE 4WUUE 3LSOA 2AEQH 2ZG3A 3BYTA 1BQLH 4LNRB 1SJXA 1T1ZA 4NJAL 4PV9B 5TE4L 5I8EA 3JV4B 4M00A 4M8QB 4YHML 1BWMA 4YBLB 1B3JA 1XR9B 3U2SB 2DQUH 1ZLWK 4QRSA 1J8HB 3VDCA 4I18B 2O93L 1MIEH 5KVDL 2X7LB 3UTZB 1FE8H 1CD1A 4D3CH 3B9DA 3NIGF 5F1IB 1DQML 4X7DC 4M1CD 2HKFL 4JFQB 3P0GB 4PGCA 4R2GB 2J4WH 1ULVA 2V2WA 4ZUSB 4XNYL 4XXCC 4FQXA 4ZS7L 1NCDH 5DEGB 3H7BA 3BP6A 2BK8A 2GCYB 4HXAH 5ENWB 1EEZB 3BQUB 3WS3B 1GZQB 1UACL 3IDIA 3GK8H 4OCYH 3RJDA 5FYLH 3O9WD 5EBLA 3GMMA 4JCLA 4S1QL 3X13A 2MOVA 3BW9B 5JLZA 3CD4A 3MCG1 1MCWM 4Y4KC 4R3SA 3VXUA 4WFEE 2VZVA 2YUXA 3OQ3B 3D69A 5D9SB 3QO1B 3BOVA 1TPXB 4TVPD 5ESAB 4NQED 2NTFB 1HXYA 1CLYH 2ADJB 3HMXH 4PGBA 5D71L 1QLRA 1BQHA 4H1LH 2CKBA 4I3GA 4GG8B 1RVFH 5CJOH 2V7NA 1F3JB 3SDCD 1U93B 1YMMA 5KG9B 1B6DA 5E4EC 2GUOB 1OP3H 3WL9A 4O2FA 3MZGB 2C1PA 4Y16C 2HFFB 5D7LE 2KQNA 2IADB 5CWSA 4LEOB 4XPGH 4HUVA 3OJ2C 3BSZH 2Q7YA 1G9ML 2YRLA 2YPKA 3T4YB 2W0FB 4LSQL 4ZPVB 5HPMB 5E24E 4N8VB 1OLLA 3BDBA 1QFOA 4PJ5A 5FO9B 5CJXA 1YN6A 5F6HI 3TWCH 4ZD3L 1M4KA 1H5BB 4LP4A 4MD4A 2J2ZA 2VAJA 5EU3B 5TDPA 4MJ6A 1GGUA 4MJIA 2R0WH 4OGYH 2DQJH 1JHKH 4LVHC 4PJCE 4JZOA 1IM9A 5AG9A 3ULVL 5HI4D 1FFQA 1BOGA 4OB5H 3R8QA 3QUYC 1R3IL 5CSZA 1BEYL 3AUVA 2AXJA 2ITCA 3T3MF 1X5KA 4F3FB 4P2QE 1PSKL 4IIQA 3WDIA 4JM2A 1RUML 2VLKE 4U0RB 1D9KA 4KHXH 1CT8A 1F45A 3RZWA 2BSED 1A8JH 4Z7WF 2R4SL 3TH4T 5KZCD 2WBJA 3GDBA 1JMZA 1JF1B 1ONQB 1VFBA 2IC2A 4JG1L 3V6ZA 4ZFOA 2FDBP 1CDYA 3BZEA 2V2TA 4GBXC 1ZT4A 4NQCD 5I73B 3TPUA 1WGOA 4XMKL 4BSVB 5D7IA 3BDXA 1S5HB 4YPGB 3GI8H 7CGTA 1KOAA 3VFSA 1J7VR 1F4YL 3AY4C 3TV3H 1VHPA 4U1LA 3OKEA 5DD6B 2DI7A 4PJ7F 4V1DB 2VDNL 4OLVL 5JXAL 2J8HA 5GRUL 5J56B 5C7XL 1MSPA 2EZ0D 1ZT1B 3MNZB 1S9WA 3HC4H 1X4ZA 3VRLF 3PWJA 4GJTB 3N1PC 2DLTA 4LHUB 4OZGB 1P7QA 4ZS6D 5HGDB 3VFRA 4LLWB 1CLZL 4EOWH 4MLIA 4NKOB 1YZZA 5T3ZH 4AG4L 4ODUA 1CXFA 3HR5A 3MYJB 1Q0XL 2E7LA 3IFNL 5HXMA 3F12B 2XWTB 3BRGC 3OR6A 2PO6C 3B9KC 3TFKC 1UH2A 1AKJA 1J1PH 4IOFD 4YFEA 1G7MB 4YGVB 3SGEH 2YK1L 1QZ1A 2ADIB 4YHOL 2AJVH 3WUWA 5JPMB 3QIBB 3BZFB 3HPJB 4CN6A 1MCIA 1JV5A 3V9FA 3HE7B 2Y5TB 3BZDA 2R15A 4NHCH 3WXWH 4Y2DA 3OXSB 3T77A 3EYSH 3OV6A 1VSCA 3IFPB 3TA3D 5IOPA 1K4DB 4YLQT 3ARSA 1WSST 4M9OA 3KAAA 3X11A 2AJXH 2CLZB 2D7TH 4FZEH 3UP1A 1FAIL 3D39B 2AEPH 2P8LA 4TQEH 3MUY1 3QUXD 2FBJH 3N1GC 4MA3A 3SJVA 3ARFB 4RIRB 4PJAB 4K94L 3VXRB 4TVPE 1BQHG 1PKQE 4U6VH 3WLBA 4NQEE 3VXOB 4OQTA 5J89A 4M7ZB 5F88B 5FUOL 2UUDH 1L0QA 1T2XA 1V7NL 3QUZC 4G43A 5E08H 1IGTB 4WUUB 1MCEA 2BERA 4X4ZA 5TDOA 4KDWA 4Z7VE 4PUBH 5EB9A 4B5EA 1CDGA 2ZJSL 1J12A 4JHWH 3S35H 2I25N 4BYHA 2OX5A 2BXZA 3OGCA 5DK0B 4MDJB 5DDHA 1WAAF 5GSVB 2DIBA 1MWAA 3ARTA 3I2CH 1XF2A 4XP9H 1J05B 3HC0A 3OPZH 4OF7A 1I1FA 4Z7UB 3GJFK 1S9KC 3GJEB 5SX4I 3DROB 3G04B 3U9UA 4FQHB 4XGZB 5D2NC 3ULUH 4LSUH 1RK1B 3BD3A 4PTTB 3ZYZA 2R9HD 4UIKH 1N59B 4HIEA 4DGVL 2NYYC 3IF1A 4HBCL 5F93C 2X4SB 3K4AA 5C6WH 4GKNB 5IB4B 2NNAB 3HN3A 3O6ML 3IRPX 4TTDC 3OKNA 1A2YA 2IMMA 5JUEL 4GW1A 1BJ8A 4FQCH 4YWGL 4P5TB 4RMWA 5D6DC 5ISZD 1MCSA 4N9OB 4POZD 1OTUC 3OAYK 1GIGH 2HJKA 1HH9A 2DL9A 3AMKA 5KVFH 1S7TA 2VZOA 3FB8A 4NZRH 1IILE 4PRNB 2YPLB 3NFPA 3IKCB 5E8PB 3UMTA 4NQCE 4N8CL 5D7LB 3V0WL 4KUZH 1PLGL 4HIIB 2FHBA 3DGGB 3V5HA 3PUCA 3D1MC 5AYQA 1NAKH 4MNGA 4P46C 3QCUH 1KF9B 5F89A 1U58B 1CE1L 3OB0H 4KAQL 3ZHDA 2X44D 4P3DB 3MJ7B 1NDGB 1U8PB 3TBTA 4QYOB 1H3XA 4KVNL 4JANA 4WHYH 2AJZB 3H3BC 3FONB 1DEDA 4RGNC 8CGTA 1KIRB 4WO4A 3VD7A 3IDXL 4EIGB 4DWHA 4MNQB 5J12C 1U8QB 4W6XB 4MA8L 4ZUUA 1QQDB 4GLRH 4A6YL 3GM8A 3HZYB 3WUWG 3BUYA 4EN3A 1DEEA 4JFYB 2ZCLL 2W38A 2DOCA 2NY7H 4BQ8A 4KZEH 2P1YA 1C7SA 3MRKA 3AU1B 4YHNA 3M8OH 1ZANL 4P2QB 3ZDXF 5ESVA 4MZ2A 2XOTA 5HVWA 4AH2B 5HGBB 1JPFB 2DLFL 3R06B 4FFZL 4JRXD 1KXTB 3TLRA 3MLVH 5CBEA 3E3QE 4M48H 4HKJB 2LAAA 1GHFH 1TQBB 3P0YL 4IRZL 5FGCB 3JSSA 4RMRA 5DFVC 4U6TA 3QFJD 3AMLA 3OJVC 3EYVB 3QPQC 1KG0A 3M17B 3GFUA 5GGVH 2UYLA 3RPIA 3U82B 3TN0D 3QQ4A 1DBJH 5FF6A 2BNQB 4UT7L 4JRYD 4QY8B 3T09A 1AD0A 4K3JL 1I7TA 1FRGL 1Y6KR 1EEYB 4LQFH 3AXLA 4AEIH 4OCRH 3V7AE 1TMCB 4FFVD 4HFWB 5E99H 3VRJA 2O26U 4OLWL 1N0XH 1BJMA 1A3LH 4LLDB 4TULL 1RUQH 3NCMA 3QIWA 3VCLA 2X40A 3D85A 4RA0C 1IC4H 2O5XH 5SWZD 1IGYB 4FOMA 5GRYA 3L7FB 3HPLA 1IRAY 3BO8B 3MMEA 4U3HA 1RU9H 5D1XC 3U4BL 3DVGA 5KSAC 1P4IL 3PL6B 2HTLD 5I16B 2XTLA 1V5JA 4FZ8L 1UEMA 5ILTH 4HKXA 1AIFB 4Y5XB 1QKZH 1CFBA 1RIVL 4QTHB 2XACC 1NFIB 5H2BA 1QOKA 4FTVB 1T7VA 1A1OA 4OD1L 3UTQA 1DUYB 4GRLC 1FG2B 2XXCB 1A7QH 4Q6IC 4KKLD 5D1QA 1JRHH 4XMLL 2DQDL 2J8UE 5DJ8A 1U0QA 1Q9OA 1II4E 1OF2B 1FL6A 5C0JA 4RBPK 2PXYC 4A6YB 1KFAH 2BZDA 5IT2L 4XHJD 2YSSA 1Q72H 2GTZA 1AQDB 3M1BB 4D9RD 1CDHA 3BP5A 3GMRB 3EOBA 2V9TA 3QNZB 4K8RD 3LKSB 2GAZA 1M7XA 5E7FA 4TN9A 4NO3A 2BHUA 4LRIC 4WW2C 1KIQA 1IAMA 3F5WB 1GPOL 1KN4H 4OLXH 1M1SA 1LEGA 1B0GB 3OXRB 4HIJA 4PJIF 1AJ7L 4PGDB 5F9WB 2Z31A 5D7JB 4JFPB 4HZLA 2E7CA 3O41A 4PLOB 4NQEB 4I77L 1G0YR 1WZLA 3LKPA 4HJJL 5C2UB 5ISZE 3FO9B 4O58L 1JPGB 3IKKA 5IJVB 3ISWA 4GW4B 4Z7WB 1EMTH 1INDL 1JF5A 1MJUH 3OR7B 5EU6A 3QT2A 5JQHC 2FEEL 1BZ7A 2VDPL 3D0LB 5K59E 4D9LH 1LDPH 3RWEB 4IRJC 4JDVB 1S3KL 3OAZH 1F11A 3VXSD 4OZ4A 4FFYH 1QA9B 4PJHE 2IFFH 1WIOA 2AJSL 2ENSA 4NWTL 1BM3L 2GKIA 4ODSL 5FK9B 1FN4A 1T6VN 1MFAL 4P5MA 2VL5A 3KPNA 1KJMB 4U0QB 4BFBD 3ZKNC 5GS2D 5JDSB 1KELL 1YPZA 4PJEE 3ARXA 5LGJA 4Q9RH 1LO5A 1F6LL 1BZQK 1VADB 1Q9LB 4OGXH 3QDMB 3RIFK 4EDWH 1F3DJ 4GRWF 1E4KA 4P2OC 3LEYL 4R4FL 1U8KB 4OIIH 5D7SH 2R0ZH 3O4LB 4ZFGH 4P4RA 2VR5A 4HC1L 2RJMA 4L3EA 4JHZA 3MXVH 3KJ6L 4LAQL 3UZVB 3HKFA 2EDNA 1P84K 4AL8L 1OAQH 4MNHA 3QUYA 4LPXA 1M7IA 5E70A 2KKQA 3CLEH 5I1DA 5CJBA 1VFAB 3WO4B 4JRXE 2HFGH 3VXPB 3CMOH 1C1EL 5E94B 1ZA6A 3OG6B 5KZCB 5I8CA 4J23A 1AR2A 1BGXL 3UTSD 1MQ8A 3JTSB 3QFJE 1JZ7A 2F58L 1G84A 4NQCB 4ODTH 2ZKHL 4YDKL 1ZVSA 4MA1B 3FRUA 1H3PL 4Z7QE 5ADOL 1A4KB 1IEAB 4QXWA 4GBXA 3O3AA 4JRYE 1RZFL 1FO0H 2CR6A 5IEHA 2CO7B 4ZXBD 3MJGX 2A83B 4W70A 4PJGE 1MPAH 3NA4A 3BIKA 4YR6A 2I60L 2VDKH 3T0EC 3K8MA 3U0PA 5DVOA 3WFHA 3ULUC 4CKVX 5SWZE 3I9GH 2AEWA 3MRFB 2AK4B 3FO0H 1UCBH 2CJUL 3P4NA 4HIXL 3CPLB 4W81A 1BJ1H 5GGVY 5EZIL 4F33B 3PWPD 5C0CB 5IP4A 5DJ6A 2XWBB 4OV5A 1PQZB 2FJFA 5GRXG 1XZ0A 1CGSL 3NCBB 3PV6B 1UZ6E 1CIUA 4DK3A 1PZ5B 3O2DL 2PO6A 3ZDYE 4PV8A 3LPWA 4HEPG 4RZCA 4NO0B 2XG4A 4DTGL 5JZ7C 3RGHA 4QOKD 4BUGA 3D3VB 1B0RA 4KPHL 4R4BA 2CR3A 1CK0L 5L88L 5IK3B 2Y07L 3QXDA 1X7QB 3B5GA 5DJDA 3ZHLA 1HXMA 1G1CA 1E4XI 2FX9H 3IDMA 1RV6X 4D9RE 3O8XD 3ZKMC 4FS0A 1KEMH 1XMWA 3MPCA 3LQAL 4M9PA 2ADGA 4HCRA 5FAAA 4GMTH 2YZ8A 3L3GB 2F54A 2A6JA 1X44A 4HF5H 4ZO9A 3DPBA 3KXFB 2X89D 3MRJB 3V95A 2P46B 4J3XA 1UKQA 3S97C 5C9JB 4YHLL 3HNTL 4PRHD 4OCSL 3WUZA 3TBYA 1MCFA 5TFSL 3A6BL 1UB6A 5EOTB 5F7DA 4QWWC 2HT3D 1I1RA 2CDGA 4RWYH 2MQCA 1W0VA 4DQOL 3RWFA 3WD5L 3MGTB 5J1AB 5IMOA 4HIHA 1KCRH 2EEDA 4PLJC 2YWYA 3UC0H 2JJSA 5D7IF 3NIDE 3WDHA 1KPUB 1S7WA 5GGRB 5F96L 2AQ2A 3IJSA 3A6CH 3NCJH 4FMKA 4OZIB 3HG1A 4DN4H 4QRPA 5GRJH 1TFHA 2BC4A 1LP9E 1SMAA 3NGBB 1NAMA 3MR9A 3VXSE 1C5DA 3GIVB 4CJ1A 3IXAB 4M7JL 4PS4L 4XRCA 1MHCB 3CCHB 3JWOL 5FA4A 4C56D 5BQ7B 4XH2B 1R3JB 1TZHA 2J8UB 1ZLSH 1Z0MA 3K81A 2YD7A 3P77B 4MJ5B 5MEOA 2G2RA 1ACYH 3P11L 3A6OA 3B3IA 3BH8A 1KB5H 4OUUB 4X6DE 5LG1A 2ZZUT 5GGTA 1I1YB 5D2NA 2D31B 3BN9C 2V9RA 3QXAA 2EDOA 1L6XA 3BMVA 5KW9H 2R2CA 4TRPH 4Z95H 3L1OL 3HS0A 3AAZB 1INEL 3TNMA 5ISZB 2CKNA 1NCBH 3J7HA 1IKFL 5LAXB 5C0GB 3B2VH 5KS9E 3QQ3A 1KCLA 1EGJH 2Z91A 2BDNH 2AK1H 2GJZB 3CAFA 2FLBT 3UTSE 4QRRD 5E4IA 1HHJA 1AFVL 2YWZA 3IAPA 1WWWX 4ZAKC 1SEQL 5HHOD 5ICYB 2D3VA 3CZJA 3ARBD 4R4NC 3E6HB 3NTCH 1S9XA 4X6BA 3BEWA 2BXYA 5EBWB 4ZDHB 5DI8A 4JZNA 4UQ3A 5DT1H 3SKOB 1KTDB 3MBXH 2NCMA 5D2LA 1TNMA 3DX6A 5E9DB 1HEZA 3I02A 5J57B 1I75A 5I8KH 5DWUH 4PJEB 5T1LB 1EZVY 3RBSA 3MCKA 1MCPL 2ATPA 1I7UA 1QLEH 3EJYD 3H2WA 1R0AL 1HQRB 3PWPE 5IHZA 4YUEL 3BX7C 2MWCA 4HPYH 3CXDH 3O6FA 4BKLA 1YEKH 4CRPA 1UXWB 4XP1H 1OL0A 1V05A 1LO3L 2A73A 1JTTA 2ZUQB 4XP6H 4OM1L 4OFKA 2BOBA 3FN3A 4QOKE 4LCYB 3RIFF 5CEYA 1QSEA 1MRCH 2Y23A 4XZUB 1UB5A 4MD5A 5H8DA 4JRXB 3C60B 5IFJA 4OZFG 3H7LA 1AXIB 5DYOB 1J5OL 3HMXA 1E6OL 2I07B 1A6VL 1SHMA 1UADC 3C8KA 1MAJA 4XP4H 4L4TD 5GGSY 3MFFB 3T04D 3OL2A 1QBLH 2AXHA 2FR4B 4WENB 4JRYB 2RQ8A 1JWUB 4PJIB 2OI9B 3RY4A 1OCWL 4HK3N 1EFXA 5KTEL 3IDNB 2IH1A 3RWDB 4UUJA 3WFBL 1KJVB 4PRHE 1S9YA 1OAKL 2MQ3A 2DLHA 3F7VB 5CINL 5INDB 5DK2A 5SWZB 3VU2A 1ED3B 4OGAC 1A22B 4NBZB 4LARL 5A43C 2Q86A 2CDEB 3VWJD 5T1KB 1J10A 3MGOB 3JBG7 3BISA 1ES0A 4UNUA 5D1XA 2YBRA 3WIIL 1QRND 1HYRC 3HZMA 1CDJA 2QSCL 3BZ4B 4YO0A 1DVFB 3S34H 4XPHL 3DXAB 1Q0YH 5CJ8A 3DRTB 3PQYB 3TP4A 4C56E 4L4VD 3LKNA 3HE6B 5AD0A 2P8MB 4M5ZH 3QRFM 4LSDA 5EU5B 2YUZA 4LPWA 1RULL 1NKRA 2P7TB 3BPLB 5DMGC 4JFDD 1F6FB 4FXGA 2HMIC 1F6AA 2ILLA 1NANI 3J8F7 1BFOB 3MO1A 4QXTB 3RIAK 4EEEA 2FD6H 2PXYA 3C08L 2EDKA 3MYZA 1B9ZA 1NMCB 5KSVA 2I9LB 3C5JB 3QWRA 1R5WB 3MRQA 4HUUA 4H26A 3D9AL 1N5AB 1FNGB 2A77L 3MLTB 4YPJA 4LKCA 2OZ4H 5EIIB 2PTTA 3SGDI 2BY1A 4G42A 3RWJA 2ZUYA 3IGAB 5CP3H 1MRFL 5F6IB 5HD8D 3MXWL 4M7LT 5E8EA 4NQDD 5J9PA 2DKMA 3Q5OA 1NLDL 2CIKB 3UAJD 1ACZA 4NCDA 1NJ9B 1EH9A 5I30H 4QRRE 2QEJA 5TF0A 5ESQA 2Y6SC 2VIRB 3O4OB 2DAVA 5HHOE 5BO1H 1IZKA 3QWQB 2XNAA 4WI8A 2XFXA 2ITDA 4XPTH 1MFBL 3DUSA 3LEVH 2I9TB 4ZSOE 3KYOB 4WUKL 1MUJA 1I8LC 5DJZB 5FHAH 4JY5L 2BSSA 2X1OA 4GQPH 4NP4L 1Y6NR 3U6RB 5I8OL 3GBNL 5GISH 2FO4B 1BZ9B 1WBZB 4NZUL 3B5HA 5L2KD 3LKOA 3IETB 3K8LA 3RNKA 5BZDA 4UDUB 3IJYB 4YDLB 4HHAA 1UVQA 2BVOB 1BOYA 3QDGA 4TNWF 1U2CA 4DUXA 4UDTA 5T5FL 4PY7A 4RAVB 5I1GL 4XC1H 3MRGB 1YEEL 5J6HB 4P3CL 4PB0H 3QG7L 4KJPD 3KLDA 3T0AA 3KNBB 3ARWA 3CFCH 5DFTA 4NCC2 4Z77A 3TO4A 1HH6B 2Q8BH 2XI9A 1MCBA 3EDEA 3MV9A 4HEME 3OGOE 1Q94B 1LK2A 2FSEB 1YA5A 1X5JA 2NXZD 2Z4QA 1J9CT 3CVHL 4PFEA 3UTPD 3EYFA 3UJIH 3IT8D 5F72S 4HS6A 5E1AA 3DETC 3EKCA 3UTSB 5IB2A 4FRWA 4PREA 4X5LA 4QHNB 3H9SA 5FIEA 5KSUB 3ZKXB 4L4TE 3QEQD 5I1KH 2W0LA 1IQWH 1YNKH 4MVBC 3QJFB 4NQXB 3ARED 3QEHA 1SYVB 1OB1B 1QUNA 3FO1B 1B4JL 5DS8A 5JNYA 1CDIA 4FP8H 4MCZA 1IKNA 4ZXBB 1JK8A 1PX3A 3FB5A 4JFOB 3C09B 1FGVH 5TQ0L 2H3NB 1XIWC 4YZFF 1FFOA 3V5DB 4P23A 3TNNB 2CRMA 4JEGB 4IM8A 3UJJL 4X83A 3T0EA 2XRAL 3TYFA 2M2DA 2WUBL 5D1ZC 1OAYH 2ATKA 3ME0A 3MRLA 1AXSA 1QRNE 4RFOH 2FHFA 1LE5A 5F9DC 5DD1H 4KROC 4AQ1B 4NM4L 5IMLB 3Q0HA 3DYOA 2JIXA 2BNRB 4MAYD 1TLKA 4BQ9A 1LO2L 5C0AD 4R0LB 3G6AB 4XNMB 4AEHL 1MHHB 4X6EA 1ADQL 5DMJB 4L4VE 4QOKB 2VJXA 2QLVB 5JHDA 5I1EL 1AQKH 4LCWB 5HYFA 5E6IC 4JFDE 2VLRB 3S3SA 4C4KO 3I6KB 3O8XB 4NJAH 1DR9A 5TE4H 1JZ3A 5T5NG 2EE6A 4YHMH 1UWEL 4S1DC 4HWEL 2VSDA 1BF8A 1MCQA 2JTDA 3CDGB 2R1WA 5KVDH 1OW0A 1ND0A 3JTTB 4H0IA 5BVPL 2H1PL 1FBIL 5TGBB 3CVHB 3I85A 1DQMH 1TZIA 1QR1A 2HKFH 3PDOA 3LKQA 4PD4J 2X41A 1CFNB 3SE8L 3SO3C 4XNYH 2G60L 2KDGA 3KYKL 2GSGB 1I7RB 3OF6D 4PRHB 4ZS7H 5ITBL 2NX5B 4G8GA 5CMAB 4NQSB 4JY6A 3ZE1E 2FIRT 5C0IA 2X1PA 1UACH 2AXFA 4NQDE 1F90L 2GIYA 1F42A 3LRSA 4M1DL 1N5YL 1TCRB 4XCYB 4S1QH 4FFWC 3GRWA 3VWKB 3PJSA 3IJHA 3MOAL 5GSRB 5MERB 1A64A 3QNXB 4Y5YB 5DVNA 5IV2B 1NGQL 1S9VB 1C5CL 4XCNA 4EXKA 4NOFA 2GTWA 3GM0A 1KULA 5AAMA 3BPNC 4LHJB 2FWOA 1A14L 3MJ8A 5D71H 2EIBA 4C56B 2BOCB 3SQOL 4Z8FL 3SHSA 1KCVL 4EI6A 3RUGB 1N3NB 5L2KE 1KTLA 3DO7B 2PW2B 3BPCB 1PG7X 4ELMA 2DM4A 2QV2A 5DF0A 3F8UB 3L3OB 3O2VL 3TO2B 1G9MH 3F6LA 1MVUB 1U8LA 4QT5B 3IS0X 4O2CA 4WHDA 3EBAA 4LSQH 4GKSB 3QAZC 1EBAA 3Q5YA 1CCZA 3S5LA 4NKIL 4APQA 1DQJA 1EAPA 3HCVA 2X4TB 3NCYS 3NIGE 5EA0L 3GMNA 4ZD3H 5B4MD 3RIAF 4ZPTA 3KPTA 3IDYC 3M45A 5EFIB 4BA8A 3SCMA 3UTPE 1S78C 2MJWA 1JWMB 3V7MA 3GSOB 1VCAA 1CLOL 5J4MA 3RWCA 2VITB 1WBXA 5GJSL 3ZDZF 3ULVH 1QSFB 5EUKB 2YD9A 1U3HA 1UG9A 3QEQE 1R3IH 2XKNB 4IBLT 4C58B 2HP4A 1CWVA 3ARBB 1HNFA 3DVFA 4F7TB 4KJQC 3S98A 1BEYH 4QRUB 1MAKA 1C7TA 1XR8A 4ZAKA 1PSKH 4ZSOB 1F4AA 4X9BA 2OJEB 4LF3A 1RUMH 3W9EA 4YJZL 2IAMB 2E6QA 5SWSD 2IPUG 4HUWB 2R4SH 2CK0L 3WBDA 1MHEA 1I1AC 1TNNA 1ZT7A 1WFTA 4A2LA 4JG1H 4G8FA 3GMLA 3C6LC 1AGFA 1DDHB 5BS0A 3ZE2F 4MMXC 1I4FA 4LIQL 3O45B 4XMKH 1HINL 3S36X 1OAUL 3RX5A 2BMKB 1QHPA 3PWLA 2EE2A 2MPAL 3DIFB 3I6GA 3U0TA 1F4YH 1RURL 1X5YA 3DV4A 3W11D 5JPNA 2FIKA 3MUGA 5IB5A 2VDNH 4OLVH 1RHFA 1AGCA 3ARZA 3LN5B 3MLWL 3CFEB 4WDIA 5GRUH 5JXAH 5C7XH 5E5UB 4L9LB 5C0AE 4WI7A 3BGFB 2HA1A 4KY1L 1HHGA 3IDGB 1SJHA 5EZJB 1FFPA 1QNZL 1HWHB 1CLZH 4AG4H 2X4OA 5IW6B 4PJXE 5AUMA 1Q0XH 5HI5C 4UILL 3IFNH 2J5LC 3NAAL 3PABA 2FNBA 2WWKO 3ALPA 3O2WL 2NZIA 4ZOAA 1OT2A 2C3GA 4F2MB 1K5NB 2BVPA 2YK1H 1X3DA 4YHOH 5E8NA 4R96B 4JY4A 2ED8A 1KTKE 3L95B 2VZ3A 5E7BA 3VFTB 4DGIL 2SEBA 2HYMA 1T4KB 4FQQA 3SOBL 2VN7A 2UZIL 4OD2B 4W4OC 2A2QT 5DJ2B 3BN3B 4WHYG 3STZB 5C8JA 2QADD 4GAGL 5GIRB 1FAIH 3VWJB 1EAJA 4C54A 4F7CB 5JO5B 3GSXA 1RZIB 2CDFA 4UQ2B 5CZXD 2B0SL 5DRXA 1QRNB 5IVXF 3SO5A 3VRIB 5E8OB 4FG6D 1KLFA 4K94H 3CSYA 4HXBL 4B0MM 4YBLC 4BQ6A 1IM3A 2PTUA 3UZQA 4I18C 4HGKC 3SDDC 2F53A 5D2LF 3R8BB 4LOUD 2VDRL 1V7NH 4MQ7A 4P3WA 3VRLE 5H35A 4KZDL 2C1OA 4P2YA 1FIGL 2VLLB 4LLYB 5C0BB 2RFXB 3CFBA 2DYPD 4HJGB 3WIFA 2ZJSH 3BQUC 3S5LG 3GGWA 3RDTD 1RJYB 5K33A 3AS0A 1G7HA 4UBDC 4XCCL 5DJ0A 4NBYB 3DRQA 1N0LA 2EDYA 3GSWB 3RVWD 1RD6A 4X6CA 4RNRA 1FO0A 1TPXC 3L3JB 3TT1L 3ZYOA 3VD9A 3NIFF 1J1OL 5A2IH 3LS5L 1F13A 5D70L 4NQDB 5FHBL 4DGVH 1TTGA 2NY6D 3B5TA 4HBCH 2DMKA 3OB0K 4GXUM 2QL1A 3FT3B 5KSBB 3O6MH 5EO1B 5CCKL 3BXNB 2VERN 5JUEH 4IS6A 5DO2C 4YWGH 1INQA 3CFJB 2GYSA 2VUOA 2N7AA 4WWKA 1ZGLB 5GGSA 1BLNA 1F02I 2OXHA 5SWSE 4Y4KB 3KS0H 1LNUB 1ZVHA 1VENA 4XNXL 1P1ZA 4NT6B 5TE7L 4OSUL 3U30B 1FG9C 2EH8L 2BSRA 4ONGL 1UXSB 1I8LA 2VZUA 1NGZA 4QXUL 4BH8A 5L2KB 1W0WA 4N8CH 5FKAB 3TZVC 1H5BC 3AS3A 3V0WH 4U1SB 1PLGH 2IANB 1OD9A 4Y4FD 4MJ4A 2H6PB 1EHLL 5KN5A 2NY2B 4LCCB 4JQXC 1X9QA 4UU9B 3RWHB 4HKBB 1TQCB 1FZJB 5SX4H 1U8MB 4KAQH 5GPRA 3IRZA 4YAQA 4G9FD 1QP1A 3V4PL 5D5MA 4EDXB 4MYWB 1WAAE 5GRWA 4KVNH 5I71B 4N0UA 4P57A 5J0BA 3WO3B 2NXZB 3R1GL 3IDXH 4E0RA 3ZSSA 4U0RC 4AY0A 2R8SL 4JRWA 2W9EL 1T66D 5GS0D 4E41B 4A6YH 4HLJA 4ESKA 1IEBB 4P2RD 2FJHB 2HT2D 2X2YA 2P24B 1PYWB 4CGTA 2ZCLH 1TJGL 1X5GA 1A1MA 5DTFB 2NR6C 1P7KA 1CD8A 3OKKB 4N0RA 1A7OL 3AREB 1XGTB 2M26A 4ONOA 4LVHB 2YD6A 3K46A 4ZNEA 2GW5A 5I0ZA 4WW2F 1ZANH 3T1WA 1C8PA 4NQUA 5EUOE 2ICES 3SDXB 3HHRB 4FFZH 2WWKT 2GT9B 4I2XE 1ZLUH 3OHXB 4JFEA 4OZHE 3P0YH 4IRZH 5GS1A 3B6SB 4NBXB 4QGTA 5CGMA 3VE0A 4I48A 4WJ5A 1AE6L 1G9MC 2ICWI 5ACZA 5HJ3A 4I0PC 4DUWA 1Q1JL 3L9RA 1CL7I 2YPVL 2R0KL 2OTPA 5BOZG 1ODAA 4PLKC 4K3JH 3K4DA 4S11A 3RTQD 1FRGH 3UPAA 3VG9B 4XAKD 1I8IB 3GB7A 2O5YL 4MAYB 1C12A 5DUBB 1IGIL 4TULH 2GK0B 1GZPB 3QIBC 3T0BA 2ZCKL 4WTWA 2JF1A 3RL2A 4PRPA 1KIUA 1RK0A 3GSQB 4PY8J 4TOYL 3U4BH 4PJXB 1P4IH 1A4JA 4JDZA 1ZGLM 4FZ8H 4PJBF 3ES6A 4ODXA 3ULVC 1HSAB 2ZNXA 1CFTB 4NQVB 1RIVH 3WN5C 1CDUA 5E6IA 1EGJA 5SX5K 4NM8L 3THML 1JYNA 4OD1H 5GGUA 1RZGA 3D0VA 4YBQC 1E4JA 1A6AA 4XMLH 1BJ1J 2DQDH 3WJLC 4M4PA 5HHXL 3RKDD 5E2UL 4LKXA 3ARFC 1D5ZA 2Y06L 3RY6A 1CG9B 3ESVF 4FQXD 3CDFA 3QUML 5IT2H 2VE6B 2W0PA 1VFMA 2IBBA 5CD5C 3FO2A 4M7ZC 3MLZL 4MB3A 3S3PA 3QEUA 1M05A 1A6TB 3OAZK 2DQFA 5J8OA 2GI7A 1YC8A 2HN7A 2YD3A 3E0GA 1YEIL 5HHPB 1GPOH 3FFCA 1H3GA 3T1FA 5ANMA 2V7HA 3KPPB 4C83B 1TVHB 3RAJL 3VXUD 3IVKB 2MQ0A 3INUL 3BWAB 4MD0A 1JHLL 4XTRD 4HJJH 1LHZA 4X9IA 1LGVA 3VFPB 4ODWA 4O58H 1PFCA 5CP7A 2DQTL 1J11A 1R24A 4X5XA 1INDH 3GSRA 3CMGA 1M7DA 1YMMD 5INCA 4EKXA 1MIMH 3CDCA 2LU7A 2XKUA 3DUHA 4EQ2A 1J0JA 4TUOB 2FX7L 2VDPH 4EVNA 3ULUF 4NRXB 4YDJB 4P9MH 4KJYA 5A2LH 3IFOB 1VERA 5E00A 3QUZB 1FVEA 1MI5B 4P9HL 4EXPX 5E5MA 2ZG2A 1S3KH 5DQ9B 4IOIA 1U3ZA 3G5VA 4LCUB 2AJSH 4NWTH 4ODSH 1BM3H 4G9FE 4MJ2A 5HYEA 2H2SC 1MFAH 5DHYA 1EHAA 3HUJA 4PJ5D 2CIIA 4P5TC 2JJVA 3WEXA 2C3VA 4HT1H 2UV3A 1KELH 3MOBL 3QHTC 1FSKB 3TIEA 5FOJA 5I75B 1WZKA 4MJID 3LEYH 4R4FH 3MNVA 3KWWB 2X4UA 1CE6B 1IM9D 1G7QB 4M6ML 4XCEA 2FHCA 4HMEA 5FCUL 4P2RE 4Q97A 2EXYD 4Q9BA 3BFOA 5IKCA 1U8IB 1EEQA 4HC1H 3LPFA 3KJ6H 4LAQH 2JCCE 3QUMB 4K94C 1AXTL 1XF1A 4AL8H 2L7UA 1OGAB 2OTWB 4JM2D 2ICWB 1D9KD 1IT9H 3DHJA 4L3CB 3SDYL 3KHQA 1X5FA 5F7UA 1C1EH 4UNVA 1U3YA 2WBJD 1BGXH 2C7UB 4ZTOL 3E2HB 4JQVA 5DRZB 2F58H 2ZKHH 4Z0XA 2CLVB 4LVNC 1H3PH 3C6LA 5EULV 1RZFH 3FQNB 1OM3L 4Y88A 3P9MA 1U8HB 1QPPA 3LN4A 5AZEL 5IVXB 4HK0B 2EDJA 4XAKE 3SE3A 2B4CL 3AM8C 3GSUB 4X4ME 4AJ0A 1OAXL 3MRIA 4K7PX 2I60H 2VABA 3T3PF 4CVWA 5JW5B 1FYTA 1A5FL 1P7QD 3BKJL 4YHIB 2OZ4A 2LU4A 2CJUH 1UM5L 3PHOB 4HIXH 3P9LA 2FATL 4QRTB 4ELMF 5GZOC 5EZIH 1EXUA 2K7QA 2JK5A 3CUPB 5DUPH 2ICEB 3O3BB 5EZLA 1AKJD 3KPSA 1CGSH 4GRWE 3SGEI 1NFDA 2JJWA 1TQBC 1K8IB 5E95B 3O2DH 4M8VA 2DDQL 3WNOA 1BBJB 1AGEB 3D2UB 5IMMA 5H37H 5I18L 4U7SA 4FNLL 4DTGH 5EUOB 2X70B 3RI5K 2VZTA 4Y2DD 4LVOC 4KPHH 1AD9A 1CK0H 5L88H 2Y07H 5C08A 1CFSB 2VXTL 3DX8B 5FO8B 3I6LD 4HWBL 4JHAL 5EO0B 3PGDA 4M3JA 2J6EL 1OQXA 1PY4A 3C6SB 5IMKA 3LQAH 1K6QL 4NFBA 3U36B 3G5YB 4W4OA 3MBEC 4H1LB 3QR2A 3STLB 4KK5D 3PL6C 4XVUC 4U1HA 3TC9A 4MX7B 4OAWB 1T0PB 5JW4R 5EU7C 1W0YT 3VXUE 3SJVD 5F97E 4HX1B 4HKZA 4Y5XC 4KC3B 4XBGA 4F7EB 4I0CC 4YHLH 1NMAL 3HNTH 4JGMA 4OCSH 2YA2A 2EH7L 5TFSH 3JZ7A 3A6BH 4LNRA 1BX2B 2I26N 3GSVB 4PV9A 1JN6B 3JUZA 3JV4A 1FNEB 4KK6C 4DQOH 1XR9A 4X7CC 3L3DA 3WD5H 1J8HA 4I18A 3X14A 3G5ZB 3B4NA 1YMME 2EE3A 5HGAB 3VXNB 2X7LA 3Q48A 4HFUL 3ARGB 4CDGC 5F1IA 5F96H 1PKOA 4JFQA 4MSWB 1JZ5A 4D0CB 1QACA 1EPFA 4F9PA 1T1XB 2A6DA 5DEGA 5JIIA 2GFBB 4PS4H 1URLA 2GCYA 4M7JH 5ENWA 1EEZA 1EDQA 3JWOH 3TVMD 3WS3A 1GZQA 1WQVT 5FV2A 3FZUC 3OKLB 4PJ5E 1BVLB 5F9WC 3TBSA 3BW9A 4ZNCD 2Z8RA 3V0AC 4MZ3A 3TIDB 4HGWB 3P11H 1LD9A 4Q6IB 1J18A 2NY4D 2X1WL 1DLHB 2XZAL 5D6CB 4MJIE 5D9SA 3QO1A 3GBLA 4K55A 2NTFA 2ADJA 2LFGA 4P4KB 1NC2B 1T20B 2CMRL 1T5XB 2DIAA 4B7LA 2WAHA 2VWEE 3L1OH 4GG8A 2UWEA 1F3JA 1U93A 3IXTB 5KG9A 1INEH 2GUOA 1GC1L 4O51B 1IKFH 4NYLB 1KPVA 43C9B 2IADA 4LEOA 4EUPH 3I3DA 5EU4B 1T0MB 5EC2B 3V5KB 3S37X 4XHQA 3T4YA 5CJQL 1AFVH 5I17B 2W0FA 1F58L 1SEQH 1FJ1B 3BP7A 2V5MA 3RWIB 4ZPVA 4IJ3B 4JO2L 5JW3L 5D7IE 4D0BB 4WTZG 4NHUB 5FO9A 1I9JH 1MFCL 1H5BA 4JFFD 1MFNA 1KCSL 1G0DA 1KENL 2KQMA 4L1DA 4XVJL 2W92A 4IRJB 5J7CC 1XGRB 2DLEA 4WW1B 3MJ6A 1OT1A 1UM4L 5IB1B 2VLJD 1MCPH 5B22A 1KLUA 4GLRI 3WO4C 1R0AH 5IBLD 3FHQA 4F3FA 4YUEH 2DIJA 3VXMB 1OP5K 4RWHA 4EN3D 4PB9L 3W0WB 2VAAB 3FTGA 1CS6A 5GGRY 1LO3H 3BEVB 4OM1H 4U33A 4MA1C 1JF1A 1ONQA 1CGVA 2DI9A 4KQ3L 1YNTA 5LCVL 4LPUA 3GZKA 5T1DL 1HKLL 2JB5L 3HZVB 3L5HA 4M62L 2X1XR 4BSVA 4UAOC 3I6LE 3CVIL 4TNVF 1J5OH 1E6OH 2NZ9D 1CICB 5DRNB 1WTLA 4LRNL 1A6VH 2F15A 5DD6A 1VFOA 2QQLL 2HFEB 3OKMB 4WVRA 3WFCL 2DTSA 2IQAB 1ZT1A 3MNZA 1WWBX 1NGWB 1CDBA 4LASL 4LHUA 4OZGA 3RTQB 3SKMB 5K93A 3SJVE 5HGDA 1OCWH 4LLWA 3UX9B 5KTEH 4NKOA 4IOFC 4FQIL 3FOLB 3U48A 3MYJA 3WFBH 3I75A 3F12A 1GOFA 1OAKH 2FL5B 5C6TL 3SPVB 1A6ZB 3QIWD 5CINH 4CN4A 3D85D 3BWUC 4GKOA 1G7MA 4YGVA 3MRBB 3V8CA 1N2RB 3NA9L 3ROOB 4LARH 2ADIA 3LV3B 2R2BB 2YC1B 5E5RB 5JPMA 3QIBA 3HPJA 4OM0L 5HHMD 3HE7A 2PYEA 2Y5TA 5EIQA 1OVZA 3E3QC 2I27N 3WIIH 5GS2H 1NBYB 3OXSA 5E03A 4K3DL 3ROLA 2W91A 3H9YA 2QSCH 5B3JF 4OFPA 3IFPA 4HMCA 4OD3L 4NUGL 4XPHH 5IM7A 2WIMA 2R0LL 1CD1B 5HTSA 5E6YA 5D1QD 2EDRA 1T03L 3QUXC 5BJTB 3LD8C 1NCAL 4NJ9L 2CLZA 3KYNB 1RULH 3D39A 3EO9L 2Q6WB 1GSMA 1CLCA 2WQ8A 3C5SB 2G75B 3H7BB 1B88A 2EDHA 5CHNB 3ARFA 3IDIB 1PZUB 3EW3B 4PJAA 3C08H 3VXRA 1R3KA 3QHZL 1E6JL 4O5LL 3RI5F 5F88A 5I74B 2CRZA 4ZFOL 3D9AH 2A77H 5HYSA 2Z31D 3D69B 3QNYA 12E8L 1AO7B 4WUUA 1N26A 1QFWI 4AIXA 2E3VA 1MRFH 2E27L 4LSVL 3MXWH 2H32H 4PRDB 1TITA 5EC1B 1NLDH 4PTUA 4UT6L 4WEBL 4N8VG 2AVGA 3EZ8A 4JLRA 5DK0A 3ARPA 4MDJA 5EU6D 5HHQA 2XT1B 5GSVA 3DVNB 1EVUA 2HRPL 1HOCB 3U46B 1J05A 5F3HA 3R4DA 4Q0XL 1A47A 4Z7UA 3UCRA 2OLDA 1YEJL 3DROA 4MNGE 2ZSWB 3G04A 1MFBH 2HJLB 5ERWB 4FQHA 4XGZA 4ENED 4WUKH 1RK1A 4JFFE 5ID1B 1P2CA 3WJJC 4AIZB 1MH5B 4JY5H 5I66A 4NP4H 4PJFA 1N59A 5I8OH 1FNHA 3GBNH 5IGXL 3V6FB 1KIPB 1NANH 4NZUH 4BM7A 4PJ5B 2ARJQ 4OT1L 4GKNA 1G7LB 5IB4A 4Z7OE 1AR1C 5C09B 2N1KA 5DMYA 2VLJE 4MJIB 2NW3B 1ZMYA 2ZUUA 1WZ1L 5IVZB 4TSCL 5T5FH 3NCEB 3W9DB 2Q76B 5I1GH 1HQ4B 1YEEH 1IM9B 4P3CH 3QG7H 1BOGB 4QHKI 5F71A 4XXDB 2OYPA 5JORB 4PR5B 1CXEA 4G5ZL 3QXTA 5KOVC 2GY7B 3UDWA 2MKLC 5IFAL 1B90A 3QUYD 4JM2B 2YPLA 4LLQA 3IKCA 5E8PA 2GJJA 3CVHH 3GNMH 4UV4L 4HIIA 3DGGA 1NUDA 4J3WA 2RB8A 2F74A 3RBGA 1ZTXL 2HAZA 3GUTA 2FCBA 1U58A 2Y9RT 4P3DA 4J3VA 4LHUG 3MJ7A 1NDGA 1U8PA 1IFHL 2D7QA 4QYOA 3OKDB 4PY8I 1B4JH 4QNPF 2AJZA 3G6JF 3FONA 4YK4B 5KVEL 1KIRA 3GHBL 4U1LB 1UEYA 3JWOC 3MLRL 2C3HA 4MNQA 1U8QA 5TQ0H 4JCMA 1QQDA 4JR9L 4YBHA 1IC1A 1BBDL 3HZYA 4S1RL 2ZUQC 4JKMA 3QQNA 3WIHA 3UJJH 5FUCE 2DN7A 4D8PB 1MWAL 3VFRB 2DF3A 2XRAH 1NGXA 2WUBH 5HHME 3AU1A 3P0VL 2P5EB 5EPMB 4P2QA 1RUKL 5F9OL 3OTTA 4EIZC 3ILQC 5HGBA 4NM4H 1JPFA 3R06A 3VDAA 5MI0B 3ARUA 2PO6D 5FCSH 4Q58C 1LO2H 4S2SB 3TFKD 4HKJA 3Q2CA 2OQJB 3RVTD 4AEHH 1WFOA 4M7LL 1ADQH 2IBZX 3HUJF 2EDBA 5T1MB 3IAGC 5C92A 2ID5A 1ZHLB 3T77B 5I1EH 3EYVA 4YGAB 1FZMB 4JGJA 5IOPB 1CQYA 5F6HJ 1VACA 1XEDA 1AC0A 1NH6A 2ZSVA 2BNQA 4QY8A 5F8QC 3QA3B 2X4NB 1UWEH 1EEYA 4HWEH 3DLQR 3VI3F 2GY5A 1UC6A 2VKXA 4ZOEA 5LWYL 2NY5L 4LLDA 5BVPH 2H1PH 2WP3T 5CFHA 1FBIH 4JN2B 2F54D 1U9KA 4QCIB 2WLYA 2DQEL 1IGYA 4NC1E 3L7FA 3SJVB 1FZKB 3BO8A 3SE8H 4N68A 1TETL 2G60H 4PJDB 3PL6A 3KYKH 1QD0A 3ZYJA 5I16A 5ITBH 3LKRA 3WLBB 5C07B 4MDIB 4JM4L 1AIFA 5F7FA 4Y5XA 1F90H 1GOHA 4KKLC 4M1DH 1N5YH 1NFIA 1T7ZA 3L6FB 4FTVA 2R1YB 4RQQB 4NNXB 2OL3L 3IU4L 3MOAH 4NWUL 3REVB 5EU6E 3BPLC 4WNQA 1P7HL 4XHJC 3O0RL 4XX1E 1PBYA 1NGQH 1YEGL 1C5CH 3V0VA 3HG1D 4A6YA 4QGYA 4QRPD 2Y7QB 3PWNB 3OGCB 4JZJA 5IROC 4PP2B 1A14H 1AQDA 3TVMB 3ALXA 3SQOH 3QNZA 3LKSA 4MHHI 2FB4L 4Z8FH 1H9VA 2H9GB 4NZJA 1KCVH 1S7SB 1CIDA 3R0MA 5MHSD 2L4OA 3F5WA 4R26L 3V4VL 4ODVL 1YPZE 3OXRA 4RFNB 2NY4B 3H8NA 4PGDA 5F6IC 2NY0B 5D7JA 3O2VH 1P53A 4JFPA 1NFDF 1NMBL 1T1WA 3FO9A 2E6PA 4HJ0D 5A2FA 1F2XK 1JPGA 5IJVA 4GS7B 1MFEL 1BP3B 4LEXL 4NKIH 4KRNA 3OKNB 4GW4A 4Z7WA 5K9KB 1IAKA 4POYA 3O4OC 1FVDB 2HJFB 3KPOB 5EA0H 4QRQB 4BJLA 4ZQKA 4M4RA 5IB3B 2EICA 4TTDD 3ZYIA 3O3EA 3K2UL 3BD4A 5IHLB 4F7PB 3RWEA 3DHMA 1A02N 1CLOH 2VH5L 4D0DA 5CLWA 3FB7B 5GJSH 2Y25A 1OTUD 1QA9A 5FYJD 4ZTPL 5FK9A 1MCJA 4X98B 5IG7B 1DN0B 4YDLC 4GAJL 4MNGB 1KJMA 4Y89A 3CZFB 5F89B 1QFWM 5JDSA 4JFFB 5C70A 3UJTL 1VADA 1Q9LA 2CK0H 2XIDA 3QDMA 4LGPB 2OL3B 2Z93B 5JW4N 1U8KA 4Q9QL 3O4LA 1JZ6A 3BGAA 4OF0A 3DI2B 2PYFA 4LIQH 1HINH 2HLFD 2VLJB 1OAUH 1MCCA 3KS0J 2MPAH 4UINL 2BNUA 1I85A 4RGND 1PVHA 4OCXL 4IMKC 1RURH 1DEEB 5HDLA 2VUYA 3O6FD 5FYLD 3MLWH 3VXPA 3NZ8B 3ZKXC 1UCTA 5E94A 3PE9A 4N5ED 1I8MB 4H25B 4YHNB 4KY1H 4Y19B 2FECI 3ZE0F 1YUHB 1QNZH 2A9ML 3QQ9D 1QSED 4HZAA 1HE7A 4UILH 4ZXBC 3X17A 3NAAH 1OWWA 3C09C 1A4KA 3LRHA 5AZ2L 3BIAX 4OLYL 3O2WH 2XG5A 4X4YB 1MJ7L 1SYSB 1JTOA 2A83A 1QFPA 4M61B 3ZDZE 2WW8A 4PRIB 5F7EL 4DN3L 3AGVA 2XTJB 5DFVD 2F54E 1K4CB 2OR9L 3D18B 3MRFA 2AK4A 1IVLA 4DGIH 1EFXD 5A2JH 3SOBH 1U3JA 2GJ6A 2UZIH 4F33A 5C0CA 5DVMA 4XNQB 2XWBA 1PQZA 4R0LC 4GAGH 2MHAA 1PZ5A 3PDDA 2YXFA 3DVGB 3MV8B 1Z3GL 2A6KB 3ZE2E 4NO0A 5F7NC 1QG3A 1QRKA 2B0SH 5D1XD 7FABL 4RAHA 1CGWA 1EX0A 3D3VA 3H0TA 4GO6B 4FABL 3O8XC 1RZKL 1KB5B 1DBAL 3HG1E 4HXBH 4QRPE 1X7QA 3UTQB 2P5WB 5D1ZB 2CUHA 5CIPB 5IEKB 5DD5L 1VGEL 4EI5A 2VDRH 3TJHD 4XAWL 1LK3L 2IPKA 4HG4J 5MHSE 5C0JB 4JFXB 1L6ZA 1XH3B 1FIGH 1NQBA 3L3GA 1FVCB 2YSSB 5EN2B 3KXFA 2X42A 3MRJA 3EOBB 2DJSA 2FH6A 2PXYD 4GG6B 5D2NE 3HB3D 4IDJL 4NO3B 3VWKC 3QWRD 2J12B 4AZ8A 5EOTA 4XCCH 3EDFA 2A74A 2YA1A 5HDOA 1KSRA 3N0PB 1RQ5A 4IRSA 3MGTA 5F7LB 5J1AA 4Y5YC 5JA8B 1ZEAL 3T0VA 1RIHL 3NFNB 4WHCA 3TT1H 1J1OH 1KPUA 3LS5H 5GGRA 5D70H 5EH1A 5FHBH 4OZIA 2NW2A 4WI3A 3DI3B 3KLHC 5DD0L 5EU6B 3IXAA 5FYJE 5CCKH 1MHCA 3CCHA 2ZUSA 2VISB 3MRPB 5BQ7A 4XH2A 5T3ZD 1R3JA 3RZCA 5J13B 1UKTA 2N56A 4Y5VB 4OZGF 4OCLC 4ZO6A 2V5SA 3P77A 1K2DB 2QSVA 4OZ4B 4JN1L 1CVRA 3G6JB 3O2DA 4OUUA 4CU6A 4XNXH 5TE7H 1FN4B 1I1YA 4KQ4L 4OSUH 2D31A 2EH8H 4ONGH 3MLUL 5D2LE 5DFWH 1KN2L 4ORZC 4QXUH 4K23L 4LFHG 4BSJA 4LPCA 5DJCB 3T08A 4ZG1A 1R5VB 3QDGD 1XFPA 1EHLH 3ZKND 1JGUL 1KBGL 3AAZA 3UBXI 4RGNE 2DQCL 4FQJL 1EJ6A 5LAXA 5C0GA 3ULVF 2NLJB 1XF3B 3W39A 1SY6A 3BAEL 3U4EA 5FYLE 1ZLUK 5CBAB 3RVVC 2Z92B 3B9VA 3OJDB 3V4PH 1G1YA 3TO4D 4JAMA 3ARBC 3MV9D 4HCRL 4Y2OA 2ZUTA 3E6FB 2ZNWA 1OAZH 3ZT7A 3FHAA 5ICYA 3R1GH 1I8KB 4KKBD 1QSEE 1YYLL 2R8SH 3B8SA 3ALWA 3E6HA 2EECA 1Y6MR 2W9EH 4PJAF 4HG4K 5EBWA 4ZDHA 4WFFD 1R3LB 1TJGH 4Q7DA 4Z0BL 3H9SD 4CW1B 3ET9F 3SKOA 4MA7L 1U6AL 1KTDA 1ZVSB 1A7OH 2E9IA 1DL7L 3FRUB 3P4OB 1FCCA 1M6OB 5E9DA 5FYKU 4FMFA 3B8YA 3ARDB 3LAFA 5T1LA 5DR5L 4OBSA 1ZE3C 4L5FL 1JZ4A 3LVEA 3RU8L 4YR6B 1FFNB 4KUCD 5EG6C 1HQRA 4P23D 3JV6B 4L9LC 1NAML 3U0PB 1I3VA 1YNLL 1AE6H 1UXWA 3T0ED 5IQ9A 5JW4Q 1I1AB 3C5ZD 1Q1JH 4Z7UF 2YPVH 3DURB 4YEEA 4FXKA 4KJWC 4Y1AB 1T83C 3MFGB 3C60A 5E8DL 2O5YH 2JIXD 5GGTL 5DYOA 1IGIH 2XZQL 2V5YA 2WV3A 2ZCKH 2MCPL 2I07A 2PKDA 2PN5A 1GCFA 1ZHNA 2I5YL 4TOYH 2BVQB 2R4RH 1D5MB 4R4BB 4BH7B 4PGEA 1K3IA 1YDPB 5JHDD 1TTUA 3G08A 4DKEL 4X99B 3MFFA 4G6FD 2GHWB 3GEWB 1EVTC 2FR4A 4BELD 3T0WA 3MLXL 3O6KL 5L8KB 4GXVL 1I9IL 1JWUA 4PJIA 2H26A 4WEUD 4TSAL 4WGVB 2QHLA 3IDNA 3RWDA 3FQXB 4NM8H 3THMH 1KJVA 1RSFA 4CADB 1B2WL 1PEZA 2J5LB 3BGMB 4HULB 3ZKMD 3MRMA 3VWJC 1EK3A 5INDA 3F7VA 3OB8A 2AXGB 3IDUA 1XCQB 2A6JB 4R7DB 2QBWA 5HHXH 1NGYB 5E2UH 2CDEA 2Y06H 5T1KA 1BIIA 3QUMH 3MGOA 1JYWA 2D4FA 3MLZH 2ERJC 4I5BB 5CLTA 5F7DB 3CSPA 3ULSB 1A7BA 2C5DC 4UIMB 1BD2B 3CJJA 1W0VB 4ERSL 3BZ4A 1T7XA 1DVFA 2Q8AL 3EYQC 3P40A 4HIHB 3S3JA 1YEIH 2B1AL 1JYVA 2D0FA 4AT6A 3DXAA 4O4YL 3DRTA 4Q2ZB 3PQYA 3DMMB 3HE6A 5T3ZE 3RAJH 2P8MA 1WIUA 5ITFB 3IJSB 5EU5A 3INUH 5FM8A 5HYQB 1OTTD 1JHLH 2P7TA 1H3TA 1ZHBB 3MR9B 3MX0A 4NSKB 3WV0A 1MEXL 3UBXB 1VFUA 4NKMB 1RJZB 2CO6B 4XRCB 4QXTA 1CD9B 2DQTH 5FA4B 1F4XL 5IROA 5CAYB 1M71B 4CAGA 1KEGL 1JGLL 2I9LA 4YXKL 3QP3A 3LIZL 1R5WA 5MEOB 4XPBL 2WBKA 2FX7H 2B1HL 3SDDB 1N5AA 1FNGA 1JUFA 3GJFA 2YHGA 3BH8B 3KYMB 4NZTL 1RAMA 3MLTA 4HS3B 3BD5A 3QDGE 3TM6A 5EIIA 4P9HH 3LQMA 1OHQA 3AROA 3IGAA 1I9EA 4APQD 2CIKA 3N85L 1NJ9A 3MV9E 2WINB 2UY6A 1ZA3A 4KV5F 2VIRA 4L29B 3MOBH 2LTQC 1BPVA 3SCMD 4PRAA 2DM3A 1NUNB 3PGCB 1DQTA 2N4IA 2OP4L 4M6MH 1QVOB 3G6DL 5FCUH 5DVLA 2I9TA 1J0YA 3KYOA 3U30C 2XN9B 4WFFE 5DJZA 5L8JB 1U3HD 4PG9B 5DEZA 3H9SE 5I1JL 1D6VL 2KZ1B 2XYCA 3U6RA 2AJUL 1GGCL 1S7UB 2FO4A 1BZ9A 1AXTH 4W68A 4F58L 3BEWB 4ZAKD 1D5BB 2NY2C 4LCCC 3IETA 4UDUA 1EV2E 3IJYA 4YHZL 1TQCC 1U91B 4R4ND 4KJPC 2BVOA 2OCFD 3SDYH 1Q8MA 2E9BA 3RVXD 3RVUC 4NUJA 4RAVA 5F1NB 1HEZB 3I02B 3QIUB 3U83A 2DICA 4ZTOH 4Z7NF 5I71C 5JTWA 3KNBA 5BS0D 1SEBB 1NKOA 2NXZC 2FJGB 5DQDL 1R6VA 4NKQB 1HH6A 3T0EE 3MCKB 2ATPB 4ZFFB 1Q94A 3QBTB 3WE6A 5CEZH 2W07A 3HI5L 2FSEA 5IHZB 1OM3H 5AZEH 4CL7A 1SBSL 5ICXB 3TZVB 2B4CH 2LQRA 2MKWA 1OAXH 3EDJA 4IHOB 2A73B 4YHKL 4IMKA 5F3BA 3TF7C 3UTSA 3AREC 2NY3B 2BOBB 2QHRL 4M03A 1A5FH 4X7TB 4AEEA 1J87A 5KSUA 3BKJH 4QTIL 5JHDE 1UM5H 1NBZA 3QJFA 1MNUL 2FATH 1OB1A 3FO1A 4ELKA 5FOBB 3TPKA 5KANI 4JKWA 6FABL 2DS4A 4XI5D 2DDQH 2UVFA 4GT7A 4GAFB 3RHWK 5I18H 4FNLH 2YD5A 3V5DA 1PD6A 3CU1A 5DURB 2VSCA 1Z0NA 4NC0B 1DE4B 5AWNH 1S7QB 2IBGA 1MQKL 4XVTL 5FB8B 2BVUA 2VR9A 3WHXB 4EOWL 1S8DB 1Z9MA 2GITA 3ZTNH 4JVWA 4R7NA 4RSVA 2VXTH 1W72L 3B2UD 4JHAH 3VG9C 1S9YB 2APFA 4MAYC 3MV7B 2A0LD 3VJ6A 2J6EH 5HGGS 2H41A 1K6QH 2EYSB 4HUXB 4BQCA 5ALCL 5IMLA 5BRZB 2D7MA 2BNRA 3IAQA 4PBWD 1WT5C 1FPTL 4R0LA 3G6AA 4KI1A 2DQIL 2X5PA 1MHHA 4WU5B 4BFGA 4QOKA 3UZEA 3QG6B 4MCYB 15C8L 2WIIB 4LCWA 1NMAH 5E2WL 2EH7H 1QHOA 2VLRA 4I0PB 2F53D 3I6KA 4M93B 4QHLA 5HYJA 4KMTL 1EBPA 3CDGA 5FECB 2DD8L 3H9HB 3JTTA 4HFUH 5TGBA 4FXGB 3RFZC 3CVHA 4M1GL 5IESL 4EBQL 1F6AB 4DZ8B 5KJRL 2IWGA 1CFNA 4WFHD 2C3WA 5GGQL 1RY7B 3MODH 5DMGD 3LN9A 2GSGA 1I7RA 4PRHA 1X6LA 2NX5A 3QO0B 5HSFA 2HVKB 5CMAA 4NQSA 4HUUB 2FBOJ 3OX8B 4N1CA 1IGJB 4NGHL 5A16B 3PNWB 1NC4D 3WN5B 1TCRA 4XCYA 2AW2A 3VWKA 3L5XL 4PJ9B 4RA3A 1A9BA 4YHYC 5A3ID 5GSRA 1I3GL 5MERA 2B8OT 4NO5B 3VXQB 1FLTX 3X3FL 3QNXA 4BZYA 4Y5YA 1KB9J 2XZAH 5I15L 5IV2A 2BVEA 1YECL 3BP4B 1QEWA 1UA6L 5D72L 3NPZB 1J0KA 4UV7L 1AGDB 5ESQB 4KRPD 1MY7A 2CMRH 4U6XA 1PY9A 3V6OA 3TYGL 1UJ3B 4J7RA 1W72B 1P9MA 2XFXB 5F9JB 3RUGA 1Q9WB 1N3NA 1GC1H 5DJXB 4WWKD 2PW2A 3BPCA 3UTTB 1YEHL 2DLGA 1ZWIB 1F4WL 1D3CA 3BJ91 4YNYB 3L3OA 3TO2A 5CJQH 5ALBL 3T0DA 4O02L 1F58H 5BZDB 1PW3A 3RNKB 5BS0E 2VR4A 5B4MC 5JW3H 1T21A 5A2KH 1FSKC 5F9AC 1H0DB 1P5UA 5I75C 4PJ8B 2X4TA 2IH3A 1MFCH 5DZOA 3BVNB 5EFIA 4BFIB 1KCSH 4OFYD 1KENH 1JWMA 4XVJH 3TO4B 3GSOA 5CEXB 3FOMA 3QB7C 3S35X 2A38A 3D25B 5HVHB 3S7GA 3MV9B 4X5WB 1QSFA 5EUKA 3VGHA 3JWDH 4GKZB 1RIUL 1UM4H 2XQYK 3EYFB 4F7TA 3FAWA 4WU7B 4QRUA 4AMKL 1FDLL 2DBLL 1K85A 2NXYB 4W6YB 4J3UA 3M07A 4L3AA 2VDLL 5F7MC 2OJEA 5FKPA 3L5WB 4PB9H 1BFSA 1T2QL 2IAMA 4JO1L 4HUWA 3E2HC 1RZ8B 1XGUB 3DETD 3VFUB 1I9RL 4MXWL 4JQIL 1CXLA 3GRWL 3QRGL 2BJML 4KQ3H 5LCVH 1DDHA 5T1DH 1OP9A 4MWFA 1HKLH 2JB5H 4M62H 3O45A 3W11C 1A7RL 3CVIH 2BMKA 3DX9B 3DIFA 4JFED 5B21A 4LRNH 4OZIF 3EO0B 4B53A 1KNOB 2KUTA 3SBWA 2QQLH 4DOHE 1KB9K 3HC3L 3CFEA 1BFVL 1Z5LB 3LN5A 3WFCH 1LWRA 4L9LA 4P9HC 3EJZD 3C5ZB 2J8UF 3Q6GL 5CSGA 3M8OL 3IDGA 3MRLB 4LASH 1HZHL 5EZJA 5JMRA 5F1KC 1Z2KA 4FQIH 5IW6A 3RGVA 4Z6AT 3MLSL 1WCBB 4J3OC 4LVNB 4Q74A 3F7YA 5EZOL 5C6TH 3LEXB 4RCAA 4LSTL 1T83A 3EFFB 4MS8C 4X6EB 2DMCA 2F53E 5DA0B 4PJCB 1K5NA 4OF5A 4PRPD 3EYOB 2O5ZL 4DVRL 5LBSL 1XGPA 5JHDB 1L7IL 4KTDL 4OM0H 4G6FB 4R96A 1K8DB 1ITCA 4DK6A 2WSKA 4K3DH 2Z0BA 5TE6L 4WFHE 3VFTA 5E6ID 5I1CL 1G7IB 2VLKB 4OD3H 4NUGH 3EGSB 4WEMB 4N1EA 4FA8A 4OD2A 1ND0B 2R0LH 1RUQL 1I3RB 2EO1A 1UH4A 5L2JA 4S1DD 4Z76B 3NN8A 3STZA 1T03H 2D7NA 2LABA 4TVPL 1NCAH 2ZCHL 4NJ9H 5B38B 3DX7B 5GIRA 5I6XB 3EO9H 4FG6C 1YY9D 4F7CA 1QLFB 5HI3D 4X6CE 5JO5A 5K59F 2OK0L 1RZIA 3UO1L 4AM0B 1QRNA 5E8OA 1NGPL 2R2HB 3RHWF 4KVCL 1NBQA 4LVOB 4BQBA 3EOTL 4LOUC 3VFMA 3QHZH 4O5LH 4JJ5B 3IJHB 2MSPA 3KLAB 1JZ2A 2CXGA 3CFDB 4I3SL 3PXHA 3FFCD 4I8DA 3ARGC 2PTVA 12E8H 4PJEF 4KTYA 5LXGL 2B4CC 5EBMB 4XCNB 3ABZA 2P48B 3GMOB 4Y4HB 3MBEB 1EFQA 2VLLA 5C0BA 3RDTC 2E27H