4N5ED

42f3 tcr pcpa12/h-2ld complex
Total Genus 60
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
60
sequence length
239
structure length
239
Chain Sequence
AVTQSPRNKVTVTGGNVTLSCRQTNSHNYMYWYRQDTGHGLRLIHYSYGAGNLQIGDVPDGYKATRTTQEDFFLLLELASPSQTSLYFCASSDAPGQLYFGEGSKLTVLEDLKNVFPPEVAVFEPSEAEISHTQKATLVCLATGFYPDHVELSWWVNGKEVHSGVCTDPQPLKEQPALNDSRYALSSRLRVSATFWQNPRNHFRCQVQFYGLSENDEWTQDRAKPVTQIVSAEAWGRAD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural interplay between germline interactions and adaptive recognition determines the bandwidth of TCR-peptide-MHC cross-reactivity.
pubmed doi rcsb
source organism Mus musculus, homo sapiens
molecule tags Immune system
molecule keywords 42F3 alpha VmCh
total genus 60
structure length 239
sequence length 239
ec nomenclature
pdb deposition date 2013-10-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
D PF07686 V-set Immunoglobulin V-set domain
D PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4n5eD01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4n5eD02
4TULH 2X4NA 5EO1B 1F13A 2QSCH 1J7VR 3P0VH 3W0WE 4AH2B 1V7ML 4U7KA 3HNTH 1MFCL 3LCYA 4XC3L 3PWJA 1SMAA 2PR4H 4RIRA 2P5WA 3HZMA 4PTTA 4WVRA 4LSTL 2BOBB 4NN7B 3ELAT 4HGWB 1NAKH 5J11B 5DD5H 2VLJE 5KSBA 3X3FL 5DGRA 4X99B 1OTTC 1A6UH 1EH9A 2XKSA 1OWRM 5MENB 2IBBA 4OQTH 5DT1H 2VR9A 3EOTH 2UZIH 3INUL 3BT2L 4V1DE 4KAQL 4MLIA 4POYA 1OL0A 4OD2A 5F3BA 4WNQB 1TJGL 4M7JH 1MFAH 3VDAA 3SBWA 4DK6A 3TC9A 2HT2D 3HG1A 4YBLB 2PXYC 3BIKB 3O2DH 1KXQE 3WO4B 4R0LC 5KSVB 2VLRE 3L3DA 3FQTA 4R2GB 3BP4B 3H9SA 3JV4A 4EKXA 1IAIL 4JKLA 5SWSB 5F7UA 4MB3A 3KPRB 2NLJA 4NWTH 3TN0B 3MRBB 4OM0H 4XMKH 1ZE3C 3GM0A 5DS8A 1KBGH 3AS0A 1JGUH 2IANA 1IT9H 2R4RL 1AE6H 2GAZB 1LILA 3BOVA 1U58A 3P40A 2A77L 2VR4A 3G6AA 3HAEA 4L9LC 4LLUA 2AXGB 2DQGL 4F2MB 5A2IH 3KNBA 4DK3A 2BOCA 4WFHD 2VDRL 3GMLB 1DQTA 4MX7A 4YDVB 4FQIH 3C8KA 1BFOA 1LQSR 3BH9B 1CE1L 1ITCA 4RAUA 1VGKA 3MGTA 5GS1C 5JLZB 1OQOA 3N1GC 4YFDB 3S36X 1UKTA 4MSWA 3I6LE 3VXRA 2CLVA 4AYFA 1NGQL 5HYJD 2VH5L 1HKLH 5ITFB 2MSPA 3LY6A 5D96C 4J3UA 5IQ7L 4MJ4A 5H37G 1PG7X 1WTLA 3OJ2C 4HEME 4FRWA 1GGBL 4PRBA 1R24A 1KTDA 4NQXA 4OCRH 4PREA 1KEMH 4LCUA 5DMJB 1DP0A 1I1YB 3L3HB 4G8GB 3WIFA 5FKAA 4PJEE 1S8DA 3CH1B 5T3XL 1NBZB 2FIRT 4HUXB 5IVXE 1YEIL 2HVKB 1DVFC 4Z7NE 2F58L 5D7LE 3SE9L 4GBXC 1X5JA 4DGYH 5EWIL 2R1WA 1EUTA 3BP7B 1JYNA 3VGDA 4KKLC 4YFLI 1F4XH 3UTTB 4UUJB 2E6JA 2F74B 1JPFA 3VFMA 2FJGB 5IGXL 1SJEA 2DTSA 3AY4C 5DRWB 4ZTPL 1CIUA 2NY4C 3JWOH 1MFEL 5E5UB 2MCG1 3MCLL 2Q7NA 4H8WH 1QLEL 4J3XA 1MJUL 2DBJA 2X40A 3LPGA 2HWZH 3KXFE 3BPNB 1T80A 2EDXA 1EHNA 2ZNWA 2FLBT 4M1DH 5JR1H 4LHJB 4LHUB 3DYMA 5MP6H 3KLHD 4ZSOA 4EDXB 1WCQA 5CEZD 5FUCC 3QULB 5JNYA 5INCA 2HFFA 2GJ6E 5D6CA 5I8CB 5T3ZH 1KCVL 2FBOJ 3DTXA 3EDFA 5DSCA 5J13C 1N59B 5T5FL 2DF3A 5DD0L 3F7RA 3D69A 3ALWA 3IDNA 3ARDA 2P8MA 5FYKD 2VXVH 5KSAC 4F3FA 3QUYC 3EO1A 3HMXH 4HC1A 4LKCA 4NZRL 3RWDA 2YBRB 1WFNA 2QQLL 4Z7QE 1JRHH 2WBJC 4MX7B 4FXGA 4ZOCA 2D9CA 3F7VA 4OLUH 4U1SA 4LSUH 1WZKA 3L3IA 1FL6A 1FNEB 1UXSA 3A67H 3GK8H 5GQBA 1RIHL 5F6IC 1Z3GH 2BNRD 5ADPH 3ARGC 2CIKB 4ELMA 4AY0A 4DGYL 3G6DH 3MROB 2YA0A 3OKKA 3ULUD 3ARDB 1B0GB 1FIGL 4XP1L 3QUXC 2BXZA 2RCSL 3T1FA 2CSPA 3QDMB 2VYRE 4GMTL 4QHMB 5C07E 3EYSL 5E2VH 3MMEA 4XC3H 4Y5XB 3VFVB 4ODVH 3U0WH 1C12B 3VGFA 1FYTE 1DLFH 2FJGA 1C5CL 1UCBH 5KS9B 2BC4B 1OTSD 1WCBA 3SGJA 2MQCA 5EIQA 4YBLC 2LE9A 2PYEA 4U1HA 3JWDH 4E41A 5H35B 2V17H 1BBJA 1F3JB 1CZ8H 3MLVH 5TDNA 2GI7A 4N1EA 4KMQA 1IKFL 5C0DB 1T22B 4QNPF 4M4RA 1S9KC 5F6HJ 5DI8A 3EDJA 1I3UA 3L5WA 5E2TH 1JHTB 4K8RH 4G7YL 1X4ZA 4HH9B 1LDPH 4UILL 1IEBB 2OTWB 4K7PX 4RGNB 1NLBH 2Z8RA 3IXTA 4G43B 1HOCB 1UVQA 2HTKD 4E0RB 1HSAB 3C60C 5DRZB 2O5YL 3MJ8B 4IRJB 1CD9B 2YA1A 4N9OB 4OQTA 1CDBA 2R8SH 2EC9U 4YDLB 3QDJE 2YBRA 4NHUB 3GSOB 4OIAA 4HPYH 3QQ4B 5HYEA 4QY8B 4NM8H 1PX4A 3WJLA 1QO3A 3N85H 1EEUA 5DJ6B 2AK4D 4OCLC 1IGIH 5LXGH 5T1KA 4MCZB 5IEKB 5FB8A 5IW1B 1AY1H 2VUYA 4CN4A 1G7HB 1MJ7H 2RFXB 1INQB 3V0AC 2MPAH 4EXKA 8CGTA 3FOMB 5TE7H 4LKCB 2O93L 1YYML 4KQ3L 1BIHA 4CU7A 5KSBB 2B4CH 1WIOA 3UYRH 5C0JA 3GKWL 1YQVL 1Z2KA 2MPAL 3TEUA 1MVFA 4XBGB 4F7CA 4QWWD 2AJSL 3GRWH 3ILPA 4RX4A 2C1OB 3IDJA 3GJFA 3IJYA 1KFAH 1YNTA 3K7UA 4QHLB 1KV3A 3MCKA 4KI1A 2XTJD 3G5XB 2AGJL 3REVA 3B5GA 2H26A 3MACH 1IM9B 4Y19E 4OV6F 4GRWE 3LKNA 1ONQA 5ALCL 1AI1L 2AJ3A 1OHQA 2YRLA 2EXYC 2P42B 1BAFH 2AQ1A 4HJJH 2APWA 3DMMB 1NGZB 1I8LA 4U6HA 4X6DB 2JE8A 5JXEC 3GSVB 4CMHB 4KC3B 5DHYB 3RZWA 3W0WA 5FF6A 4Y5VB 5BV7B 4I4WB 3R0MA 5L9DL 5GGRY 4Y5XC 3WIHH 5DUPL 2VXTH 4YDLC 2CPCA 1G7QA 3NTCH 3IJHB 3G5XA 1S9VA 1DUZA 1F6FB 1G0XA 1MLCA 2WP3T 2UYLB 3BGMB 3FTGA 3VW3H 3EOBB 4WWKA 1R5WA 5H94A 3K2MC 3KDMA 3VFVA 3C8KB 3KGRA 3O2VL 1AP2B 5C0AD 3W82A 1I85A 4J3SA 4DGIL 5D6DC 1W0VA 5IOPB 4XNXH 2V5MA 4R7DB 2DLGA 1A7OH 3BPOB 4X9BA 2H32B 3LOWA 3K8KA 5E1AA 2NY1B 4PS4H 1XT5A 5IW1A 3C9NA 2HLAA 1T1YA 4KI5C 4NWUL 3H3KA 2X1QA 1I1RA 3JWNC 2LAAA 4OIBA 1LO3H 2H6PA 3UPCA 5C6PB 4IIQC 3S35L 5D7IE 2F8XC 3QDJD 3OAZH 1X5AA 4LHUD 5IR1A 4GT7A 4C83B 1WZ1H 3IDMB 3H7BA 4A6YA 5DFWH 4ZAKC 2OBGA 2IANE 3GSNA 3KPMB 3GKWH 2V7HA 4I2XE 2OTUA 1NPUA 2EDBA 3IDXH 5DJXA 3TBSB 5CLWA 5HPMB 1TIUA 3S4SB 4XP5L 3KVQA 4KXZH 1A1NA 3PGCB 5DEFA 3NN8A 4HUWA 4U1MA 3UDWA 4Y5YC 4OGXL 2BDNH 1KULA 1IBGH 3GJEA 5HDOA 4RMWA 4JPVL 2ZSVA 3HUJB 3ZSSA 2K9UA 5LBSH 3NIFF 4NQEE 1B3JA 3MRMB 5EU6A 4EQ3A 2Y5EA 5EZIH 5AYQA 4PRHA 4ZS7H 1C7SA 3WLBB 1LNUB 4Z7UA 1H3WM 1LEIB 1KELL 3D9AH 1WBYB 1N7ML 2NXYC 2XFXB 1L7IH 2XA8L 3GSQA 5HGBB 2K7PA 2KH2B 1G7PB 5IKCB 5D7LA 3LRSA 3GJEB 4HMEA 3SQOH 2QSQA 1BVLB 3GBMH 2DM4A 4UQ3A 1EDQA 5L6YL 5JXED 2BP3A 4ZUVB 2W60B 4UAOC 3U36A 5TGBB 3EOYG 1NFDA 1DBBL 1SEQH 3KYNB 3BEWA 5E6YA 5ERWA 3ARWA 3RNKA 2IMNA 2YMXL 3DOSA 3O3AA 3I75B 4BZ1H 1DVFA 4P4RB 1OAZH 4G80B 2GSIA 3IJHA 4N9GB 3HMWH 2GT9B 4Z7VA 1FZJB 5D8JH 1G9EA 4L3AA 2YPVL 3KXFA 4N0UB 3MRKB 5ISZE 3TGXA 3PP4L 2UVFA 2ZUSA 4DZBB 4Y2DC 1H3XA 4ZPTB 5BW7A 3WJLC 5CD3A 3AS1A 4LNVA 3PDOA 3R8QA 3R4DA 2V5YA 4MJIA 1GGBH 4KMTH 4RFNB 4KU1A 4LVNC 1RAMA 3BPCA 5AZ2H 5I66B 5CJOH 1DQJB 4NO3A 3TN0C 1J0HA 3L95A 5DEGB 1UEYA 2OK0L 5IQ7H 3FB8B 4N0CD 1CTNA 1HXYA 1BPVA 5F96H 1OAYL 4NO5B 3TBWA 5EN2A 4OBSA 3O0RL 4OFDA 3SDAD 3TZVC 2FATL 4KZDL 3QWOB 1H3PL 1AD9B 1U8PB 4EI5B 2R1XA 5JW4Q 3NPSC 1EO5A 1P4IL 1CLOL 3PDGA 2PTTA 5D2LB 2BJMH 3LKQA 4YEFA 3BIKA 3SDAC 1R5WB 4G6ML 1MUJA 4UV7H 5K9JH 4V2CB 2EO9A 4FS0A 5DTFA 3VFUB 1F6AB 4GAGH 4P5MB 3STZA 2AK1H 5TDPB 1HNGA 1E6JH 2QHRH 4FQXC 1JGEA 4KUCF 4LLAA 4BSWA 4JFOA 4XNYL 5JO5A 3QNZA 43CAA 3WLBA 3R06A 3RGHA 4JHAL 2QADD 3T4YA 5L8LB 5CSBA 1EO8H 3OGCB 3WNMA 5IB5A 5TQ2L 5T5FH 3CCHB 3OPZL 4CBPA 3SKOB 4XNUL 1LO5A 1V3KA 3K8MA 4XXCC 4RQQB 3V7AG 4HT1L 5C07A 1KACB 4GRLB 4ODHH 4XHQA 4MA8H 3U46A 4PY8I 1P53A 1P4LB 4TNWF 4AH2A 2ADFH 1M71B 4LPXA 3IFPA 2HT4D 5BZWA 4BQBA 3CK0L 1S7QA 3EFDL 2XTJB 4FNLL 4NPYA 2PNDA 2QSVA 2BJML 4OLVL 2VWEE 1FZKB 3EFFA 3LHPL 3FQUB 2X4PB 2XQBH 4GKZB 1WTGT 3QEUB 2B0SL 3TT3L 5D1XA 3MLWL 3P9WB 5F96L 3GBNL 4U1SB 3MV01 1DSFH 3S5LA 3BSZL 1GHFL 5D1QB 3QR2A 1KEGL 1AKJA 2HJFB 3RGVA 3RIAF 4GSDH 3QUZC 3WNPA 3GIZH 4JPIA 1M05B 3D85B 3KJ4B 5J4MA 1OAXH 3D0VA 1BECA 4FQXB 3CC5A 1QBLL 1U58B 3RNQB 4ZFOB 1EX0A 4FQLH 1YEFL 3QZWB 4IRJD 2DQUH 4EQ2A 3ZE2E 3N0PB 3E1F1 3HNVL 2AJ3B 1NCAH 1BOGB 3VFTA 4BQ8A 4IJ3B 4Z7NF 2BVEA 4R97C 3IU3B 5JW4M 1OT2A 2AK1L 3VXSD 5ID0B 5DDHA 5ICYB 1MF2H 3CVIL 1CI5A 4PTUA 4QHLA 4TTDD 4ZO7A 4Y8AA 4HLZG 3WFEH 4UU9A 1UEMA 4QRTB 1QVOB 4G6KL 1FP5A 3AXLB 3SN6N 2OXGA 5D7KD 3NFPA 1P4IH 2ZUYA 2FIKA 3CC5B 1N7MH 1ZLSL 2E8YA 2DWDB 2RJMA 5CD3B 1UJTA 4R90H 3NIDE 4GOSA 4AM0B 3QRFM 2XI9A 4DVBB 4WTZA 3QDJB 1FPTL 1NGXA 3FFDB 3BPCB 1FAIH 1KENL 3CFDB 1Q1JL 3UBXB 2Q6WA 2E27H 1KLUB 1KYOJ 1CE6A 1VEMA 2F74A 3GMRA 4KK6D 4O4YH 3VA2C 1HIMH 1DL7L 3ARXA 4OUUB 4DVRH 1KIRB 2CRIA 5DMKB 1R24B 3TO2A 4Z77B 2E7LC 3NFPB 3OZ9H 3GMQB 1E4JA 4QLRA 3MRPA 3O3BA 1K3IA 3N9GL 3H2WA 4OGAD 5FHAH 1S8DB 3BQUC 3CH1A 4YR6B 2OYPA 4N90E 1YPZA 5A1AA 1L6XA 1UQSA 3QCUH 5I74B 3CU7A 5IJKC 4ELKA 3PWLB 1CLYL 4FQ1L 3MLSH 3RVTC 4JKPH 3QFJB 3QUML 3CFDA 3JUYA 4GUPA 3U7WH 5FB8B 4YE4L 2ZKHL 1I8LC 4N0CC 3BHBA 3C5ZB 5F89B 1JF1A 2XTJE 4P99A 3GMRB 1GPOH 3O4LE 3FFCA 2HKHL 3VXMA 3C5SA 3KPSB 1KJ3H 2EDLA 2NY3D 4KUZL 2F54A 3BMWA 4O58L 4LP4A 3ARGB 3MRJA 4XX1E 5C07B 3WUZA 1F90H 2R1WB 3ROLB 4HIIB 3S5LB 8FABA 4HWBL 4FFVD 4JE4B 1EHLH 4OCSL 4TULL 3V6ZB 3MCKB 4MJ2A 1CD1A 2OX5A 4L8BB 4P3DB 5T1KD 3QJFB 2VR5A 1VFUA 4JY5H 2VRAA 4PBXA 3UYPA 1S5IL 3J8F7 5E8DH 2A6DA 1JCKA 4P57A 1KIPB 3V4PH 4MJ6A 3PABB 3THML 4M8QB 1FE8L 4QWWC 3SOBH 1UA6H 3H3PH 2W9EH 1D5ZA 1P84J 1ETZB 3CU1A 5TDNB 4MYWB 1KCUL 5C0FA 4UAOB 1PAMA 1NCCL 1EXUA 2V5RA 4Y7MA 3LEYH 3LKSB 4RZCA 4UT7H 1D5XA 1KJMB 5SWZD 3OF6A 5DUBA 3FRUA 1ZGLM 3GHBH 4OFKA 1NBQA 4NNPL 3WKNA 2ICCA 3H9HB 4HV8A 3GNML 2Q8BH 3S35H 1LDSA 3TNMA 2D4FA 3D39D 3GO1H 3V0VB 1HH6B 3NACH 4PPTA 3QT2A 1Q9LA 4IBLT 4HHAB 5B38B 2YD3A 4PJAA 2QADB 3CLEL 1VEOA 2PCPA 3BISA 1ZHBB 1OTUD 2WIIB 3QG6B 1KLGB 2CJUH 4ALAL 4K3JH 4ZPTA 3G08B 4DOHB 1U95B 4PRHE 2GITB 5CIPA 4RWYL 3Q2CA 2AV7B 3LDBB 2Q86B 5DMYA 3IAGC 4FQXD 4Z7UE 4Y5YB 5IMKA 1H8NA 1P5UA 4P3DA 4OUUA 2VLMD 2DOCA 1VADB 3RY6C 2GK0B 4KQ3H 1XGYL 1YYMH 3O4LB 5KANG 1FE8H 4OSUH 1RZ7H 3VI3F 5C0GB 5DA0B 3QI9A 5E2UH 4BKLA 4MA1B 3B9KD 1BEYL 5AZ2L 3O4OB 3VXQA 1N5YL 4JY5L 3BDYL 1SEBB 4F7EB 3QB7C 1RMFL 1A6WH 3D39E 2P44B 1UM6L 3JWDC 1NFDE 5JTWA 2Z8WC 1W0WA 2AKRB 5E08H 5IHLB 2NW3A 1Q0YL 1YNKL 1IGYB 3K4AA 5IB4A 4JZOA 1U0QA 4O51B 4P2CG 4WIQA 3B2UC 4N8CH 5DF0A 1S7TB 4YDKH 2H1PL 4PJ8D 5F9JA 2ZOLA 1SJHB 1TNMA 3MR9A 3QNZB 4XAKE 1IL1B 2FX9L 5DMIH 2BK8A 3K2UH 4YUEL 4EI5A 5ISZA 3VD4A 4EDWL 1BFVL 3NABL 3RAJH 1K4CA 3WXWL 4U6YA 1Y0LA 3L3HA 1EZVY 3QUXD 5I76A 3NA4A 1CXLA 1T21A 1GOGA 2DMCA 4F7PA 5EUOF 4TOYL 5GS0D 3GEWB 5TE6H 3MYZA 5E99H 3FOLA 2A6KA 3E6HA 5F7HA 1N26A 1Z0MA 2WUCH 5CP3H 2RFXA 3WO3B 1QLFB 3G6JE 3OHXB 1DQML 4P2OC 4S1DC 1ZVHA 2RAMA 1FORL 5SWSE 3ARSA 5JPNB 4WWKD 2A9MH 3PQYE 3DX6A 5D2NC 1HHIB 4PGJA 1P7QD 5DVOA 5MHSE 2XOTA 4ENEC 5DRXB 1A47A 2A6IA 1A7RH 5D6CB 5I1GL 2JLLA 5DJYB 2WAHA 1EBAA 4OF7A 4TPRL 2BVQA 4L5FL 2FR4B 1NANI 1TVHA 4YEEA 2D7NA 1ORQB 4IOIA 2I25N 4RA0C 4FQXA 2NR6D 1A0QL 1NAMH 1SYVA 3CJJA 3G6DL 3CX2A 3BGAA 3CFKB 3S88L 1U93B 1GAFH 1UB5A 2NQCA 5IJKA 1JF6A 5I9QB 4FMKA 4H25B 5D7LD 4MA3A 2EIZB 4GLRH 3WFEL 1J8KA 4K8RL 3VFPA 1KPUA 3CVIH 5EOCH 4R26H 1U41A 1FG9C 5FYLE 2Y06H 3NH7L 5M95B 3EZJB 4LSRL 1MCKA 5JDSA 5JOPE 4GKNA 2Y1VA 1NCAL 1FQ9C 3MFFB 4I1NB 5F44A 4H1LA 4NOBA 3VFNB 2WIMA 4WI8A 4HUWB 3NN8B 5DUMH 3MJ9A 1JGVH 4U6XB 1S78D 1YY8B 4LCWD 3G08A 1B0GA 3V4VL 4PRAA 2CMRL 5D2NE 3EYOB 3ZKXB 5F1IA 3CVHL 4PJDF 4QHMA 5I73C 1RIVL 5E2UL 4E5XA 4O5LL 1X3DA 4WGVB 2F9BT 2JIXD 4PJHE 2B2XL 4Q9RL 5MP6L 5D1XC 3RDTD 3U30B 4L4TA 1CE6B 4YNYA 2X4QB 1MWAB 5AG9A 2NW2B 3S3JA 3NTCL 4XPHH 5F7LB 2R39A 2ZCLH 3MV11 2VXTL 3QNYA 4MD5A 1SJXA 1UWGH 2AJYH 4PP1C 4PRIE 1XIWA 4FFYL 3M8OL 5FM4A 1ZT1B 1C5BH 3OKMA 3CK0H 4N0YL 4XNZB 5GGVL 1PZUB 4N8VG 1TPXC 7CGTA 1NDMB 4ZFZA 1CF8L 3VRJA 1UZ6E 4L8CA 2I5YH 4JDTL 4WFEE 5L0QB 2ZSWB 4P3CL 2P5ED 4P46B 5I8OL 5F3HA 3WKML 5F8QC 1JYVA 3HZYA 3UTZB 1CFSA 4HULB 1IKNA 3KPSE 1T1XA 3RY4A 4JZJB 2OZ4A 2DIBA 3ARFD 2NXYB 1IAOB 5EA0H 1HILB 4FFWC 3VFTB 3SGKC 3CZFB 4ZO9A 4YHLH 2EDWA 1JWMB 3CH8A 2LVEA 3UJJH 5D72L 4LGRB 4OZHA 1GOHA 1I4FA 3QIBD 2BVOB 5F89A 1IGJB 5HHVL 3DX8A 4ZD3H 1Q0XL 4D0DB 1MFBH 3EGSB 5B4MC 5T3ZD 1KJ2H 1AGBA 4HZAA 1D9KD 1MCOH 3QP3A 2F54B 1NCBH 1BREA 4OGYL 2YD1A 4OCSH 1DN0A 1GJIA 5BCAA 3D5OF 1T0MB 5H2BB 1RHHA 5DQ9B 3QXAB 1H15B 5HSFA 1F4XL 1X5GA 1TZGL 5TGBA 1JGDA 3VDBA 5TF1H 2DI7A 5LAXA 1E4WH 3HE6A 4LOUC 4ONFH 1DQQB 2D7QA 3PHOB 3IDUA 1LEGA 4QTIL 1TVBB 1AGCB 1MCFA 3FN9A 3KWWB 2VLLA 5MEQA 1HSAA 1Z5LB 2WQ8A 3DMMC 4GBXA 4RMSA 1MIMH 4EOWL 3HI6H 4NNYB 4NQCE 1I1AB 3RX7A 2P47B 3T0EE 4JFFD 4FQ1H 4KRLB 3RWJB 3GMLA 4AMKL 3ZT7A 4M1CC 5J0BA 5I1IH 2ARWA 3VFSB 5L7XL 4PGBA 3MGTB 3UPRA 1RJYA 1SMOA 1YNLH 1GOFA 4O2CB 2PYFB 1X7QA 1MEXL 4ODBD 1IC4L 4DN3H 5JO5B 5CINL 1C5CH 1UCBL 1WJ3A 3FRPA 1OSPL 4ZQKB 1QR4A 3Q5TA 4IRSC 2AXGA 2J3SA 5C0BD 2HN7B 4OCWH 1WT5C 3BEVB 2AJXL 3I6GB 3VXUE 1FNHA 5B8CA 1PVHA 3CLFH 5CCKH 4LARH 3RUGF 5E8PB 4RMUA 1JPSH 5IMMB 2C26A 2C3WA 4UDTB 2WQRA 3CFJA 1WZMA 3Q3GA 5E6ZA 1QFHA 4LPWA 5B3JF 2J5LC 3ESVF 2NW3B 1ED3A 3WIIH 4PJGB 4Q0XH 5DJ8A 4E0RA 1IAIM 4LSDA 5D93B 4Z78B 2BXYA 4NQVB 4HJ0D 4K7FA 3MR9B 2NTFA 4FQPA 2EEDA 3K8LA 4BM7A 3A6CL 3VFRA 3GB7B 2CUHA 3I9GH 4NCDA 3V95A 2OP4L 2F53A 3SHSA 1KF9B 2AQ3A 5DJDB 1X5HA 1AXTH 2E3VA 3DO7A 4JREC 4PJ8A 2FH8A 4IDJL 1IZKA 1MSPA 4Y5XA 4FABL 4PLNC 1RZJH 1T4KA 1RZ8A 5E7BA 2JB6A 4JQVA 3ZYIA 4NO2A 2H32A 3S8WA 4P59L 1AH1A 1YYLL 3MRHA 1DUYB 4NQTA 5C08D 5DURD 3SE4A 1ZLWH 3AUVA 1I1AA 3LB6D 3TA3D 3T1FB 4ZO8A 1YECH 3EOBA 4RGMB 4YBQD 2A73B 4OCWL 4MB5A 3W9EB 4GJTB 5C6TL 2OJZL 4P4KB 1NANH 4XNXL 3TYFA 2Y9RT 1QLEH 1F58L 3SGDH 1YDPB 4S2SA 5D1ZB 1RZ8B 1BLNA 5E56A 1OGAE 2PN5A 4XWGL 5LWYH 1XGUB 2DQIL 4Z7OE 3ECBA 1QBMH 2ICWA 4GRWB 4G42B 5JW4N 2COQA 1B9ZA 4HUVA 3MLYH 2P8MB 2D03H 1P5VA 4POUB 4M93C 2EDHA 2OQJB 5F7FA 4NUJB 1XGPB 1XH3A 2QTEA 1AFVH 1KC5H 5IWLC 1P7QA 3BKCH 2YC1A 4YO0A 1H3VA 1HZHL 4R4FH 1K4DA 1BP3B 2IQAA 5EZOH 1KEML 1JTPA 4GMSL 3MA7A 1TDQA 3SDXF 4LSPH 3ZYZA 4QGYA 5EC2A 4ERSL 4KJWC 3DROA 3QWQB 4NUGL 4RMQA 3MBEC 4BFEA 4QHNB 1AJ7H 1IGTA 4UDUA 3IDIB 3HI1A 2NY5H 4Y89A 1FGVH 2EE3A 3OJDB 2CDFA 3PQYA 4KJYB 2OQJA 5C0BA 4I9WD 3HRPA 4AIZB 1P4BH 5FUOL 3OKEA 4LGSB 4HUKB 4YO0B 3WS6C 4MGXA 2R56H 1PZ5B 5I18H 4W4NA 4H20L 5ILTH 4HCRL 3IU4H 4M7LT 5IEKA 4XP9L 1NBVH 1T1ZB 4OM1L 1JZ5A 3BZFA 2FYYA 1CR9H 4G5ZH 3ZTJG 1RU9H 2DWDA 5AUMB 5I2IA 1YYLH 2M1KA 2YD6A 5FECB 2W0LA 4RGNE 5C0ND 5E8EB 3LQZA 4HBCH 3D1MC 3ULVF 2ZG1A 5D7JD 4KTEH 2WV3A 2E9WA 2GTZA 3VXMD 2Y25A 4IOFC 1M1SA 3QPXH 1IAIH 5EO9B 1BVKB 2VQUA 4M1CD 3C5JA 4OD1H 5D70H 5FDWB 1EK3A 3SDDB 4M62L 2AJUH 4UT9H 2VUOA 3N85L 4MAUH 2VLJB 4NM8L 1OB1B 6FABH 3U48A 1GGCH 1IEBA 4HWZA 12E8H 4LF3A 4KI5E 2DI8A 1BQHB 2Y6SC 2JJWA 1S5HA 2IPUK 2L7JA 1ZGLP 4MA7H 2Q8AH 2R29H 1LK3L 1SEQL 4EUPG 3VFGL 1S7XA 5D2NA 3QQ9D 3BH9A 4A2MA 2CUMA 3BWUC 1E4KA 2OL3L 4JDZB 2Y5TB 3SGEI 3T2OA 4PJHA 3WFBL 4X9HA 3RU8H 4TYUA 3MRFA 5JIKA 4EZMA 1C08A 3PV6B 2VLJA 2BHZA 5KVMC 1P1ZB 2YK1H 3ARYA 1FV1B 3F7QA 3UPAA 1IFHL 2IQ9H 1MCQA 3CVHH 3DVNA 3U7AA 1MFCH 4ZS7L 4QRRE 3U4BH 4K2UH 1VCAA 5LG1A 3DV4B 2D3VA 3VRLF 1J18A 1T7YA 2XNAA 5C0AA 3MQIA 3BMVA 3ZKQD 4D3CH 5C0NC 1FFOA 5ID1B 3SE8H 3AU1B 4NNXB 5CP3A 2Y5TA 3QIBC 5E2VL 4XCCL 1Q9OA 4G6JH 4XWOD 4YHPA 3TT1L 3O3UN 2HG5A 4XP5H 4YZFE 1CGWA 3CXDH 2VLRA 5HJ3A 3EO9L 1RJLA 3MUJA 4POZD 1LO4H 4OZFH 2D9QB 2O5ZH 4DZBA 2OS7A 1WAAF 1CL7L 1G6VK 3FQUA 4WRLA 1MCWW 2ESVE 1XIWB 1NH6A 1YC8A 4OCNC 5KJRH 4G8GD 2E9JA 2GJ6B 2NTSP 3UXFA 5FA3B 2VABA 1AXIB 1CL7H 1NGWA 3SDXA 5C2BH 2ZG3A 3KYMB 5IOPA 4NQDD 1C08B 3FT4A 4LMQE 3HE6B 4NQSA 3ALXA 2ITDB 2HH0L 3OAZK 3MODH 4UTBH 5DA4A 3MJ9L 3MJ7B 4GKSA 4OCYH 3RVWD 1UCTA 1A7OL 3OQ3B 4F58H 2NYYD 1A2YB 3Q6GH 1NCDH 5DURB 5HI3D 1PY4A 3EDDA 4G8EB 2BRRH 4MXQC 1EJ6A 2J8UE 1OGAD 4HX1A 2DL9A 5E8NA 3U9PH 3QA3A 2NYYC 1WICA 2VZ3A 5I73B 5LGJB 2YPLB 5IFHL 5JORA 4WTWA 3RGVC 3U6RB 2YN3A 4IMLA 3SCMD 1PQZB 1I4FB 1BX2B 3OAUH 4KDWA 3WN5B 5CJXA 1S5HB 3SQBA 2N7AA 2XYCA 5C7XH 1I7UA 2FD6L 4EBQL 3T0EA 3Q5YA 3MCLH 3DYPA 4LCYB 1HILA 1I1AD 4KDTA 5I74C 5M7QA 2GYSA 1WEJH 1FZOB 4ZUUA 3MA9H 5FO9A 4NQEB 1VHPA 2IH1A 1MIEH 2BSED 5I1LB 5EO1A 1KTLA 3AM8A 5LAXB 4LCIH 1T4KB 5GISL 2F58H 1DDHB 1UT9A 3MUY1 1REIA 4WW1B 4QT5A 3IKCA 2VZVA 5HHXL 1V8HA 4PJ7A 2XPGA 2FHFA 4ZSOE 3Q6FA 1HHJA 3ES6A 4C59B 2LQRA 4K94H 1OCWL 2ADIA 4NN7C 5JPMA 5DC4B 1FIEA 1D5BA 3QIWB 4X5WB 4YDVA 1N4XH 4JFYA 3C09C 4P5KA 5C9KA 4R4NC 3KPRA 4ZXBC 1QZ1A 5I1LA 5HYSG 3CFEA 4JG1L 1QO3B 4ZG1A 1U8IA 1WQVT 5J9PA 1TZIA 5HGDA 4F58L 4DGVL 1CE1H 5GGSA 4W6WB 3SDAA 1TQBB 4R4BA 3MX0A 4P2QE 1MFDH 2HMID 5I30H 4KRPC 4FTVD 4HXBL 3QNXB 3NCCB 4RAVB 4D8PB 5ALBH 4WUUB 4HPYL 4IJ3C 1MHEB 5I1KL 1H0DA 1YEHH 3HE7B 1KB9K 4KJQC 3KR3L 5IK3A 5MENE 1XZ0B 3I6LD 3QO1A 3QXDB 5DJ0A 4OQ1A 3V5KA 1NCNA 4ZDHB 5EIIA 5GS0C 4PJXA 5AYUH 3OJVC 4GXVL 1BF2A 1SJEB 2PW1A 4FHBD 5C0EA 4JFQB 1NFIB 4PRPB 3IFLL 1HQRB 5B8CC 4E41B 4WW2C 4QRRB 4XZUA 1DBKL 1KYOK 4OKDA 4Z8FH 3FB7A 4JM4L 5C1MB 1RUMH 5IESL 1KC5L 3QNYB 4JPKL 4MD5B 4GQPH 4RAVA 3B5TA 1IKFH 1T2JA 2I9TA 2X9XA 3D2UB 1C16B 5EUKA 4HG4K 4U1KB 1NJ9A 4YK4B 1K2DA 1BZ7B 3RKPA 1N6UA 1WWBX 1QNZL 2YD2A 1VDGA 1ZVYA 2FJHB 5FO7A 1N3NA 2M26A 5IHZB 2IADB 4YC2B 4HHAA 2BHYA 3VG9C 4RMVA 2Q7YA 1I9IL 1XF4A 3QNXA 1ZT4A 2X9WA 4YHKH 4YR6A 2DIJA 1CDGA 2DMKA 2IG2L 2QBWA 2VXQL 3PWNB 4Z7VF 4W4OA 4RQQA 4EN3D 3M07A 1DANU 5EFIB 3TV3L 3MGOB 1R0AL 2AJVL 1LK2B 3IRPX 3QIUB 5T1MA 4OFYA 4LASH 2ATPA 2IH3B 4V2BA 5AEAA 2R1YB 4RGNC 3S3SA 4PD4J 4PJXB 1A14L 4L3ED 4BFIB 3FO1B 4PRDB 3RL2A 4DJMA 3E8UL 2Z31D 3AXLA 4DKEL 3IFNH 3MLSL 2YHGA 2E6QA 5DFVD 3UCRA 2G2RA 5ICXB 2GCYB 1FDLH 1XF4B 4OLWH 5MEND 4LSUL 4XP4H 4NZTH 1T5WA 5CKGA 2AXFA 4ISVA 3SJVE 8FABB 4MQXD 4QYOA 4M9OA 4MJID 3TIDA 5I8OH 3V52H 2VDKL 5JQ6H 4S1SH 3IDJB 3AREC 5CZXD 1HH9A 1T66D 4M6MH 4Z76A 5IVXB 2XTJC 3MZTA 3HG1D 1GGIH 3U0TB 4L3CA 5GJTH 4LFHG 3TJHC 2A83A 1NAMA 3HC3L 2Z91A 3JVGA 2ZCHH 3C09B 4PRID 1MHHA 1SM3H 4JCLA 1AR1C 2FZ3A 2NY6D 5FHBH 4R2GD 2NY4D 3IU4L 4LARL 4JO4L 4YHYB 1XIWD 3DSFH 1AO7B 1ROWA 2XRAL 3VXPA 4M5YL 4GH7B 3FN3A 2X1XR 5FAAA 1YPZB 4QHUA 1P4BL 4XCEB 4PJEA 3QIUA 3QDGA 1A3LH 3QQ3A 1PW3A 4Y19A 2NY7H 2VLJD 3O6ML 3UTSB 5E94B 3QHZL 1T5XB 4MD0B 3TVMA 3WEXB 3BQUA 3QZWG 3HUJF 5DMKA 3WDJA 2QADC 2ED8A 2EO1A 2VLLB 4Q6IB 5MEQB 3ZSTA 2L7UA 5AUMA 1ORQA 5C0CD 4CVZA 3WUWG 3IF1A 3MPCA 3SKNB 1RUPH 5SWZA 1S7SB 3MXVH 1OGAB 3ARVA 4M7ZB 2BX5A 1U2HA 1VFMA 5EUKB 1UACH 4QTIH 4OZFB 3I2CL 3L9RB 4URTB 2FEEI 2XTLA 3S96A 3U0TA 1ZV5A 1KPVB 4YHZH 1V3LA 2CIKA 1UWXH 1F4WL 5KSUB 3TZVD 4QRRA 4KKBC 4M3KB 4P2OA 2FZ3B 3ETBF 3T0XA 5E7FA 5FM8A 4U1MB 4NT6A 3KPQB 4TTGA 3O8XD 3TT3H 5C0AE 1HXMB 4L9LB 1JNNH 4TNVK 4MAYD 5ESAB 3RWIB 4JRYD 4HK3J 1OF2B 3KLHC 5J3HD 5FYJE 2AEPH 4G6FB 3UO1L 4TVPL 4W70A 1P7HL 1K2DB 3DBXA 2YN5A 1Q0XH 2EDTA 3LN4B 5EC1B 4UIMA 5BS0A 5FYKL 5F9DC 4ZUWB 4CU8A 2HKHH 5D7IA 5EN2B 3OKYA 5TE4L 4UB0L 4JO3L 1TCMA 4ESKA 2GCYA 4ZAKB 1JYWA 5FCSH 1I7UB 4PB9L 1EEZB 3SDCA 4F7TA 3SDCD 2K1MA 3VWKB 5T5NF 2P48B 4TUJA 1ZLUH 2C3GA 5L0QC 4HXAH 2D7TL 4WO4C 1T3FA 5JXEA 1KIUA 5K59E 3U7YH 2VAJA 2EICA 4CU6A 4CNIA 3H9HA 4HV8B 4PG9A 3N9GH 1JNJA 4XTRC 1RULL 3PWVA 3ULSA 4X6BB 5I1EL 4HJGA 3SPVB 3S37X 3T3MF 4P3CH 1U8NA 1VESA 2UZYB 4HUMB 2H26B 5ELIA 2R2HA 4G80A 5JMRA 3C5SB 1PYWA 4WY7L 1NGPH 2GK0A 5HDBF 4JDVA 1MLCB 3MOAH 1TJIL 3NZHH 4WU7B 5EU6E 1RFDL 2Z92A 4QRUB 1JIBA 2PYEE 3C6LA 2JK5A 3AC0A 3NIGF 4M43H 4E41E 3HE7D 2EEAA 2WWKO 4F7CB 4P23C 3BUYB 3TP4A 2V9QA 1M6OA 3L5XL 5C0IA 2JELL 3JTTA 1JGLH 5D6DA 4JZOB 3EO0B 4X7DC 3UTQA 4KK6C 4JY6A 2D31B 4DFHA 2CGRL 3LS4H 4L8SB 3SDYL 1WBZA 1IC4H 4NQCB 1ONQB 2ADJA 3KNBB 2BNQE 3QDMD 3SKOA 3L3KB 3CUPA 4IDLA 5ADOL 2DRUA 3QISA 4WJ5A 4KJYA 1ZT7A 4UQ2B 4DEPC 3CFCH 4LFHD 1FC1A 1ZTXH 4I3RL 3MNZA 5IW6A 1U3HC 5GGQL 2HT4C 1UM5H 4DKEH 2VXUH 2NR6C 4PLKD 4PJFB 3WFHB 3VXNB 3GGWA 3HI6L 5SX4H 4IRSD 3REVB 4LMQI 1FBIH 5CEYB 3F5WA 1WSST 4K9EH 2X4UA 5ISZB 4JFXA 2AJZA 4ODXA 3VD7A 1MREH 1I8IA 4BUHA 4J3TA 4D94A 5FUZH 4PJAF 1K8IB 1XGTA 4M6OH 1YEGH 1TCRB 2YS4A 2H45A 1FVEB 3KPRE 4QTHA 5KG9B 5GXBB 1HHIA 3NVQA 4RGND 1JI2A 4M02A 3UTTA 4NZUH 4LVOC 3MBXL 1K5NA 1DDHA 4NZDA 3KLDA 5KSUA 3ILQD 1KJ2L 2HFEB 5CIPH 1DZBA 2WM0A 3FZUD 3R1GL 1Z5LA 3B2VL 4EI5C 3EO1B 3Q6FB 4OGAC 4EUPH 3LQMA 2IFFH 4AIZA 1Q8MA 1KGCD 1K4CB 3V7AE 2B8OT 4LRNH 5C3LD 1JF5A 1MVUB 1BD2A 1MH5B 1U8QA 5CAYB 5MENA 1UXWB 2HFGL 2R0ZH 3C6LB 3H7LA 4YK4C 2C4FU 1KB5A 4KHTH 1NLDL 2AK4B 32C2A 4U1KA 4PJCF 5ENWA 2XZAH 4PJXE 5JIIA 2DD8H 3RNKB 4XRCA 4F57H 3PV6A 4RRPA 5GGSY 5F9OL 4PJ9C 2IADA 3RWEA 1EMTL 1F8TL 1AR1D 3HNSH 5T33H 2EDNA 3HZKB 4APQD 1KT2A 1ULVA 2PYEB 4ZTOL 3CZJA 4HFUL 1G7PA 5HHNA 5F88B 1F00I 1T04B 2I5YL 2PETA 5INDB 1S7RB 3UBXA 3K2UL 4RDQF 2YPLA 3MLXH 4ODWB 3VE0A 4GUPB 4D0DA 1H8SA 1NCUA 3TYGL 1GC1L 2DL2A 3OB0K 5ACMA 1CU4H 5DMGD 1CFQB 3T04D 2CLRB 4NN6B 2FIKB 2FHBA 3VFRB 3KPOB 4JFHD 1DR9A 2IALA 4Y4KA 1RMFH 5CJ5A 4F37K 2F19L 3CPLA 1U6AH 3QUMA 3CD4A 1KJVA 4LVNB 4TSAL 5H8DA 4GG6F 1YN6B 3VXRB 3QIUD 1UYWH 4PGDB 3QWRD 5E8OA 1CFVL 1U92A 4NO2B 3VXTB 3MRGA 3F12B 5GISH 2UVEA 5C08B 4PJIB 1W72H 3N06B 1MHPH 3M45A 4CMMA 5F88A 3RIAK 2UZXB 3VFSA 3FQRB 5GGUB 4MAYB 1HCFX 1AI1H 2FJFA 1MJJB 4ZTOH 3O45B 4YHOL 5C7XL 2VDPL 1U3JA 1FL3A 4OZGA 1F8TH 4XVJH 1T89A 2X70B 1BBDL 4O9HL 3DLQR 3F5WB 4JRWA 2ZWLT 1KB9J 4MMZC 3PGFH 3CVHA 1HOCA 4RNRB 4P57B 2CQVA 2D7MA 1U8LA 3GMQA 3DI2B 2AXHA 4LOUD 4L8SC 4MQ7B 3FZUC 4UDUB 4RBPK 1E4XH 5IT2H 2MQ0A 4QGTA 4HKZA 1QHPA 4WI3A 1HK6A 2AQ2A 3VI4F 4XVSL 3MJ6A 3WFCL 3VJ6B 3JVGC 4C56E 5INDA 3GSVA 3QDGE 4RAUB 1GGIL 4L3EE 2BCKA 2X09A 4XBPA 4AT6B 1PZ5A 5EU5A 1CVRA 5FV1L 1AKJD 3VA6A 3P4MB 1IGJA 2WSKA 4S2SB 5D1ZA 1BMGA 4HWEH 5KTEL 3BN3B 5IVZA 5BO1H 1GZQA 3DARA 2EYTB 4X80L 1YPZE 1OTTD 2DQTL 3OJDA 5DC0A 2R8SL 1NEZA 5H37H 4HKJA 4I0CC 1KCRL 3HE7A 1FSKC 2EE9A 2VDLH 4XBGA 3V7MA 5MEPA 1R3KB 1B2WH 4CMHC 1TTGA 3T0DA 3N1MC 4LLQB 4MJIE 1YNTB 5TQ0H 1LDPL 4UILH 3VWJD 4RBPH 3BP5A 4EXPX 3BQUB 3D39B 4N5EC 4YHOH 1U8KA 1G9NC 4HJGB 3SPVA 4QKXB 3WNOA 4IIQB 2Z35B 4Y2DD 5FECA 3VCLA 1LWRA 3SJVB 2Q76A 2HN7A 3SE8L 4ONGH 5D7JB 3TO4C 5HYQB 2Y07L 1DN0B 4L9DA 5E9DA 3BPNC 4WEUD 4JFYB 4ETQB 2XWTB 1BD2D 2G60L 3TPUA 1B4RA 1HYSD 3MFGB 3U4BL 3WS6A 5J57B 3FFDA 4JN2A 3QXUA 1YDPA 3TVMC 5BS0E 1IFHH 4PGDA 1LE5A 1CS6A 3V0VA 5EC2B 1GIGH 1SYSB 4OZIB 4PIRF 4M7LH 3WFCH 3U30C 1A4KB 3T65A 4XVSH 3RIFF 5EU3A 4U2YA 3MUHL 3HI1B 1Q9KA 2I27N 4PYGA 2V2WB 2GTWA 1EVUA 5F72S 3WIHL 3B9KB 1PSKH 4OD3H 3CDGA 2EDDA 3PGFL 2VSCA 2FGWL 1OARL 3ARBA 1TTUA 5K33A 2DN7A 2VAAB 1FNFA 3P3YA 4N1CA 4P9MH 1LP9B 3LN4A 5EC1A 5DSCB 5FGCB 3MLXL 3WE6B 2FLRT 5BV7L 3MLZH 3GIVA 3R8BB 4JFQA 4RISL 3I02A 4ONHB 4XC1L 4ZFOA 4IRSA 1A1OA 4LQFL 3VH8A 4CVXA 3VXUD 1WT5A 1UH2A 4Y4FB 1HHHB 4NNPH 1R3IL 4HS8H 2NY5C 1IZJA 3DI3B 4NRZA 3MRJB 4G7VL 4IHOB 2DQUL 3U1SL 3ARBB 3MV8B 1BJMA 5F70A 4PV9B 5FYLL 4LLWB 1KXVC 4MJ5B 2ZP0T 4XP9H 4GW1A 5CP7B 4TNVF 1FH5L 1ZVSB 3GSWA 4JG0L 2IGFH 5EU3B 4C57C 4LVHC 2UWEF 2BNQA 3CFKA 4X6DF 1WC7B 1RZGB 2VZSA 4ZNEE 1ZSDB 4NCC2 2GY5A 3UAJC 1BHGA 3HPLA 1EZVX 3C5JB 4HWBH 4DN4L 4FG6D 4Y1AA 4HQQH 1CDCA 4WENB 3TPUB 3DX7B 4MNQA 5BXFA 3PWVB 3DO7B 3AAZB 5LQBL 3QFJE 1QFPA 2R1YA 2J6EA 4Z78A 1HDMA 2PXYD 1VFAA 3AS2A 2BVTA 2DQDH 3KXFB 1UACL 1FG2A 2NCMA 4OZGF 5D9SB 1ZHKA 1HZHH 4X6CB 2IEPA 5I76B 2R0WL 5HYQA 2JB5L 1XF5A 5D1QD 5J6HB 3V6OC 4OCRL 3UTTE 4NQDE 2ATKA 1WVZA 2OR9L 2WNGA 1BZQK 1T6VN 4F9PA 5JXAH 5GGQH 2ARJB 3BVNA 1TMCB 3WN5A 5J89A 5HDQL 3U9UB 3MJ8A 1DANT 3CFCL 4IRJA 5CEZL 3GSQB 5HGBA 3TNNA 1S9VB 4OZHF 2BFVL 3CMGA 1JNHB 3KPQA 2EIDA 4CW1B 2BNUA 3D18B 3OKMB 1HWHB 4RWHA 1P84K 5F1KC 5IEHB 5BMFH 3HR5B 4F7EA 4KV5F 1CK0L 4AL8L 4JRYA 3ZL4L 4LLYA 2YRPA 5SWSD 3T08A 3V6FA 3T4AB 3TYFB 1N8ZB 3O0RH 2Z31A 2N4IA 4J23A 4CVUA 2IPKB 1CQKA 1JGUL 4AENA 2ICWB 2OK0H 5CJXC 3RQ3A 1FRGL 4AL8H 1BJ8A 4JN1H 3F12A 1TZHB 3LS5L 4BKLB 2VDOH 3DIFA 3S4SA 1QEWB 1RIUH 3MC0A 1JV5A 1EFXB 3DO3A 4WHCA 1H5BC 5BRZE 2F54E 5IFJB 1WIUA 3ULVE 2DQHH 3KYOB 2ZCKH 5E00B 2AV7A 5GJSH 4NZRH 4GW5A 1MFAL 4XCYA 3NFSH 1BQUA 5ETUA 2BNRB 2AI0H 2VXVL 3MNWA 4XAKD 4U1NB 4Q0XL 3SCMB 2R9HC 3GMPA 1W0YT 4PJIA 2MJWA 5C0RL 4PJCA 4I0PD 4X7EC 3RVUC 4KPHL 1J8HE 2X4TA 4PJDA 4MA1C 3P77A 4TVSa 4HX1B 5GGUA 2NXYD 3VXQB 1UFUA 3FKUS 1RJZB 4XMLH 1IGMH 4MNGB 3PGDA 1RZIA 2JF1A 4L4TE 1CGVA 4WFGD 3ILQC 5IMOA 5JOPD 1RUKH 2OI9C 4XAWL 4M48H 5FYKH 1IGML 2VB5A 5C08E 5EO0B 1VEPA 1OSPH 5F9WC 3H9YA 4KVNL 1HN1A 4PRIA 4FQJH 4RNRA 3C87A 3OXRB 3JWOL 4FQ2L 5L2JB 1JNNL 4JZJA 4YX2L 2XWBA 2Q8AL 4X4MA 5C8JB 3QCTL 5JHLH 3DUUB 5DQJA 5I1IL 4I5BA 1J0KA 5GGRA 3BD4A 3MO1A 2BDNL 3DGCR 1UH4A 4PGCA 4NM4L 3IDMA 4FXLA 3QULA 4M5ZH 5JNYB 4WI4A 5D7JC 4J8RA 2FEDD 1QFWH 2EKJA 1HEZB 1TJHL 4OJFH 4QT5B 4R6UA 3FB8A 3RUGB 3LV3A 2HLAB 3PQYD 1KN2L 5FM5M 2DQFB 2GFBA 3OKNB 2CO6B 1RUAH 2K7QA 4KKBD 1P9MA 1PJ9A 4TSCL 2R0KL 2AERT 1HKLL 4JEGB 4WI7A 1E6JL 2QHRL 2DQEL 4KI5D 1BZ9A 3W5MA 1RPQA 4JFPB 2YWZA 1W72A 1F3DJ 2P7TB 4NP4L 5GGTL 1MCOL 4K94C 2XN9E 3G5ZA 2OJEA 3QHZH 1MFBL 2WBJA 2H2PD 2R2CA 4JB9H 4XRCB 1Z9SA 5DJCB 7FABL 2IFGA 1FFPB 3DUHA 5IBTL 3MRPB 4UIKL 4H26B 4OD3L 3ZE1F 1JZ4A 5F1SA 1F3JA 2I26N 3FB7B 4G6AC 3TBVA 2VQTA 1DEDA 1U8HA 3ARGA 5E03A 3V0WL 5IKCA 2P4AB 5HTSA 1BOYA 5DJ2A 4WUUE 4U33A 4NHCH 5JLZA 1INEH 4FZ8L 4MNHB 3WL9B 3B2UD 2X7LA 3FQWA 3QDGD 2HG5B 1C12A 1TTFA 2ICWJ 3O4LD 5GHWL 1IM3B 2C3VB 4R96A 4U49A 3RJQB 3QQNA 1MCHA 1U8PA 4R2GC 3HI5L 3ULUE 2HVJB 5DK2A 3P4NA 1MRDL 1QSFA 5DTFB 4NYLA 1BQSA 4D9RE 4MAYC 4C4KO 2YC1B 5IMLB 4I3GA 1VACA 2ICES 3IRZA 1BD2B 1MH5A 1U8QB 3O6FD 4QYOB 5SWSA 1P2CB 2CDEB 2ZCLL 5IG7A 1MCBA 1EEQA 1JPGB 2OMBA 1OQXA 4Q74A 5EBLB 4WNQA 3MV9E 3CFEB 3K1DA 4IRJC 5ABDE 1CDYA 3VFOB 4IMLB 3TNMB 3GZKA 3JUZA 3VXUA 1LO2H 1MFNA 3S6CA 5HD8C 3MRIB 3OR6A 5DR5L 4YHYC 2VDLL 4LLVB 3UJTH 3BW9B 5F9AC 3UYRL 5I17A 3L3GA 3QEUA 4F37F 3I84A 1YEKH 4JFFE 1U36A 1XR8B 3Q6GL 2EDOA 1A3RL 3QQ4A 2NX5B 1JHLL 3VG9B 5AWNH 4JPVH 3WFZA 5D1QA 2MFNA 4F80A 4FABH 1GZPA 3VXTA 1IAKA 1I7ZA 4OGXH 1OOAA 1K3ZA 2IPUG 2XZQH 2Y6SD 4PTUB 2OP4H 4LCCC 4OCXL 5J6GB 4NJAL 4L4VE 4NQXB 4RAHA 3PABA 5C6WH 1GGUA 2KZ1B 3C60B 4JPKH 3MBEB 4TSBL 3DRQA 3LZFL 2N7BA 1OWWA 2J8UB 3NGBC 1SEBA 5E4EC 3VRIA 4PP2A 2EDQA 4MSWB 1PDKA 4AQOA 1MCRA 2VOTA 3V5KB 1FLTX 1UZ8A 3MRRB 2EZ0C 2DM3A 3R06B 5I9QC 1KLFA 4L29B 3W39A 5IBTH 4U0RC 3CFBB 1PBYA 2X4OB 3GMOB 3CX5K 4WFHE 5I1KH 3O6KL 4JM2F 4X7TA 5GIRA 1NSNH 1FLRL 4ZFGH 3HFMH 1EEZA 3SDCB 3VWKD 1JRHI 5E5RB 1A6VL 2IC2A 5I15H 4LCWA 4Q2ZA 1OGAA 3TJHD 1OF2A 1OAKH 2FHCA 3F7PC 5DEZA 5LGHL 2ZOKA 4YWGH 1CFVH 1A6VH 1UB6A 5D93C 5GRUL 4EJ1C 2AEQL 3VMOA 1HH6A 3U2SB 4LEOB 2H8PA 4X4ZA 2V7HB 1RI8A 2DM7A 3V5HA 4RMRA 3HG1E 2XICA 1YJDL 4KROB 1ZHBA 4XCNB 4I0PB 3H9ZA 3BE1H 4ZPVA 5DQDH 3KPSA 3SY0A 5D7JA 3H9SE 1IARB 2DQJH 3O8XB 2LFGA 3MGOA 3F7VB 2UWEA 5FYJH 3V6FB 1V05A 3DHMA 4MNQB 3LSOB 5IROA 4JN2B 1ADQH 4AJ0A 3CGTA 2B1HH 2FWOB 1NCTA 3ZDXE 1B0WA 3M17B 4MCYA 2DLFL 2H8PB 4S1QH 4YIQB 1ZSDA 1OAUH 1SY6L 3QEQB 2QV2A 3PQYB 4OIIL 4OCXH 3RWCA 1U8JB 1X5XA 1BOGA 5TPWL 4AZ8A 3LRSB 4HAFA 2Q3ZA 3HMXL 1N0XL 4HD9A 2JJUA 3QEGL 3D2UA 4AEIH 4M1GH 5F9OH 2P5EE 3QXVA 4FZ8H 3KYNA 2VQ1A 4ZXBB 2W92A 3HS0B 1AD0B 2QQQA 3BHBB 3C5ZA 3P4MA 4BZ2H 4CADA 4POZC 1G6RL 3W39B 2Q20A 3TM6A 3MREB 2VJXA 4OB5H 5D9SA 1MHHB 4H20H 4JY6B 4MZ3A 2DAVA 1ORSA 4OF3A 4PJBB 1IKNC 5JHDE 3RZCB 1ZA6A 4Y8DC 1BBDH 4O9HH 3SKJL 4TUOA 3QO0B 1OW0C 3OMZA 2ZSVB 1GGYA 3B4NA 2YD8A 5J06A 3Q1SH 4P9HH 3WKMH 3BI9X 3IT8D 3EHBC 3TIDB 3F7YB 3QUZD 4F9PC 4BSVB 4NQSB 3SKMB 1DVFB 1EJOL 3EO0A 4P4RA 5TFSL 4X0KB 5IM7A 3AFLA 3M17A 4MCYB 1D9KB 1V7NL 4WV1B 4HEPG 4TSCH 3EYUH 5CGMA 5AZEH 1G7LB 1QLRB 1FRGH 1QA9A 1A7PH 5F8RC 5EWIH 3B8YA 5EBMB 2MCPL 3W5NA 2PCPB 5HHOB 4GAYA 1QFWM 1IVLA 1XH3B 2X41A 4G7YH 5DD3L 4DFIA 2LU4A 4NN6C 4AG4H 2IBZY 4MS8D 5B39A 3TN0D 3L6FB 1FCCA 1ES0B 4M7KH 4TSAH 1IQWL 3L95B 4FOMA 1WBXA 5D5MB 1T2QL 2R9HD 5D2LF 3EYVA 4YHPB 4B0MM 3VXSA 3QDHA 3HAEH 2WINA 3T77A 3JWDL 3K4DA 1K6QH 1J1XH 2VLME 3DROB 2WWMC 1IC5H 4LLUB 4F2MA 1CIDA 5HDQH 2Q76B 5J12C 4IRSB 1Z9OA 1T1YB 3DXAD 3TCXA 3FB6A 3HTLX 3TWCL 5EUOB 2DICA 4XPBL 1GXEA 4YXLL 4FQHB 3DWTA 4UOW1 3GM8A 2BY0A 3O2DA 2XN9D 3S34H 2F53E 4OD2B 2XG4A 3BWAB 5C2BL 1K9TA 4PJ7F 5TH2B 1XGRB 4U1GC 3WEXA 1EVTC 3I6KB 1FCGA 4MDJA 1UC6A 3DTXB 5AZEL 4OM0L 2W0FB 4TRPL 2YKLL 5DHVH 4ELME 4HIJA 5MERB 3EJZD 3VGEA 1D5IL 1KG0A 1AD9A 5HVHC 4E9LA 1GAFL 2EC8A 4NUJA 4P2YA 3VFGH 5I8KL 4Y5VC 5BV7C 4ENED 3OG6B 1RZIB 1EBPA 4LU5L 3WO4C 4QOKB 3LIZL 3NFSL 3QDAA 4TQEL 2I07A 3T8XA 4P46C 3GI8H 2XN9A 4RGOL 5CLTA 12E8L 3VI3E 3ZDZF 3HS0A 2BVOA 3SKJH 3O41B 1S7QB 3RVUD 3PL6A 3E3QC 1FYTA 1I9JL 2Y72A 2X4QA 2IAMD 3I02B 4MXWH 4ONHA 4Y4KD 4EI6A 2V2TA 3D0LB 3WIIL 4YXHH 3ARGD 2I9LA 1D5IH 5I8EB 4IS6B 4LL9A 1DBJH 3C60D 2NNAB 3QRGL 5E8EA 1CFNA 4WUUA 1ZS8B 1SBSL 2HA1A 3BP6A 2PYED 4JFPA 3MRLB 1T20A 4UB0H 2V7NA 4NBXB 4A6YL 1XF5B 4KRMB 4PV9A 2MHAA 5CUSL 3ZDZE 5CKAA 1OP5K 1ACYL 2W60A 5E4EB 4YC2C 1R5VB 5DRXA 4WUKH 4XPBH 3FT3A 3LV3B 3ULSB 3ZTNH 4TVPH 3MRIA 1MEXH 2DTML 1V3MA 3DX8B 1LO2L 5DK3A 1YN7B 1PGRB 2H41A 4HDIA 5GRJL 1QSZA 1T1WA 3RWJA 2EKSA 3EOAB 4DUVA 1I1FB 1K6QL 4Y1AB 1T0NA 1AJ7L 3QDJA 4WUUD 3G6JB 3P73B 1IMHC 3AU1A 5CGYD 1T66C 5IIEB 3CAFA 4N8CL 4RSVA 5IB3B 1G84A 5SV4A 1GGCL 5C0BE 5ICYA 1QPPA 4R7DA 3WFDL 4LSPL 1KUMA 3BH8A 3BEWB 5ACZA 3I2CH 4WW1A 4X8JA 3WSQL 4MDIA 4RFOH 5DJYA 3DVIA 3GIZL 2HTKC 1UM4H 2NY3C 1J11A 4LIQH 3SDYH 1NKOA 1IC7H 3QJHB 4NKQB 3ARDD 1J12A 5TF1L 1GIGL 5IHBA 1Y0LB 5FYJD 5DVMA 5GIRB 1JZ2A 2W9LA 4I77L 4KKAD 4G9DB 1CR9L 3CUPB 1SJVA 1OAKL 4MNGA 5LGHH 1QQDB 5I75B 5EFIA 1KB5L 1FVDB 1QBML 4LPTA 1AGEA 3VXSB 3MNZB 5IW6B 4HS3A 2BCKB 3QXWA 5BMFL 2VDRH 1U3HB 4R0LA 3V5DA 1B0RA 1JK8B 2P8LA 5D1ZC 1NSNL 5HHQB 5HHVH 1I8MB 4X7SL 1OPGL 3MNWB 3OX8B 3GMOA 2BOBA 3UJJL 2D7OA 3I3DA 3PP3H 5DD6B 1KT2B 4OB5L 2P5WD 4XCNA 5BQ7A 3B3IA 5I8EA 3WNLA 3K80A 2XIDA 4Q9QL 4B7LA 4JR9H 2J8HA 5HI4D 1C1EL 5BW7C 2VZTA 3GSNL 2RR3A 1BZ9B 3P0YH 3WNNA 1DBAH 1T20B 3W9EA 2D7TH 3DX9B 4AEFA 1ZANH 3V6OE 5E9DD 3H0TB 4LGPB 5IJVB 1A5FL 3I3BA 2A9NH 5T3ZE 1S3KL 4HMCA 4TSBH 2C1OA 3U46B 4UT6L 3SO5A 1KN2H 5E94A 1UM4L 3RWEB 3FO0H 1DUYA 3K3QA 1IJ9A 1F5WA 3OKKB 2OL3A 3BW9A 3ORJA 4U6XA 4U31A 5JA8B 2D03L 5BQ7B 3QYCA 1JHLH 2B4CC 5GGRB 2R0LL 4WI9A 4QEGA 4NOFA 4ZFFB 3DRTB 5IB1B 1OLZA 3W0WB 1MY5A 1YN6A 3T09A 3ARPA 1P69B 1UJ3B 1B0RB 1FZMB 4U6TA 4M7ZC 5TDOB 3ZDYE 5TF0A 4MD4A 1WGOA 3RWGB 5JIHA 1RIVH 5I71B 3BQUD 2VDNH 3IDNB 4I8DA 4JJHA 3P4NB 4AIXA 1A9BA 4XCFL 3QUYA 1FZOA 5GRUH 3ZDXF 4P59H 4HIIA 4CDGC 3KYKH 5FO8A 4LRIA 2IAMB 4I0KA 2XZZA 1CXEA 1HI6A 3LN9A 1FO0L 4NQUA 1CLYH 4YHMH 3GMMB 5I1AB 3O6LL 1CICB 4I2XA 1UJ3A 4YXHL 2APVA 3HI5H 1W72L 3D0VB 4AEHL 1QOKA 3O11A 5HI5C 1A64A 2NY6C 4ZFGL 3AS3A 3SJVA 5HYIA 2AABH 1WFUA 4L8DA 4RA3A 1VFBA 3C9NB 1RUML 3B9AA 1A1MB 3HC4L 4NKDA 3TO4B 4OFPA 1Y6KR 5BVPH 1CGUA 4OI7A 2ZZUT 1MPAH 1DL7H 5E6IA 5FUCE 1QTYT 4QHKJ 2HLFD 5FDWA 1UB6B 5KVFH 1W0VB 2Y7QB 5AYUL 5KS9F 3P0GB 2VDOL 4NRYA 4JAMB 4PY7A 1JPSL 1LE9B 2R69L 5DVNA 3DSFL 5DWUL 5DK0A 1A8JH 3GI9L 4NPYB 1MQKL 1SM3L 2FGZA 5I2IB 4X83A 4CVZB 1I1YA 2EYSB 4YPGA 4Y1AD 2X10A 5KAQF 5I1JH 3NCJH 1MRCL 3PHQB 5IWLA 2R0LH 2VZUA 4KGLA 1DQLH 3BXNA 5HI3C 3D25A 1A1MA 1MJ8L 5SX5K 1A02N 3HR5A 4KRNA 3SE3A 1FC2D 3RGVD 4EN3A 3NCMA 3HE6D 1UGNA 3V52L 4XBPB 1J0ZA 4I4WA 5FEBA 3G04A 4X6FA 2WANA 3BIAX 1N6QL 4KJWD 3FO0L 4YFEA 5L7XH 3BVNB 4G9FB 4EEEA 2VL5A 3B5HA 1GC1C 4L8SA 4UV4H 2N1KA 4LPVA 4XPAL 3C60A 1MIML 5DO2C 3BKMH 4HFWA 1IQDA 3S97C 2D0FA 4U7SA 5A16A 3VWKA 1RZFL 4FQHA 5IMMA 3CFIC 5EO9A 1E28A 3A6OA 3BUYA 1GSMA 1M7DA 2EYRA 3VXSE 4YBQC 1KCRH 4ZO6A 1RZKL 2ATKB 4HK3N 1YEJH 1A7PL 1D7FA 3CX5J 5HPMA 5F3BB 5F1NA 2C4XA 4WEBH 1RJLB 1YNKH 5GS0H 4PY8J 1PYWB 3MROA 1XMWA 4J3OC 4DGIH 1KB5H 1DE4B 1XR9A 3VH8G 4NZUL 5KN5B 4Y4HD 4PJFF 3T0EC 2FD6H 4EBQH 1RUKL 2KPNA 1TPXB 4P9HL 4UQ2A 4DVBA 4I3SL 4I77H 4OKVA 1T7VA 5C0FB 3L6FA 4J2XA 1WIPA 5IUSA 3LQAH 3PP3K 2WUBL 3QIUC 1X5YA 4D9RD 2IAMC 5FO7B 3MXWL 3AM8C 5K93A 1JFQL 4C56D 1Z0NA 1QA9B 3BP5B 2GSIB 5BOPA 3HN3A 1ERNA 1AXSB 2D4DA 4JY4A 4ODXB 3S37L 1DLHB 2XWJB 1GCFA 3RIFK 1JHKH 3E6FB 2Y36L 1QEWA 1FGNL 2YUWA 3FQTB 4MVBD 2WIIA 4HJJL 2VO5A 3MRDA 4F9LC 2DQHL 1MVUA 5TPWH 1I7RA 5ALCH 5KS9E 1ZHNB 2ZUWA 4IRZL 4WI5A 2HTLC 4Y5VA 3MRCB 4K23H 1OAUL 2CO7B 3VMPA 2DYPA 3KPPB 5C92A 4XC1H 5CEZE 2HFEA 1JF1B 4HUVB 3CFBA 3ZKNC 1KFAL 4JGJA 3HZKA 5ISZD 3K1KC 4WW2B 1G7JB 3IVKB 4PJCB 3HNSL 1G7IB 3NIFE 4HIXL 5C0GA 1WLHA 2EE2A 4X99A 3S88H 1ZA6B 5BOZG 1UQSB 5FKAB 1EGJL 1KCSL 4HSQA 1KPUB 1LO0H 1CICD 4HKBB 1NLDH 2N56A 1WWWX 15C8H 2EXWD 2EYRB 2JJSA 5JZ7D 1W2KT 4X8JB 5DHVA 2VLKD 3C8HA 1OB1A 1NUDA 5CEYA 3LEVL 1AHWC 4OAWB 4APQA 3B43A 3SGDI 4YX2H 1EUUA 4PUBH 1FFNB 2G75B 2R23B 3FAXA 4RGMC 3RKDD 3ZDYF 4P2RA 3ULVL 3RWIA 3QCVH 5I15L 3ULUC 3L1OL 5D7IF 4LCCB 4HXAL 2H3NA 5GS0L 1T2XA 3O6LH 4X6FB 5B39B 2YMXH 4HBQA 3P30H 3NOIA 4J8RB 1QR1A 4U4BA 3V5DB 5GS3A 3RU8L 5EOCL 5DLMH 3FT3B 3S5LG 5HBBA 1NL0L 4LP5A 4LNRA 2SEBA 4KZEH 1KPVA 3QEHB 3M1BB 5EORL 3PWPA 4QXUL 4GS7C 5C8JA 3ZKMC 3D69B 2DQCH 2APTA 2X4PA 3BP4A 4MXQD 5KZCB 1OGTA 5CEXB 2CDFB 4L1HA 4OFIA 4P2RB 4JQXA 2JK5B 3VD9A 3DETC 3DURB 1J5OH 1TLKA 1U8MB 2R0ZL 2HFGH 1XCQA 4BZYA 2CRYA 3FQWB 4LLWA 1WV7T 3RDTA 4JFED 5KVGL 1IC5L 5IHUL 3GJFK 3SKMA 1A7NL 1JWUB 4UT9L 5LBSL 5I6XC 3OGOE 3B2VH 15C8L 4P2OB 4GAJL 1TQBC 4BQ6A 2VL4A 3FQNA 4QRPA 5EZLB 1BGXL 4TUOB 1NBZA 4HUXA 1GRWA 1FNAA 5I1JL 5L2KE 1NQBA 2EXYD 3P11L 4NKIH 1CBVL 3WLWD 3TPKA 1F2XK 3RGVB 1G9ML 4Y5YA 2EIEA 3RVXD 3KS0J 5I16B 3UC0L 3VXRD 3D85D 1ZA3A 3NA9L 2LABA 3E2HC 5J1TC 3FT4B 4LQFH 3GK8L 3FFCD 3KWWA 4XI5C 3O4LA 3F58H 2NY4B 5J6GA 4K3JL 1LO3L 4NO0A 5FYLD 4S0TD 3ZHKA 3C08H 5DD1H 3V6BR 2CLZB 5T1DH 4CAGA 3BZEB 3P4LA 3MRDB 3DUSB 4K3GA 1R3HB 2CK0L 2OR8A 1MHEA 1AQKH 3PWUA 1A7QL 3U83A 5EDXA 4MQTB 1YEFH 3VGAC 4F7MA 3IFPB 1NMCC 5DD0H 4H0GA 3O41A 1I7ZB 3GMMA 5I1AA 3X3GL 4OLXH 3GHBL 1U8NB 4K2UL 2IANB 4TUKH 1CGSH 1YA5A 3Q0HA 3FONB 1AGBB 4QRSA 3OR6B 1CGXA 2WUBH 4YFLF 1A9EA 3QDME 2XACC 3MJGX 1GHFH 4K71C 3QEQE 1RZ7L 4D9QD 1V3JA 5BZDA 5HVHB 5MI0B 4QTHB 2DMBA 1MCSA 1IEAB 2WP3O 1URLA 1T21B 1JPTH 1PEZA 2XWTA 1XZ0A 5FM5O 5FV2A 5LQBH 3MRBA 1R3LA 2IMMA 5EO0A 5TH2A 1UKQA 3VFOA 3V6ZA 2GJJA 1N5AA 3TBWB 4P49A 1UVQB 4BYHA 1NEZG 2D2OA 2BVQB 2X5PA 2B1HL 1CFSB 4PJAE 4XZUB 2I9LB 5DZLA 4Z7WA 4Y0GA 1RZFH 4QNPE 4Y4HC 2E5EA 2DTMH 4PGBB 4O2FB 2NY2B 3QFJD 5EORH 1U3YA 3FT2B 1XGQA 1N0LA 4WTZG 2IG2H 3A6BL 4HFUH 2X4SA 1AGEB 2E7BA 3BP7A 1VFOA 1KN4H 4UZGA 2A2QT 1OLLA 4KKLD 1UZ8B 2LV4A 4KY1H 2EYTA 4L1DA 4F57L 3L1OH 1W8NA 4G5ZL 4LCUB 1G7MB 2XZAL 1DFBL 1LP9F 4NDMB 2CDGA 1I3RB 2A74A 4ODTH 2DM2A 4DTGL 1CFNB 4MA3B 4Q9QH 2BHUA 4KRPD 4P23A 2E7MA 5CZKA 1FN4A 5A2FA 3CXHK 4UTAH 1T6WA 5IB3A 3RTQA 3PL6B 4X7SH 4CDHA 5DYOB 4Q6YA 3HZYB 1FJ1B 1DBKH 3X12B 1BQHG 1CVSC 5DK0B 3JV6A 5F71A 3VFNA 3ZMRA 4JO4H 1A6TA 4D9LH 5B38A 2WK2A 1JPTL 2B1AH 1F4WH 1L0QA 1JJUA 4NWTL 4Y4FA 4X5XA 5EU7E 3JSSA 3DSNA 5AAMA 3UYOD 1LD9B 3ZKXC 4CMMB 2XXMB 4M93B 4WHTA 4E42B 1ZT1A 3QBTB 3DHJA 5ESVB 4U6HB 4X6DA 1VGEH 3RX5A 4NHUA 4PJ5E 4S0SD 5DRNB 4BJLA 5E2WH 4P4KD 5D2LE 5IK3B 4HIEA 2UWEB 2X4SB 2AABL 1LP9A 2G60H 5K59F 4RFOL 2VC2L 5E2TL 2F8VA 5DDHB 4L4TB 4WHYG 1NAMB 2Y07H 3QWOA 1CDJA 2YEZA 2ZUQB 3D6GA 2Z35A 4LHQB 3WFDH 3C5ZD 2BERA 2GJ6D 5AWNL 4X7FC 5HYJE 2I24N 2V2WA 1P6FA 1I3RA 1ZHKB 4OQTL 4XWGH 3KPOA 1PX3A 1JHKL 3PE9A 2DKMA 4U6YB 4H1LG 3BKJH 3VRJB 2BNRE 4LHUA 3WYRA 4WFED 2V5SA 4JO2H 3F58L 3P4OB 4OZGB 1R0AH 1S9XB 3UBXG 3VE0B 1G7QB 1A6ZA 1D6EA 1BD2E 3NZ8B 3S4SG 4KGJA 4X6CF 2JCCB 4N8VB 3JV6B 3F6LA 5E1AB 2Z4QA 1FFPA 4JFDB 1G9NH 4YHKL 3VXOB 4R90L 2VERN 3EJYC 4P2OD 1ZWIA 4Z7WB 1RZGA 4U05A 3EJJX 3GJFH 1JNLH 4M6NL 3BN9C 4J4PD 5D1QC 4WEMB 4HWEL 2WBWB 4OZ4B 3DRQB 3GRWA 5CGYC 3GSUA 5FYJU 4G6KH 5IVXF 1T83C 1ZK9A 2NY0D 1U95A 1MRDH 5TFSH 4DAGH 3RWHA 1I9JH 4JFEB 3WHXB 4NZTL 5T1LD 2FECL 1F45A 4EVNB 35C8H 3MOBL 4HZLB 5IHZA 4QCIA 3GSWB 1ZVSA 4FFZL 4Z7UB 3V79C 2APXA 3AB0B 1HQRA 3FO9A 4TQEH 3BGMA 1FO0B 1WZ1L 1RHHB 1IEHA 1EFXA 4OKVB 5DHYA 5J3HC 3HUJE 5C0DA 4LLYB 3O45A 1OD9A 1YJDC 3T0VA 5I1HH 4ZUSB 5HVFB 2KKQA 2XN9B 4JM2D 4PJ8B 4XVUC 5JOEA 1VKXA 3BIBX 4NQDB 2G5RA 3W11D 25C8H 3LEXB 4P5TA 1F2QA 3FB5B 1JZ7A 4I2XB 5HHPB 3FFCB 3S7GA 3HCVB 2IAND 4LSQH 4PJHF 3VI4E 3VWJC 1MHPL 3VGHA 3K4ZA 5FKPB 3KJ6L 2HWZL 4J1UA 4NKOB 4Y1AE 4HKZB 1OTSC 4JVUA 4WWKB 3WUWB 3TWCH 3CNKA 5E0QA 4C83A 3JV0A 3NPSB 3JV4B 1MQKH 2YPLD 4HPOL 4I18C 2WW8A 2ZOKB 4J4PC 5MHSD 4UDTA 5FGBC 5AG8A 1IC7L 3HB3D 2W0KA 4LIQL 5F7WC 3GJFB 3IJYB 5C0CE 3T77B 5D7KE 4TVPE 4G9FA 2HMIC 1PLGL 3BAEL 3T65B 4KMTL 4WV1C 5DUPH 2ZUVA 3WD5H 3BEVA 1LD9A 1QRNE 1YN7A 1CU4L 1PLGH 3BAEH 2ADJB 3P77B 1JGVL 3FL7A 2CIIB 3HC0B 1Y6NR 1YJDH 3PWNA 1GC1H 5JIPA 3OR7A 3Q5OA 5GRXG 3LKSA 4RZCB 1CLZH 4D3CL 5GRJH 5E5MA 3JWOC 5EU4A 2NY2D 4OFYD 4JKMA 2H2PC 2XT1B 5ADOH 4C56A 4F7MB 4OZFA 5ITBL 1FO0H 4L3EA 1EPFA 4K23L 4G42A 4OLYL 4G43A 3TIEA 3PIQB 1IGTB 3HKFA 4QOKE 4WO4D 4FTVE 1I8IB 2C1PA 3RY6A 4HUNB 5CHNA 4NBYB 4XPFH 3DMMD 4L4VD 1FHGA 2X4NB 1D6VH 1IQDB 4M5YH 1ZS8A 3B9KC 3T4AA 2B4CL 2VABB 1EFQA 3BYTA 3QRGH 1KB5B 2XRAH 1ZEAL 4TPRH 5F7EH 1K4DB 1DBJL 3OR7B 4KPHH 4FXKB 1X6LA 1WWCA 3EYQC 4WTXA 4AENB 4Y19B 3PXHA 1A6PA 5DJ6A 2R29L 3BJ91 5A3ID 5JDSB 4XT1C 1LEKA 4NIKB 1WBYA 2VTFA 1CCZA 2EXWC 4KVCH 5IB5B 1NC2A 1D5MB 1IAII 1N0XH 5HHNB 3FQNB 5CSZA 2VIRA 2X1PA 2I07B 5HGHA 4W81A 4LCIL 5BJTA 3MBXH 2FRGP 4RDQG 5EIVA 4Z0BL 1SY6H 4YHML 3LPFA 3OKDA 4PRHD 2FDBP 2O5YH 3IS0X 5E9DE 5BS0B 2F8OA 1L6ZA 3IGAA 2WBJB 1MHCB 1J8HA 1FL5A 3PNWA 4W6YB 2Q87A 1A5FH 3WCYA 3A6BH 1UWGL 2AJYL 1ADQL 3IYLW 4MDIB 3TIEB 4I48B 1DBAL 4C4KT 3QEQA 4J6RL 5DJXB 1MREL 3TBSA 1MNUH 4LIQE 3L3DB 1QSEB 1DLHA 2OR7A 1G7IA 2VDNL 3FJTA 2H6PB 4YXLH 2AJVH 4XPTL 3BKML 2DDQH 1H8OA 2B2XH 2VIRB 5DVKA 4YUEH 3CDCA 1YQ2A 3H7BB 4A6YB 5GSRB 4BQ9A 3VWJB 3BKJL 4IOFD 2XY1A 1X4YA 4P48A 3P0VL 3KLAB 2AEQH 4JPIB 4HK0B 1EEYA 3L7EA 2IBGA 2JIXB 4HS6A 3T4YB 1U91A 4HAGA 2J6EH 4X6CE 5GS2H 4NBZB 4YHIA 3D3VA 1QLRA 2DYPD 4I5BB 1N5YH 3NAAH 1AGDA 3CSYA 4QF1A 3FTGB 3DV6B 1QSEA 4YPJA 4H5SB 1I9RH 1XGYH 5DD3H 1KJVB 3UZQA 4Q7DA 3F7YA 4UT6H 4UQ3B 3QG7L 5C09E 4RCAA 4YAQA 4OLXL 3C6SB 1S3KH 4UINH 4B53A 3H0TA 5IJVA 1ZGLB 4L3EB 2EH8H 5EU7C 1FV1A 1RIHH 2F15A 1FYTB 4EI6B 5KVFL 1RV6X 1C1EH 2BVPB 2B1AL 1GZQB 3MZGB 1LEIA 2C3XA 4JHWH 4HG4J 1AC0A 5J56B 1UWXK 2ITCB 1J0JA 4WW2A 4WY7H 5GRZA 5HYSA 1R5IA 4ZUTB 4ELMF 4MQXC 2DB8A 4PJDB 1RQ5A 5CSZB 5CFHA 3D18A 4XCCH 4YXKH 2NY0C 5HPOA 1H0DB 4ZNEA 1OD7A 4K3DL 1CXHA 1I3VA 3VGAB 4LSVL 2A0LD 3FAWA 4NJAH 3MRCA 3RVTD 4RFEB 1JPFB 1MWAL 4QRQB 4WUKL 1J86A 5D70L 1FH5H 32C2B 4GW4B 4XGZB 1X5KA 1G9MH 2JJTC 1MHCA 4R4BB 4MNQE 2ITDA 5DGQA 4MDJB 3MYJA 2ZUXA 4Z7VB 3TO2B 1MLBB 1QUNA 3CVHB 4Z77A 2ZG2A 1G6RA 1JNHA 4WU7A 4QRRD 4JG1H 2FSEA 4AEIL 4U3XA 5KSVA 3DV6A 4XCFH 2F54D 4OM1H 5HGHB 4NC0B 4PJ5A 5E8PA 4GAJH 2ZNXA 5L8KB 3GSUB 1AY1L 1ZLVH 4DKFH 1LP9E 3IS1X 1RJYB 2OL3H 1EA9C 3D85A 4KKCC 4ZAKD 3W2DH 2AEWA 5IGXH 1CICA 4RGOH 2E8ZA 3FONA 3TYGH 4ODSH 1OAQL 5C0CB 3TH4T 4KKCD 4LU5H 1WAAE 4NYLB 5A2LH 5DQJB 1HHJB 2Q1EA 4LDEB 1Q9WA 4FQ2H 2XNAB 5ID1A 1L7TL 4GMSH 4QXUH 2EH8L 2DLEA 4HWBA 4P5MA 4QY8A 1GPOL 4F33B 1IC1A 1LHZA 3PWJB 1XF2B 2PF6A 4JRYE 4GW4A 4PJIF 2AS5M 1I9RL 5BZWB 3ULVD 3VRLE 3ZE0E 4AK1A 4Y4FC 3NAAL 3O9WB 1G6RB 5I1CL 4Z0XA 1CGTA 5SV3A 1Y18B 2CKBB 1CGSL 1NFKA 2GJZB 3X13B 2D7PA 4KHTL 1BVLA 1L4IA 2BOCB 3X3GH 1YNLL 4ZUTA 5L2KD 3UZEA 3BXNB 4G8EA 3SE3C 1FVCA 1S7WB 2R56L 4PJEB 4MJIB 5IB2A 3FN0H 3F62A 1S9WB 3LKRB 7FABH 3VG0L 4R7NB 3LEXA 2ZCKL 2AV1B 4Z8FL 5IBUG 2FL5B 2HJFA 3L5JA 3I85A 4K7FB 1Q72L 3NBNA 2GK2A 4XMKL 1EGJH 3QHFH 4JFEE 1MQ8A 2XKNB 5CJQH 5I8KH 3WN5C 2X9YA 2HT2C 2OL3B 2XWJA 4JHBA 4PGEA 4JRXB 2LU7A 1AIFA 1HYSC 1BF8A 3D48R 1N64H 4YH6A 1NLBL 3KR3H 2VXSH 4P23B 4PLJC 3TF7C 3BRDA 2X42A 4IDJH 2VAAA 3OKOA 5IVNA 3P11H 3NPZB 4PRNA 3E3QE 3A67L 1X5LA 3L3IB 4OGYH 2B20A 4C56B 4IRZH 4K9EL 3JXAA 3H3PL 1K8DB 5JA9A 4TVPD 3QI9D 3UTZA 5C08A 1ND0B 3OGCA 4Y16A 1Q9KB 3A6CH 2X05A 1JRHL 4G9FD 3EIFA 5DD6A 4ZYKA 3FQRA 5CEZH 4G8FB 1OSZA 1CYGA 3QUYB 5FXCH 4N5ED 1HHGA 4H88L 3MUGB 3FRUB 4X4YA 4UIMB 4LSTH 3WBDA 2IAMA 1IILE 5D5MA 1ZEAH 3U0WL 5DR5H 4M7KL 2ZUUA 5I1CH 3IETB 1KIQA 2IQ9L 4OUOA 5CCKL 1D9KA 4O58H 5HHMB 4AG4L 2YEZB 2AJXH 1V5JA 5FGBA 5EBGA 5IFAH 5GS1B 4GAYB 1NC2D 2UWEE 3FHAA 1A21A 3B3IB 2ESVA 2O26U 2DIAA 3LDBC 4OIIH 4K55A 1QNZH 3T0AA 5DRNA 3QUMH 3SDXE 1NC4A 4Y4HB 3R0NA 1YY9D 5KSBF 4P5TC 5CD5D 3X11B 3VXRE 4K3EH 1U8IB 3BYYA 3TJEL 2HRLA 4BSVA 4PJ9D 4F15B 2EECA 5A40E 3FCTA 3OZ9L 1RULH 4U2ZA 4FTVA 5DHXB 4Z0XB 3LQAC 4GBXB 3PWPD 4NGHH 3VXMB 1ZMYA 2C9AA 2VE6B 4WO4B 1Q94A 3VD3A 3U7YL 5A2KH 4OCMC 4JZJC 4X5XB 3MV7D 4UV4L 4J4PA 5F7MC 1JE6A 5GZOC 1FN4B 4NFBA 1GYAA 4KTEL 1KENH 4TNWK 4TRPH 3BRFA 5ANMA 1JL8A 5FYLH 1KCSH 3WV0A 3H8NA 1TZGH 5JHDA 1O7SA 2UUDH 3PHOA 1RU9L 1UJ3C 4O02H 3QEGH 3BZFB 2VISB 1U42A 5DRZA 1TVDA 2R2HB 5C70A 4HXBH 1QBBA 4WWKC 4H1LB 1MFDL 1A22B 5C09B 1OGTB 3P9MA 3F8UB 4WHTB 2BNUB 4E42A 4O02L 3DETD 2W65B 1CG9B 5EU4B 2FATH 3SDXB 1MELA 2Q6WB 1AQDB 1RUAL 1KJMA 4X6BA 4AMKH 1QVOA 4FQCH 3NZ8A 5T1KB 2OMNA 3KHQA 1JUFA 3DNKA 1T2QH 4YHZL 5EA0L 2KL6A 5CMAA 1UKSA 3U4AA 3MV9A 2ZUTA 1SYVB 5HHME 5AD0B 1UWEL 3OB0H 4IIQA 5I1GH 5HGGS 2NNAA 3B9KA 3P9LB 4PJ5D 1AGFA 3MMEB 2J2ZA 3JZ7A 1HINL 1KEGH 2B7DT 2VLKE 5DJAB 4HPOH 5ESAA 5B3JE 5FK9B 5CILL 4QO1A 2YSSB 1ZA3B 4I13B 1KIQB 3B8SA 4OZFG 3D87B 3EOTL 5L6YH 1A3RH 3KJ6H 3D3VE 3OHXA 2ITCA 3X14A 1T1WB 4Q9CA 3RZCA 3G9VA 4L4VA 5FOBB 3DMMA 3O6FB 3PHSA 2CR3A 1AE6L 1OW0A 1YECL 3F6IA 4PJFE 5LGJA 4M3JA 5I1DA 3STBA 3UTSE 2DDQL 1YMMD 1XGRA 4C55A 3RY5A 1AD0A 5E2JA 1MNUL 5IQ9A 1KXTB 3HNTL 4YGVA 4PG2C 3RPIA 4LLMA 1C8PA 1MWAA 3OPZH 4J7RA 2AI0L 5SX4I 2VZ1A 4DUWA 3LKPA 4HGWA 1NCDL 4ZS6D 4I0PC 5TQ2H 1AO7E 1KTDB 2BNQB 4MJ6B 1EO8L 3D3VB 3KPNA 1ADQA 4LPCA 1TETH 2PXYB 4OCYL 4OZ4A 2D0GA 1U8JA 1RK1A 1IBGL 1T7WA 1HHHA 4FQQA 3NCFB 1MAML 4KTDL 4OT1L 3TZVA 5L2KB 4DEPB 4M62H 4XCEA 5H2BA 1R6VA 1KLGA 3NCYP 5E5MB 1CGYA 3MLZL 1BIIA 1MY7A 5HHMD 4GKOA 5HD8D 4EUPA 3EYVB 2DLTA 3OX8A 3TBYA 1A6AB 1I9EA 3G6AB 3HAEB 1ITBB 3VH8B 2PW1B 5C0EB 1N59A 4MB4A 4QHKI 1F4AA 3TNNB 5J11C 3N1PC 1G1YA 4KZDH 1EHXA 1BJ1H 3GI9H 2GKIA 2L4OA 3BFOA 1F4HA 4L5FH 2JJTA 1FFRA 3DUSA 1M7IB 4NSKB 5F7EL 3RWDB 5IEHA 5CJOL 5ACLA 3TN0A 4OF0A 2PKDA 3MOAL 2GITA 3MNVB 5CIPB 3C2AH 2PO6B 2YWYA 1JPGA 1ZLWK 3MGAA 3MCG1