4X99B

Immunoglobulin fc heterodimers variant
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
207
structure length
205
Chain Sequence
PSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPRVYTLPPCRDELTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLVSDGSFTLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Immune system
molecule keywords Ig gamma-1 chain C region
publication title Crystal structures of immunoglobulin Fc heterodimers reveal the molecular basis for heterodimer formation.
pubmed doi rcsb
source organism Homo sapiens
total genus 32
structure length 205
sequence length 207
ec nomenclature
pdb deposition date 2014-12-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4x99B02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4x99B01
5GSRA 3MZGB 3BDYH 3OBAA 4JQVA 3IS0X 3MCG1 3DGGB 1G1YA 3VMPA 1WIOA 1OLLA 4ORZC 1YMME 2J8HA 2NTSP 2EICA 5I74C 2VJXA 5A43C 4FFWC 4WHTB 1SVZA 2O93L 1QO3A 2G2RA 3NGBB 4HUUB 4PJEA 4KDTC 1S8DB 3DXAB 4M48L 3BEVB 2WUCL 5C2BL 3P4NB 3HR6A 1U3JA 3EOTL 1MCJA 2JKXA 3Q6FA 3H3BC 4AZ8A 1QSFD 5M7QA 2EH8H 4ODHH 4ZTPH 2IADB 3IGAA 1AO7E 3LS4L 3L95B 4NP4L 4RAVB 1TVBB 1FG2B 5CS7A 4KTEL 4XNYH 4Y4HC 1IGMH 3SE4C 4WW1A 43CAB 5BQ7B 4LGRB 1RU9H 2BNQA 3QDJD 3BZFA 5CD5C 4HWZA 5JO5B 1BQSA 4U6XB 3MOAH 1TVDA 4EDXB 3SE3A 4P2QE 3MV7A 3JSSA 5E6ZA 2F9BT 1YYML 5DQDL 1C5BH 3W5NA 1XCTB 3RAJH 5FDWB 4H25B 4XVSL 1UXWA 1KEGH 5F9JB 1ETZA 3WHXB 4GLRH 2W1NA 5F7KC 4EXKA 2Q76B 2JJUA 5HY9A 3QO0B 3FO0H 2CXGA 1N3NB 4XWGL 5T33H 4FQJL 4D0BA 1KTLB 1QFUL 3IU3B 3MXVH 4P48A 4YGAB 1ADQA 1BD2E 3GNMH 3U4AA 3O8XB 1YNLH 3RWDA 1AP2A 1CFQA 3MRBA 4JHWH 4NNPH 2CLZB 3QO1B 3RVXD 1ND0B 5CCKL 4O51B 1XGQB 1TCMA 1NSNL 1OT2A 3ZTNL 3OKLB 4QOKE 2PETA 5F9OH 5C0RL 5HYSB 2GW5A 2CUMA 4LHQB 3LMJH 3D3VA 5EUOE 4ZPTA 3WLWD 4WIQA 1N0XL 2DQDH 1VACA 3UTSE 5CJQL 2HT3C 4MA1C 1EEUA 2R8SL 4QY8B 2BHZA 2NY3D 3DI3B 3AXLA 3GIVB 1S7QA 3FQXA 2C4XA 2Y1VA 5HYIA 1WWAX 1MJ8L 1HEZB 4HJ0C 3DBXB 1QQDB 3LIZH 2FHBA 2A6KB 1NGPH 2ARJA 4ODSL 1J10A 1QACA 4ZO9A 4XNZB 4Z95H 3KDMA 2AQ2A 3JV6A 4XI5D 3BJ91 3GEWB 1JMZA 1LP9F 5GQBA 5A2JH 4KVCH 5D93B 4HKBB 5E94A 5LG1A 1I7TA 4V2BA 4CGTA 1UQSB 3GSUB 2BY2A 4GKOA 1A4JA 4I0PB 2YS4A 4H0HB 1B4RA 1JBJA 4YR6B 3V6ZB 4G7VH 4QO1A 2OR9H 4NC1C 4U1JA 5GGTA 1AXSB 3HTLX 1I1AD 2BZDA 4MWFB 1VGEL 3NBNA 3ZE0F 3I6KB 1IC1A 4GBXB 4JM4H 4OCLC 5FGCE 3VFOA 5C2UB 5I2IA 5SV4A 1NBVL 4TULH 2DQIL 4P4KD 5DHYB 4NYLB 3JWOC 3DXAE 4AIOA 5DQ9A 4ZMAT 4YHMH 3EYVB 5ICXB 2BY3A 4ONHA 4WHYG 4YFEA 4IRSB 5JUEH 4IDLA 4XCCH 4DZBA 2DB8A 1S9XA 1KCRH 4MDJB 3AB0B 1RK0A 2X1QA 2EDEA 1YPZA 3K74B 2O5YL 1I3GL 6FABH 1UM5H 5FKAA 2BSSB 1ACZA 2J6EL 4ZFOA 5C7XL 2ZUVA 3ZE2F 2VLRA 4P2RD 1IE5A 3HE7B 5DRZA 3DUUB 3LKNB 1OLZA 3QUMA 4K3HA 5DQJB 2A9NL 4A2LA 2W9DH 4BH7B 1N5YH 3QG7L 4HBQA 5E0QA 1OGAD 3QAZC 1M71B 1A1OB 2Z93A 5L2JA 2V7NB 4G6FD 5FOBB 1DUZA 1JPTL 4TOYH 4U31A 4Z8FH 3ARUA 3PQYB 1D9KD 2Z92B 2MQ0A 5FK9A 1R3LA 3GSNB 4NHCH 2CRMA 2AQ1A 3P40A 4QHKJ 3S96B 3BN9C 3GMRA 4TSAH 5FO9B 4N8CL 5D7JC 4BUHA 1ZEAL 3VWJD 3WYRA 4TPRH 5DR5L 2MCG1 1LEKB 2V9TA 2VXSH 1OB1B 3G04B 2JCCA 5EO0B 3GMNB 1LEIB 1NMBL 3NCCB 5IMMB 1WQVT 1CFBA 4FFWD 4HFUH 3STLB 4JFFA 3E8UL 2FX8L 4XHQA 4OCNC 2XKNB 3BPNB 4M4PA 4OD3L 1SEBB 3UTTE 1CU4H 1YEKL 2VTFA 3O6ML 4ZAKA 3MLVL 1P4LB 2DQJH 3UYRL 2JE8A 5DJ2B 4XNUL 4TSBH 4Z5RB 3P30L 4GKNA 3D2UA 1KELH 4Q6IA 3QRGL 5FA4A 2FATH 3P73A 1CN4A 1HH9B 4XP6L 3CX2A 5DJCB 1P7QD 3B6SB 4M5ZL 3QIUD 1VHPA 1K4CB 1A6PA 2V7HB 4L9LA 4Z7UF 4XMKH 4LHUD 2V5TA 1OSPH 1IILE 1PG7H 4S1RH 5IFAH 5JDSB 1F5WA 3I6GB 4HS8H 5KZCB 3K2UH 2X4TA 2NX5D 4C58B 2FB4H 4JKLA 3S37H 1DBKL 5INCA 3JV4B 5CEZH 1IGIL 4C56A 4J4PC 2J5LC 2VE6A 3EO1A 2VL5B 3I6LE 1ACYL 4FQ1H 1MCWM 1MRDH 3PWPB 5HI5C 3CFDB 1OD9A 4Y16A 3CDYA 1J1PH 3G6AA 5C07A 1RMFL 3DYPA 2WBKA 3GO1L 1NLDL 3GUTB 1AY1H 5EH1A 1T89C 1FAIL 3LKRA 4XHJC 1HIMH 1NGZA 5J1TC 5EG6C 3O3BA 4XMLH 5IK3A 3LQZB 4WWKA 4R97C 1CFQB 4LPWA 4X4ME 3ULVL 2EDOA 3L9RB 1TTFA 2DQCH 2Q86A 2HT3D 3U7AA 3IDYC 4B5EA 3T77A 5GGSY 1T5WB 3PP4H 2PYFB 3KPSD 4BFEA 1A7BA 5I1AA 2EDNA 4LLVA 1NFDA 3TA3C 1CWVA 4HJ0D 2JTDA 4QXTA 4HCRH 2Q1EA 1DQQA 1X3DA 3D3VB 1KPVA 4NQDA 3TBSB 1A7NL 1QYGL 4L8CB 4PJAB 1SQ2N 1VACB 3V2AR 2FCBA 3AXLB 1RZFH 5GRUL 1S7QB 5D1XC 2KL6A 3QG6B 2PO6A 3O2WL 3O6FC 5J3HD 2APWA 1T1XA 4PPTA 3NIGF 4ZYKA 1G7IB 4PUBH 3DX8B 5ITFA 4MNHB 2B2XL 5B39G 3JV6B 4HIIA 4P0DA 3ZE1E 3MLYL 4G43B 3TCLA 3PGFH 3SDCA 4LRIC 2AERT 2BK8A 4FRWA 1G7LA 2X4OB 4O58L 1P5UA 4XCFH 2LU7A 1CFSA 3MLRH 1SVCP 4P2OA 4I13B 3UPRA 1E4XL 3VW3H 1PQZA 1WGOA 5C92A 4JFOA 4M6MH 4PJ5D 1TZGL 5HHOD 4NBXB 5E2JA 1RULL 4F15C 4F58L 4OF6A 3V52L 4DQOL 5EBGA 1FFPB 5DQ9B 5DO2C 2APXA 5CEXA 1AD9B 2BDNL 5I0ZA 1GZPB 3KLDA 5KSBE 3GKWH 1MFDH 2X44D 5I1JL 4YHKH 4HHAA 3GKZA 5EOTB 3Q2CA 4YAQA 1BPVA 4G7YH 3BN3B 3QNXA 1RK0B 1E6OH 3F7QA 3S36L 5JXEA 1U8JB 4FQ2L 3QUYC 1BX2A 4Q7DA 4WFED 2I5YL 4F7EA 3SJVE 1YNTA 2IPTL 5D7SL 3BN9D 4X7SH 2GJ6A 5D7JD 2P43B 4DN3H 4GAGL 4Y8DC 3O2VH 3PGDA 5L2JB 5I8KH 1S78D 1ZK9A 4X98A 4ZODA 2XZCH 5FF6A 1OW0C 1EZVX 3LRSB 3W0WE 1ZKAA 3GMRB 1JCKA 2Y36H 4OZHA 5FYKD 1WF5A 4ODWB 1TCRA 4YXLL 5ID1A 3UJTL 2NXZC 2P24A 3S3PA 3C5SA 2ADFH 5DK0B 2Y72A 2BSED 1FIGL 1MIML 4UOW0 4YDKH 1MCOL 1M7XA 2R2CA 5F7EL 3C6SA 4XCNA 4OM0L 1CDJA 4HF5H 3BYTA 3F12B 5GRVL 3RJQB 4W81A 5J1SC 4PG9B 2DYPA 5EOCH 3HUJE 4JFFB 1MI5D 3X3GL 2B39A 2QEJA 4NUGL 2Q87A 4MQSB 4TNWK 3Q5YA 5DLMH 5DJYA 4ZAKB 4WUUB 3VXOA 4PLNC 2H8PA 1UJ3C 1JGEA 3SE8L 3KXFA 1YEDA 3FT3A 2H2SD 5F6HI 4EI5C 4U1LB 3OJMB 2D7PA 4H1LH 5DT1H 4AIZA 1EBAA 4GKNB 2FBJL 3D2UB 5DMIL 4K71B 4X99A 4Q6IB 1BZ9B 1MWAH 4KUZH 4MXVF 1LDPL 3ECBB 3EAKA 1AQDA 4YBLC 1KJ2B 1RUAL 2IGFH 2VL4A 3RL2B 2A6IA 4GAYA 4Q9CA 4MD4B 3MLSL 3AS0A 4L9LB 3FQTA 1GXEA 4AEHH 1ZHBB 2Q7NA 4LCYB 4J4PD 5FKPA 1I9JH 5ILTH 3V6OA 4WI3A 4M7LT 3VU2A 3ARFA 4DEPC 1UVQB 1NEZG 4N0FA 2VKWA 5BXFB 1CCZA 4OCXH 5INCB 3PWVA 4RSVA 1CDUA 4XHJD 3VG9C 3TBVB 25C8H 1Q72H 1I9IL 1X5LA 2YBRA 3PL6C 1LK2B 4DKDC 4Y16B 3G6AB 4D0CB 5E2WL 1S7VA 1KN2L 1H9VA 2FR4B 2DM2A 5FCUL 5TJWK 2VLKD 2H45A 5CP7A 3HZVA 5T3XL 3LKRB 3S35L 1NGZB 1MHHB 4ZD3L 3O3BB 4LSQL 3TA3D 1IKFL 1BVZA 1PZ5A 3D85D 5IK3B 2F54D 4NN7B 5CGYC 3IFOA 4JFXA 3H2WA 3RP1A 3TO4C 1FYHB 5IM7A 1NUNB 4P3DA 4TVSa 3BH9B 3VXRA 4U2ZA 5KSBF 4R3SB 2HFGH 1NFDB 3O6FD 1HHHA 4I0KA 1W0VA 2X89D 2AXFA 1IC7H 4AG4L 4U6YB 1QHPA 1JF5A 1HSAA 4U0RB 4F8QA 3RTQB 4F3FA 2VDPL 2ZKHL 4E42A 3C9NA 1AR1C 1RK1A 2BSRA 5ITFB 2R0ZL 1CF8L 5DHVH 1JHTA 1FVDA 5IF0A 1NH6A 4WUKL 1QFWM 3DSNA 4WO4A 4UQ2A 1S5HA 2QHLA 2NY5C 5D1QA 3RHWF 4HC1L 3SCMD 2OI9B 5IUSA 3BP6B 3QDJA 3U7YH 2Q20A 3WEXB 4O2EA 5DO2D 5CEZE 5T5FH 1KPRA 2DWEA 4KU1A 1E4KA 5D7LA 1CFSB 5DJ6A 4NN5B 4P2OB 4WUUE 3AREA 4KK8C 2B4CH 1IGFL 5JOFB 2PCPA 3DVNA 1YYLH 3QUYD 5CMAB 5INDB 4K8RL 4M9OA 3GI8H 1K6QL 1K3IA 3DYOA 5DXWA 4PV9A 4GRWE 5KS9A 3RY6C 2YEZA 3IFPA 4HHAB 4N9GA 3ZKND 4JFYA 2Z0BA 3F58L 1U8OB 3HG1E 5SWQA 2C3VA 5TQ0L 5IW6A 2WAHA 3QQ3A 1VERA 4Y19B 3C87A 1A6AA 1CD8A 2OL3H 1YNTB 5IT2H 3G6JA 3TJHC 1JI2A 1FBIL 3AU1A 3L3GB 2YA1A 1N5AA 4K2UL 5E5RB 2QQQA 2Y5TA 4Q9BA 5GXBB 1FZKB 1MY7A 4NOBA 5EORH 3LCYA 4HKXB 4XNXL 3PV6B 3QCTL 4NIKB 3PGDB 4IRZL 2NXZD 4JPKH 3TJEL 3V0WH 5GGRB 4ODUA 4LLMB 1EUUA 5FF6B 2F19H 3T0EB 3QUKB 3P4OA 2XYCA 1ZLWK 4FQCL 8CGTA 2VOTA 2QSQA 5IBUB 1FRGH 1FZOA 1NGYA 1TCRB 4NCDA 5FB8B 3C5SB 1RZKC 1LVEA 3QFJB 3RDTC 4OT1L 1NGXB 1MAJA 3LEVH 4AYFA 4MJ5A 1T4KB 3MJ7A 4Z7WB 3L3JA 3DMMC 4NHUB 1A6ZA 4TVPH 4IMKC 3HZMA 4PGEA 1FO0H 4FTVB 4EI5D 2MJWA 4ZUSB 4PR5B 3MJ8A 2F15A 2BJML 1A14H 1XEDA 3OTTA 4UINL 2P8MA 1I1RA 5C0CD 4K94C 2HVKA 1Z3GL 3WO3B 3KXFB 1YEDB 1ZT7B 4NOFA 4OLXL 1O5DT 4WFGD 1ZA6A 4AIZB 4WHCA 1JGUL 4HV8B 3WLBA 5GGSA 1DZBA 3DYMA 4ZDHA 4ZOBA 4RGNB 5IJKC 1Q1JL 5MI0B 1AGFA 5DC4B 2YRZA 2MOVA 1RHHA 5CIPB 3MA7B 4KH2A 1J1XH 1YEEH 4LIQH 3WIIL 4N0YH 3CLFH 3FQTB 4ZSOE 3MFGB 4NZUL 4WU5B 1PW3A 1OP9A 5I75C 3KPPA 4FP8H 3EZJB 4KGJA 3PL6D 4Y4KA 1X4XA 4MAYC 1DCLA 4LMQI 5IB1B 1GGIH 4NKIH 2CDGB 1HH6B 2YD2A 3QISA 1ZLSL 2MCPH 4FS0A 2ZSVB 5CBAA 5GS0C 5HGAA 2NCMA 4URTB 4AK1A 3GIZH 1U8MA 2CH8A 5CUSH 2E7LC 4DGIL 5IB4B 4J1UB 4LCWD 3TO4D 5J6GB 2OX5A 1RZIB 4JJ5B 4U1KB 5CP7B 3TC9A 3K8LA 1MNUL 3U36B 3ZYJA 1X5AA 3ULUD 4R8WH 4QXWA 3FOMA 2CJUL 5IESL 4PTTB 3S34H 5DJ8A 4IRJB 2FGZA 4CVUA 1UA6L 1VPOL 3T3PE 5CSZB 3AS3A 4G9DA 4JG0L 4U1GC 2FJHA 5IQ7H 3I02B 4N0RA 4KK5D 1CLZH 5B3JF 3GGWB 2AJVL 4ZUTA 5D9SB 3TGXA 3TZVD 5F7UA 2XXMB 1X4YA 4RWYH 4FQXD 3U0PB 4BZ2H 4FXKA 4NWUH 5ICZA 4BH8A 1AR1D 4NUJB 4KJYB 3B5GA 5BZWB 5ABDE 1XMWA 5LWYH 3O3EB 4UAOB 1YC8A 4J3WA 1QEWA 3K46A 5BZDA 4P5MA 4M1DH 1HSAB 1MAKA 3GJFH 1F3JB 4F3FB 4G80B 2DS4A 3QFJE 1BJ8A 3GSVA 3MCLH 5C0GB 4E42B 5JR1L 2YPKB 1QSFB 3QIUA 4Z7WE 4HXBL 5EU5B 5IF0B 3GBML 3RUGE 2E7MA 4KK8D 4YHYC 2ORBH 5E2VH 4YXHH 5KSAC 3N85L 2E9IA 4FTVE 35C8L 2ICCA 1UWXH 5DEZA 2K7QA 2XWTA 4LVNB 3QDJB 1LO0L 4RAUA 2F58L 3BGFB 4PV8B 1WAAE 4NFBA 4ZS7H 2UZIH 4KHTL 4UMGA 5CJXA 2CKBB 3QJFA 1DUYB 1MY5A 5KVMC 4PD4J 4RA0C 5DJ6B 1KYOJ 2R69L 3GM8A 4YHLH 1NC2D 2VYRE 2PCPB 5C0BA 2FECI 4K9EC 4HGKC 1WZKA 4MX7A 4RGNE 3TJHD 5KS9B 3VFUB 4R9HA 4U0QB 2YEZB 2VITB 3IFPB 3QXVA 1PFCA 1B4JH 4N9GB 5KSUA 1ZHNB 1DSFL 3Q3GB 4JHAL 5CJ5A 3A6CH 3DROA 5MEPB 4MD5A 4LP4A 3LHPL 3FHQA 5ICYA 5IW6B 1JNHA 3BEWA 1FYTD 2DLFL 4FZEL 1PX3A 2YD6A 3G6JB 3MGTA 3KPRD 1GSMA 1TQCB 3AU1B 4FMKA 5CHNA 1HE7A 2B0SL 4OGAC 4DN4L 3JVGC 3KPSA 2H1PH 1KJ3L 2HJFA 2H26A 2B8OT 1U8QB 4DKAA 3MV9E 3PV7A 2YC1A 3TV3H 3AM8C 1YEIH 1EHAA 4X6CB 2X1WL 3RY5A 2H6PA 1OGTB 3BP4A 1E6JL 2CGRL 2R1WB 3MRGB 2WK2A 2NY3B 4ZG1A 4Y1AA 5GHWL 3BKJH 1MRFL 3DMMD 4I48A 1OP5K 2NLJA 1IC5H 2ZUTA 1IT9H 5FYLH 1MCEA 5B38B 1NGYB 4Y7MA 5B21A 1KIRA 5E08L 3CJJA 1U95A 4PRID 4WFFD 1JV5A 4GXVH 1A7QH 1R5IA 1J5OH 4U1MB 4M62L 4D9LL 4PD4K 4PP2A 1KYOK 4F7TB 4UU9B 2N7BA 3L3JB 4XVJH 3MLPA 4LPTA 3MRRA 1A6ZB 1RVFL 2OP4L 1Z0MA 2AEWA 3HZMB 1NBZB 4YEEA 4KZDL 3SKJL 3MR9B 1PX4A 1ZSDB 3RWIA 5L8LB 4PLOB 2R4SL 3MJ8B 2LTQC 1NAML 3WNKA 4UIMA 1I1AB 1EEZA 1UZ8B 4KI5C 4FQLL 3NCJH 5HHOA 3UJJH 4LRNH 4PJDB 2M8XA 3W2DH 3NA9L 4P4KB 2XKUA 3HNTH 3T2OA 1SYVA 5I1HH 3T3PF 4X5WB 2AK4E 5E8DH 4P5KA 4F2MB 3WLBB 1DL7L 4CW1A 1SEQL 3NCYS 4LCIH 3AFLA 5GS1B 2XQYG 3TNMA 2EE9A 2EDQA 2OK0H 5DMKA 3OG4B 3VMNA 3QUXC 1LO5A 4P5TC 4P2RB 5GS0D 5J1AB 3G5XA 2KUTA 4LSVH 3U0TB 2ZUUA 1OGAB 4XBEH 1GGCH 1XGYH 2OLDA 3WJLA 3C8DA 1WCQA 3OWEA 4LU5H 3EIFA 4G6FB 4PRNA 3TT1L 3HAEG 1NCAH 3I50L 1D9KB 3PDOA 4C59B 5CBAB 1S7UB 4RISL 1V3KA 2N1KA 3RUGF 2V5YA 4M93B 4JB9L 3VWJB 4GS7B 5CKGA 3UP1A 4UDTB 1XGRA 2QSCH 4CVZB 3T08A 3PWLA 3KPLA 1R3HB 1C5BL 3MRDB 5CBEA 1CXKA 1L9MA 5ADPL 3WUZA 1BVLA 4TVPE 2P5EE 3K80A 3FOMB 1KEGL 4LARL 2E9JA 5DJ8B 3F62A 1FLTX 3IKKA 2ESVD 5T3ZH 4OIIH 3UBXA 5T33L 3N1MC 3AMLA 1BJ1H 5L9DH 3PHOA 3MXVL 4J12A 1OAYH 1JK8B 5J7CC 2CDFB 4IOSD 4KUCD 4X6CE 4AT6B 1BFSA 4PS4H 5EWIL 2A9ML 1KIQA 4ZUWB 2PUQT 4EN3C 2KKQA 4BH8B 4WU7A 4YDVB 4JHWL 4NNPL 4PRAA 4K55A 4MZ3A 4G6KL 2EXYD 4U1IA 5BZDB 2OZ4L 1U8PB 5KSAD 3MLTB 1DBAH 2EC8A 3LKSA 4PY8I 4IDJH 5JXAH 2DQFB 4KDVA 5F9OL 1P4BH 3UROR 4LIQE 3LMJL 1Y0LA 1P7QB 3QIUB 4XC3L 3PWUB 4TUKL 2DQDL 4X8JB 1LO4H 3B9DA 1UWEL 1QRNE 2V9RA 3DTXA 4YFLI 1QG3A 4WI5A 5TDPB 1Q38A 4JPIA 3CH1B 4IIQA 3RZCD 1H15A 5E6IA 3QXDA 5FUCC 3MBXH 1BHGA 1FGNH 5J9PA 1IAII 3LIZL 1NGPL 4LSTH 1EVTC 4JPVL 4HKZB 2NX5B 4JFQA 5IB5B 1LE9A 3BW9A 1J8HD 2ICWA 4G8FA 5FM5M 1YEHL 4PJDE 1H3XA 3N06B 3MTRA 2ATPB 4KY1H 1Q0YH 4XP4L 4OUUB 2ITDB 4DUVA 3H9HA 4D9QD 4G7VL 3DUSB 4RMTA 5C0AA 5CZKA 2OR9L 5ACLA 3IFLH 5KSUB 4GKZA 4RMQA 4OGAD 2ICEA 4PRHE 3REVA 1U8LB 4KQ3H 4JM4L 2FH6A 5M94B 4KJWC 5ICYB 5EU7E 2F54A 1JNHB 1R6VA 2NY2C 2X40A 4R4FH 4LSSH 4TULL 5ERWA 1BIIB 4IOIA 1MLBB 3V95A 4CVXB 3UBXI 3EYQC 5JUEL 4MA1B 1KCVH 1NCNA 3KPSB 3LVEA 3V0AC 4TRPH 5DJDB 2H26B 4N1HB 4QRTA 3ARWA 3ZMRA 2GFBB 3SQOH 3GSRB 2YC1B 4QHLB 1KXQE 1UM5L 2EEBA 1I8KA 5AZEH 2H6PB 3WE6A 2I07A 4OCWH 1UEMA 1UJTA 3O6KH 5L0QC 5DMGD 1TTGA 3CDCA 4I3SL 2HJKA 3A67H 4OZIB 1MJ7H 4Y5YB 3EZ8A 1VDGA 1N5YL 1I3RA 3HCVB 3VG0L 4PJBF 5F88A 2A6DA 2IFGA 3ULSA 5I9QC 2ENSA 4JO2L 2FX9H 4Z8FL 3RHWK 1JV5B 4JLRA 1R5IB 1T2QH 3LRHA 3FQWA 2B20A 4OAWA 2PKDA 4LF3A 5HGBB 3MRRB 1A7OH 2APTA 5J6HB 1ADQH 1NMAH 2ZNWA 3EGSB 1A21A 3TF7C 3CFKB 4OQ1A 2VXSL 2ICWI 5KBNC 1GGYA 3EOBA 1BQHG 4NN6B 4G8GD 5JLZB 4R7NB 1BVKB 2XN9D 3R8BB 4PLKC 5IVZB 4PJ5B 5HHOB 3LD8B 4JFZH 4DWHA 3SDDA 4JRYA 4PJHA 4PGDB 5FA3B 2HP4A 5K9QI 3BYYA 1LP9A 3W5MA 4HFUL 4HGWA 4XNQA 1CBVH 3QUXD 1SYVB 4HC1A 1MFCH 4ORGB 2JB6A 4P5KB 3OXRA 1OAZL 4P5TD 2UZYB 4EXPX 1A4KA 1YY8A 2AKRA 3RU8H 2V2TB 5FYJH 2GCYB 3OXSB 3V5DB 5D7KE 5C09E 1LQSR 5ESQA 5E8OB 2DQJL 3VXUA 3P77A 3OGCA 3HPJB 5H2BA 4L5FL 5IIEB 2DL9A 5I8EA 1KELL 4OD2B 1DN2A 4P46A 3SDXB 3MODH 2KZ1B 4A6YB 2FATL 5D7JB 5DC0A 3L5XH 5IHLB 3NIDE 3B2UD 4N8VA 1GRWA 1T0MA 3EFFB 4DUWA 4PJXB 3FB7A 3PDOB 2R2EB 4XMPH 1T2XA 5GGTH 4X6DF 4S0SD 1XF5A 3EYFB 1PG7L 1H3PH 4F7MB 4LFHG 5HBBA 4ELKB 3VJ6A 3WV0A 4HS8L 3FAXA 5CEYB 2FB4L 5TE6H 1YEJL 4UTAH 3KPLB 2BVTA 4BFIB 2NW2A 3SDYL 3MROA 5EU4A 1P84J 3ES6A 4LAQL 5BRZD 4ELMB 4FQ1L 1MREH 5HPMB 3DX6B 1MRDL 4W68A 4EN3D 3AS2A 5I1IH 5IVXE 1MI5B 4ONGL 8FABA 2YWYA 3UBXB 1VA9A 3MO1B 3QUZC 4H26A 4AEFA 5BOPA 1N8ZA 1L0QA 1RZJL 4MHHI 3JXAA 2E6JA 3R4DA 3CUPB 3EBAA 2VLME 3QUMH 3CXHJ 1KIQB 4X6BB 1CGUA 1M7IA 3O9WC 3RGVC 5C9JB 5IFJA 4S2SA 3KYKL 4C55A 4QRRE 2DQCL 4XXDA 4U1IB 3PP4L 1G7JB 3KWWA 1C5CH 4Q2ZA 3NPZB 5I8OL 4NC1E 4HCRL 5FGBA 4AQOA 4FFVD 4ODXB 1HOCA 1AGBA 1MFBH 4NC2B 1DLFH 4ZNEA 2AJUH 4GO6B 2QKIA 1RZFL 5E2TH 2DTML 4I5BB 2J5LB 3B4NA 4JPIB 5GRYA 4IIQB 5DZNA 1H15B 1KENL 3LEYH 3NCFB 2GTWB 3HLAA 3CZJA 4QRSB 3MV8D 4KVNH 4IJ3B 2DLTA 2FIKB 5K59F 1EZVY 1IKNA 3JBG7 3RZWA 4JFQB 1TQBC 4NKOB 2RB8A 4OZGB 2ICWB 4G8FB 5ANME 2AJ3B 5HI4D 4PIRF 4E41D 2EYSA 1OD7A 3G5YB 3VD3A 1YECL 4M61B 1P84K 1G7PB 3PGFL 4L3EA 4Z7UA 2NY2D 1QBBA 1JYVA 4R97B 1PY9A 1C5DA 3FO1B 1QVOA 4LCWA 2HKHH 4XP9H 2BC4A 3VI4E 4CNIA 2F53D 1TJIL 4HKJA 3EYQD 3CLEH 3FQRA 2VLKB 3MLRL 5GSVA 4GKZB 5J12B 3IAGC 2C3HA 3U0WH 3RWFA 3TA3B 3D85B 4YQXH 2F54B 1QSED 3WFEH 4PP1C 1HQRB 5ERWB 3GMLB 2WANA 1PEZA 3P9MA 5E9DE 1IAMA 2VC2H 3IFNH 4YHKL 3GSQA 2Z9TA 1C08B 4H5SA 5BV7L 2Y5EA 4OV5A 3O6FB 3TZVA 1E6OL 4PJXE 4U1SB 2HMIC 4FQXA 2J8UE 4OGYH 4MJID 4PJIF 4G8EA 2I07B 2B5IB 2ID5A 1NCTA 4R4BB 4RZCB 3MLZH 4RX4D 4JM2A 1Z9SA 4U49A 4X7SL 1J0YA 3ZL4L 3VGGA 1I3RB 3KPOB 4WY7L 2B1AH 3O2VL 3H3KA 2A6DB 4FNLH 2EEAA 4CJ1A 3F7YB 4NPYB 4IHOA 1X5YA 2XZCL 2DDQH 2IALB 4ELME 2K1MA 1S7SA 2EC9T 3FQWB 4OAWB 4CKVX 6CGTA 4YX2H 2Y36L 4OM1H 2VQ1A 5DFVD 2YRLA 1BFOA 5LCVL 3SCMB 4FFYH 2YD3A 3EW3B 3MACL 3WJJC 4KHXL 4F15B 1B88A 5EU6D 1T5XA 2NY1C 3MOBL 1MAMH 3B2VL 2ADFL 5J0BA 3P11H 4X6FB 5JQHC 4YDKL 3W81A 1I7ZA 2ICES 3EOBB 4JDZA 4NQEA 3GSXA 5HDLA 1GZQA 5EB9A 5CFHA 3R8QA 4BZYA 4DZ8B 2OXHA 2R1XA 1ONQA 3QUYB 1A5FH 5EOCL 3ZKMD 3JUZA 3C5ZD 3GK8L 4XNQB 2AJSL 5I18H 3JTTB 3HI1B 4UOW1 5IVXF 1E27A 3LKOB 4PJEE 4I0CC 3CXDL 4U1NB 1JGVH 3QDAA 5DLML 1CLOL 1HILA 2VN7A 1WIUA 1GAFH 3D39D 1YA5A 1A2YB 4H0IA 2Z35B 2A83A 5H2BB 4OQTA 1D5IH 3ZKSD 4M00A 5I8CA 4UT7L 3X17A 2JIXD 3OMZA 1PKQA 1QZ1A 4L4TA 1G9EA 2UWEB 2CMRH 3KPQA 3TT3H 1QPXA 2FEEI 3IXTB 1S7RA 4RDQG 3UTPD 2YOCA 3P0VH 1P1ZB 2YZ8A 2GK2A 3VFRB 3C60A 2LV4A 3BJLA 1OAKH 1A1NA 2NXZB 4G5ZH 3RKDC 4XPGL 5FHAH 3RVUC 5K9OA 1OL0A 4O5LL 1MCLA 3FB7B 1J11A 1GPOL 4NO5A 5AWNL 3SBWA 2JK5B 4BQ9A 1FPTH 1X6LA 4EUPG 4Z78B 5JW5A 1XF5B 4HIHA 1GOGA 1JFQL 1O7SA 4K8RC 4S10A 3VXPA 3X11A 2WNGA 3FB6A 3H0TA 3LDBC 2D7NA 1CXLA 3QUZD 4OCXL 5F3BA 4GG6B 5EU4B 1MCWW 4JY6A 5DJAA 4TSCH 4Y2OA 3QA3A 1WEJL 1UKTA 5ISZA 4MQTB 5LXGL 3PHQA 3WNNA 5SX4I 4NJ9H 3RGVD 5DMJB 5IROC 4EI5B 1X44A 2PW1B 8FABB 5IWLA 1VADA 3VE0A 2W07A 2XZQH 5HHVH 4H26B 2VZ3A 3VI4F 3WFBH 3S4SB 5H37H 5IR1B 5DRWA 4OF7A 4PB0H 4AMKL 5C0CB 1IGCH 5IJVB 2FYYB 2VERN 4YBLB 5IFJB 1S9VB 4Z76B 4JZOB 5F7LB 1XF1A 4Q9RL 3X14A 5DEFA 2FO4A 3B9KA 4M1CD 4XXDB 5GIRA 1IM3A 3OX8B 1H3GA 3ARTA 1DEEA 3CU7A 2OMBA 3FMGL 2XNAB 2HFGL 1ZT4B 4HBCH 3IB4A 1MVUA 1KCKA 5L88L 3V4PH 4QRPE 2NR6C 2RGSA 4LLAA 1IC7L 2J8UF 1AGBB 1JF6A 3VG9B 4KMQA 1T04B 5AG9A 4K94H 4WWID 3VWKD 1BBDL 2WIIA 3PL6B 1QLRB 4R90H 1T03L 2ZPKH 2YPLD 3L3OB 2VN4A 3IETB 4M02A 4GAFB 2OJZL 5IEKA 2ILLA 2EYSB 4XVUC 4KC3B 3ZO0A 2FZ3A 4NJAH 4L3EB 2X6MA 1CXIA 1OAUH 3GHEL 3QEHA 4PP1D 5D5MA 4Y8AA 5F7FA 1IGYB 1TDQA 4XH2A 4LCWB 4KFZC 3TO4B 3U1SL 1KXVC 5T5FL 1Q9WA 4HKJB 2FNBA 3IT8D 5H94A 2B4CL 4PJ8C 3RWFB 4NM8H 3QIBC 3CX5J 5GGQL 1YYLL 2HMID 1V7MH 3BWAA 1PY4A 2EDLA 4NQUA 4WEUD 3FT2A 3CCHA 4PJCE 4WJ5A 5KN5A 4KI1A 2YUZA 3P9MB 1IGJB 3T2NH 4MNQE 1F6LL 5IVNA 4H1LG 4GXUM 3RY4A 4PJEF 2JJTA 3WCYA 3TZVB 4YUEH 1OPGL 4MAUH 5HTSA 4FQXB 2OTWA 5D2NC 4NNXA 4G8EB 5FO7A 4YZFE 2OL3L 4HD9A 5IT2L 1T80A 2VMFA 3IDGB 3H3PL 3X13A 3MCKB 2IAMA 1JPSH 4F9LC 1T1WA 4XVTH 4QYOB 5DJ0A 3T0XA 4HWUA 4GG6E 3GSOA 1GCFA 3P9LA 4IHOB 2UYLA 2PYEE 4U3CA 3WSQH 1AGDB 1S7SB 5C6TH 3BD3A 3PDDA 5EBWA 1A9BA 1F3DH 32C2A 5K9JL 3RZCA 3WL9B 1YUHA 1IFHH 5DUMH 2OZ4A 3LAFA 1T5XB 5FM4A 4GMSL 2C5DC 3LS5H 3NFSL 1I7ZB 1A6VL 4JDZB 5BS0E 3GSXB 3LEVL 3MREB 1FVCA 1NC2B 4WFHD 5L7XH 2XZZA 4QTHB 5AZ2H 1GIGH 3JZ7A 5HYJD 4ACPA 4DW2L 3CX5K 4HS6B 3C6LD 3NIFE 4Z7QE 3QDGD 5HHPA 3V7MA 1IBGH 1Y18A 2V2WA 2VIRA 4ERSH 3NACH 1WC7A 5JA8B 3P4MA 1INQA 1HILB 3U9UA 3U4BH 3BRGC 3ARSA 4LEOA 4PFEA 4ZUUB 1UM6H 4WI9A 3RVUD 3S9DB 2R29L 1J0IA 4ISVA 5D6DC 2GAZA 2PN5A 5I8CB 3KPRB 4YDIL 1PKQB 2HVJA 5F7YC 3VDAA 3KPQB 1NFIA 3OB8A 4PJFB 1GC1H 4D8PB 1BFTA 1JPFA 1I7RA 3B3IA 1A1NB 1T6WA 2R23B 3BIAX 1JRHI 2QADC 5K9OB 1KCLA 4M48H 1J1XL 1YEEL 3D0LA 4N0YL 4X6EA 4NO5B 3MRNA 5C2BH 4UV7L 1CK0H 3SEPA 4X4XA 4FQQA 3DMMB 2GKIA 4HIHB 4FP8L 3RL1A 5CD3A 3E1F1 4U6HA 1YMMD 2DWDB 1H3UA 1FG9C 3FB6B 3H0TB 5C07E 5C0NC 3MRLA 4PJ9C 2X70B 2AEQH 2AW2A 4PRIB 4DOHE 2MCPL 1ROWA 1T1YA 3MRPB 2VDRH 2J88L 3ARBC 3SGDI 3CMGA 1NPUA 3PHQB 1F4XH 1GH7A 2E8YA 4GXUN 1YYMH 5DQDH 4BJLA 5JW4N 4FZ8L 1AO7D 1ZLUH 1BIHA 2DQEH 1Q9KB 2WM0A 2IANA 4XVSH 3T0VA 1HHJA 2QSVA 3PE9A 3MYZA 4I77L 4R8WL 2XN9A 1OY3B 5DRWB 5I66B 1B0GA 3T09A 1W0WB 2NR6D 3MX0A 1YPZF 4FQJH 4NQDE 2XI9A 1QFUH 3KPNA 4Y2DD 4P2QD 4F80A 3FO9B 1IM3B 2HG5A 5CZXC 5IQ7L 1CLZL 4BK4A 2JJVA 1MHCA 2HN7B 1MSPA 2VLJA 3UJIL 5I75B 3KNBA 4WCYL 2VXQH 4RWYL 3BKCH 2IH3B 3QNYA 3FQUA 3TBTB 5K93A 1NSNH 4YZFF 4RQQB 1CICC 5D1ZC 2CUIA 2H2PC 4XVUD 3OAYH 4OGZA 5C0RH 4UDUB 5GPRA 1BD2D 4IOFD 2WIIB 5J13C 2G75A 5CJQH 4P23C 2R8SH 1I1FB 4AENA 3OKOA 4DGYH 1NQBA 1X5FA 4L8BB 5I73C 2JCCF 2DL2A 3QIBD 4ODSH 1T21A 4QOKD 1IAOA 5D5MB 3GZKA 2WINB 4E0RA 4XH2B 2DI9A 3IJHB 4Q6YA 3OB0H 4ZS7L 4U1GB 3FAWA 4HJGA 2IH1A 3CVHB 1HCFX 3UTSD 3UXFA 4X80L 1XCQB 2GK0B 5MENE 2VZ1A 3VRIB 4YHLL 3U30C 3P4LA 4KROC 1FYTE 3T1FA 3KPRE 3IJYA 4RFOL 3CCHB 3IDMA 5C0FA 3ABZA 3NIFF 2ESVB 4UQ3A 2V6HA 1M7DB 3O2DL 4PJFE 5HGGS 5JNYA 1B4JL 1G0DA 2GTZB 1H5BA 1NBVH 2R1YB 2GJ6E 2DQIH 1CLYL 5HHME 1A6UH 4NZTL 4Z6AT 2OTWB 4OLUH 4DCQA 3VXSE 4XBPA 4NNXB 2ADGB 3WDHA 4F7PA 1SMAA 1S5IH 4I4WA 4Q9QL 1IEBB 1M6OA 5IMLB 4YHYB 5KSAB 4Y5VA 1HINH 2O5YH 1T1WB 3AC0A 4OZHE 2H1PL 1EO7A 2XY1A 3F65A 4C83A 4P9HH 2C1OB 1KB9K 3C5JA 4JY5L 5C7XH 3GDBA 3P9LB 1NMCB 4B7IA 3HR5A 2UYLB 5DD5L 1BLNA 2A9NH 1SHMA 3U6RA 3QG7H 1OARL 3WNLA 3BXNA 4OKVB 1A9BB 32C2B 4PJGB 3RZCB 3LV3A 2NW3B 3EOAA 1YUHB 1IT9L 4W4NA 1CFNA 5FYLL 1LNUA 3PGCB 1R5VB 3MV01 1F11A 3TIDB 2DF3A 1IEAB 1J5OL 4RFNC 1J8HB 4S1DC 2BMKA 2ADIA 2V2XB 1NUDA 2GQHA 3PWNA 5D7IB 1ZEAH 1JGDA 1P2CA 5JPMB 1QFOA 3MUGA 3FQNB 5DR5H 1KNOB 1U8NA 2PF6A 3K1KC 4ETQA 2V2WB 1Y18B 5AYUL 1NCCH 1R3KB 1Y6NR 4JZJC 5GRZA 1MCIA 3P4MB 4EZMA 4JVUA 1T7ZA 1MVFA 2WLZA 3EJZD 3H9SE 4FA8A 1NMBH 4LRNL 1AQKH 1LO3L 1PJ9A 5E1AA 3E8UH 3W2DL 1NFDF 2FX8H 2CRIA 1QSEA 2QADD 4OD3H 3HNTL 4ISVB 4QHKI 5I1HL 5M95B 3N1PC 4PJ7B 3W9DB 5E8DL 4QCIB 3GB7A 2HVJB 5EULV 5DTFB 3MLVH 3WXWL 1NFIB 2PW2A 3TN0D 5DF0A 2ZOLA 5E99H 4LCIL 3UYRH 3V6OE 5JHLL 4MA3A 5I1DB 3QIWA 3GMQA 3QQ4A 1JPFB 1I7RB 5HGHB 3P30H 2OK0L 1MCQA 4PJ9D 4MJIA 3D0LB 3H42H 3VGAC 2E3VA 4KDWA 5E8PA 3UTTD 3HE6A 4JKKA 1OTUC 5K33A 4RX4A 3ARBD 5AYQA 2VNCA 4LSVL 1N59B 1MQKH 5EBMA 3RL1B 4KKCC 4M5ZH 1NJ9A 4XBEL 4XXCC 3GMOA 1TJHL 3MRLB 4LU5L 3HB3D 1RUPL 5LGJA 1XR8A 5T1KA 2VAAB 5BW7A 2LTQB 1P53A 1T1YB 2E6QA 3BUYB 2IJ0C 5FECA 4WTZA 5AUMA 3QXAA 2MFNA 5HSFA 2CIIA 3AY4A 5F1NA 2ESVE 1DBKH 2QSCL 5EBLB 3LZFL 3BZ4B 5CZXD 3T3ME 1ACYH 2GT9B 3VXRE 3BGMA 5KVGL 3VDBA 1HHJB 2ZUQC 4G8GB 4NQVB 1HSBA 2XN9B 3U83A 2C4FT 1RMFH 3UZEA 5KVFL 2FEDC 3GO1H 1SY6L 1NLDH 3G5VA 1B0GB 1PAMA 3TO2B 1W72A 2FGWH 1Z6JT 3HI6L 2Y25A 1FAIH 3C5ZA 4XCYA 4RMRA 3QUXB 5DRXA 2XXCB 4OIIL 5T3ZL 3T65A 2HG5B 1CICD 5D1ZD 2H2PD 4P5TB 3CFEB 1BJ1J 2W60A 3I6LD 4OLYL 3IS1X 4N9OB 4PS4L 2F8VA 3ULVH 4K7FA 5IBTL 3ME0A 2HH0L 3B9VA 4HUVA 1HWGB 4YO0A 3QNYB 4NKDA 5BOZG 4PJGE 2JIXA 5A1AA 1DBAL 3SKOA 4ALAH 5A16A 4HK0A 3GSNL 5JXAL 3KPMB 2NY6C 1J05B 3CC5B 3DLQR 5F72S 4JQXA 1A7NH 1QYGH 3DIFA 1P4BL 4OZHF 2QQKH 1J8HE 4MA8L 1E28A 4MXQC 5D7IE 2AEIT 3QEQA 2P5WD 1LO4L 5GRUH 1NGWB 3DSFH 2J8OA 5E00A 4S1QL 2YD7A 4KROD 1IAOB 3MBXL 3CFBA 1FGNL 4JKPL 4KMTL 3NABL 2NY0D 5IVOA 3EDFA 2IH1B 3ZZ1A 5JA9A 3MLYH 4LSUL 5F89B 4N5UA 4NQXB 3H6JA 5BRZB 3LY6A 4OCSL 4E9LA 2EKJA 1Q0YL 2HJLB 3VXMD 5GGUA 1KXTB 1SJHA 5F8QC 4EN3B 2XTJC 2BY0A 3W39B 3IDMB 2XPGB 3IFLL 3ZDYE 5SWZD 1R3JA 3MLWL 1RULH 4F58H 1AXTH 3V52H 3FONB 4DQOH 4EI6B 5B39B 1CD1B 4R4FL 4DCQB 2ERJC 3CK0H 5I1JH 4ENEC 2X4QB 4F7PB 3U46B 1IAIH 4PY7A 4N0UB 3WS6C 5C0IB 4I4WB 4OTXL 5C0EA 3QQ9C 4OB5L 2HLFC 1KCVL 1F45A 3S36H 3IYLW 3MRIB 1ZHLA 1UH2A 4FQ2H 4TRPL 4DK6A 3HNSL 3SQOL 2H32A 3X12A 2IPTH 4V1DA 4KI5E 5AZEL 2CLRA 1XIWA 5D7SH 2R4RH 1E4XI 4S1DD 5ESVB 3U6RB 4KRPC 1NBYB 4GAGH 4UT9H 3A67L 1MJ7L 3VWKA 1F13A 3EOAB 4HEME 1LNUB 3QI9C 5D72H 5TFSH 3MV8B 3OGOE 3SJVD 2VLLA 2Z31A 1F11B 1VFOA 2XWJA 1T2QL 4YDJB 2ADIB 1LD9A 3RWEA 5DGQA 4E41B 5DD6A 3FRUA 1T7YA 3QJHA 4Q97A 4YXLH 4GRMA 2DMCA 2NY2B 1ADQL 1NMAL 2BCKB 4GUPB 2ZOKA 1TZIB 5ENWA 4JGMA 5HDBE 3RBGA 4ETYA 2QR0A 3TVMA 4TTGA 3TBWA 1ZOXA 4N5EC 3QPXH 4NRZA 1BOYA 4MSWB 2F53B 2D0HA 1RZGA 3KLAB 3W0WD 2X4NA 3QHZL 3DVIA 3DV6A 4Z7VA 5TDNB 2BXZA 4LCUA 4GMTL 4HDIA 3FOLB 1I85C 3E0GA 5E1AB 3L7EA 4AQ1B 4JY4A 1QSEB 3QNZA 5H8DA 3RPIA 3UZVB 4OIBA 4LLUA 1P6AB 1CBVL 5JMRA 1JF1B 4WV1C 3VD9A 5L0QB 3FRPG 4LFHD 5IW3A 3SE8H 2DI8A 3V8OA 4KKCD 2AJZA 1HXYA 4MA3B 2W38A 2XY2A 5EC2A 3QEUA 1FNEA 5I9QB 3BKYL 1N26A 4UILH 4MJIB 1LE5B 5T1LD 2EECA 2OMNA 3UDWA 4JQIH 1LDPH 5C8JA 2WP3O 4F8TA 1N2RB 4RFEA 1AD0B 3MZTA 3TCXA 3ARXA 1RUAH 1J12A 3VFWB 1A0QH 1W8NA 3GMOB 3LN9A 1JPGA 5L2KA 1N64L 1U8HA 1G84A 2P4AB 3QIWC 5BRZE 3V5HA 1X7QB 3DRQB 5ITBH 5FECB 1JPST 4QF1A 5AUMB 4TUJA 2FEDD 1N6VA 4G9FA 1WFTA 4RNRB 4G3YH 5EU6B 4GRLD 1JTPA 1MEXL 5TE6L 5GRJH 4S11A 3WFHA 2DKMA 1NEUA 3PJSA 4KRMB 3AGVA 1I9IH 2I60L 2IFFL 3BGMB 4I9WE 4L1DA 4N8PA 5KS9F 4GOSA 1EV2E 1MREL 1QOKA 4RIRA 3G5VB 3L3IA 3BP7A 5FCUH 1JNNL 1W72B 5I1IL 2MKWA 3C6LA 3C5ZB 5T3XH 4ZD3H 1OTSC 4LSQH 4JFEA 3S3SA 3TPUB 3G6JF 3B5TA 1FLRH 1AR2A 5DJZA 1FQ9C 4XNMB 4U1HB 2NY6D 3BO8A 1AHWA 1NEZB 3MA9L 5EU3B 3VGHA 3ROOB 3D39B 4DUXA 1DN0B 4HUVB 4MXQD 3JWDH 1ITCA 4QHUB 3O11A 3IU4H 4RGMC 3GBLA 3VD5A 4NQSB 2GJZB 3BQUA 3MBEA 1ZA3B 1D5BB 2JIXB 3F7PC 3VGBA 2VDKH 2YD5A 2UVFA 1VGKA 4X7DC 2ITCB 5AAMA 5DEGA 2VZTA 1MRCH 4AG4H 3VDCA 4I2XE 2H9GB 1MFBL 1ZHKA 3IJSA 5ECJE 5E2TL 5A2FA 2OBGA 5D8JH 2VDPH 3RNKA 3LEYL 3T8XA 5I17A 2ZKHH 5C0BE 4X0KA 1YMMA 2DOCA 1BEYL 3STZB 2XTJD 1ZVSA 3MLUL 1WIPA 4Y88A 4YDLC 5IHZB 1CQKA 3QUZB 4WI8A 1EO8H 4HC1H 5BJTA 1C16B 3EYOA 5DSCB 1DQDH 1SJHB 4XCEA 1BJMA 3RGVB 1UADC 1SBSH 2CUHA 4X6DA 4ENED 1FZJA 5HDBF 2IG2H 5FM5O 1N6QL 4L4JA 4NQCE 2APFA 2HLFD 5MP6L 3MRMA 4LLDB 1XF2B 3OKKB 3L3HA 3U0WL 3Q48A 3MLXL 4K8RH 2WSKA 5I76A 1K6QH 1IGTB 4YQXL 3WFEL 2YXMA 3MPCA 1MJJA 4K23L 5CEZD 5HYQA 4L8SA 3VFNB 1I8MB 1KJ2L 4Y2DA 1I1YA 4KRPD 2L7UA 3F58H 1J1OL 3QZWA 1S7XA 3G9VA 3ULVE 3O4LD 1OTTC 3HC0B 3RVWC 4JG1H 3RIAF 3QI9D 3X12B 2WQ8A 1WBXA 1ZT1B 4OGYL 4K2UH 1H0DA 4XX1G 1TQBB 1HKLL 1HDMB 1YQVH 2G60L 3GSWB 1IL1B 2Q8AH 3QDMA 1KPUB 1RUKL 4XNXH 3QCTH 5D2LE 4IRZH 2B1HL 5F21B 4M9PA 4O02H 3K8MA 3HG1D 3VWKB 4RA3A 5SWSA 4FNLL 3HS0B 5T5NF 1A02N 3SDAA 4XPFH 3WIFA 2XWJB 4L4VE 2YPLB 2DDQL 2R0WH 2LVCA 2ZP0T 3FRUB 2IMNA 1U3HC 4OM1L 4YX2L 4AH2B 5IB3B 1WFUA 4J8RA 1DBMH 3BE1L 2EO9A 1U9KA 4BSWA 3TH3T 5E95B 5ENWB 4KZEL 5EUOA 2FL5B 3P11L 3ZSSA 3UTSA 5EO1B 1KF9B 1A6TA 2JJSC 3DV6B 3NN8B 4LCUB 3NOIA 2CIKA 3L7EB 2FJFB 3QNZB 3RPIB 1A5FL 1N0LA 3A0OA 1AC0A 2UV3A 4LLUB 1RY7B 3M8OL 4U7MA 4GJTB 1T0NB 1Q94B 1JGVL 4C4KO 2P46B 3TWCH 2EXWC 4N68A 4HFWB 2AJZB 5JTWA 2LU3A 1GAFL 4Y5XC 2OR7A 3QWRD 1NKRA 3NPSB 3DECA 5JW4R 3FTGB 1D5IL 3DGGA 1J0ZA 4KK6D 1MUJB 2BFVH 2CMRL 4OLWH 3SGJC 3O2DA 1OAKL 4XZUB 4HUUA 4NZUH 3DXAA 3O6LL 2MQ3A 3BEVA 2B4CC 3P4NA 1H8NA 1FPTL 2OYPA 4QF1B 4KV5E 4EEEA 5C08D 5I1LA 4TUJB 1XF4B 1GGBL 3ULUH 3GHBH 5CWSA 2IADA 3BMWA 1S9WB 1EXUB 1C7TA 1DVFC 1ZAGA 3L95A 4RAVA 2YD4A 4YNYB 3WFHB 1OTSD 4Y4FD 1TVBA 1FG2A 4R0LC 4U6TA 2DM4A 3QWOB 3EHBD 43CAA 3MFFB 2XICA 3JTSB 4DGIH 2PXYC 4U6XA 3L3IB 4NJ9L 4J7RA 5HYJB 4TUOB 3UTQB 3C6LB 3F6LA 1MNUH 3QDGB 1XCTA 1T83A 2E7BA 5FDWA 2XZQL 4KXZI 3KVQA 1YZZA 2PTTA 5F9JA 5DJZB 3UC0L 3BO8B 5KTEL 3AAZB 3QO0A 1VPOH 4PB0L 3SKMB 4JG0H 4APQC 4P9ML 1N3NA 2MTPA 5HHXL 5EDXA 3LEXB 3IU3A 4HPYH 3RVTD 5MEQA 2ED7A 2AJVH 1S9KC 1RJLB 2YUVA 1T7WA 3VH8A 1P9MC 3O8XA 1G7HA 1EAPB 3OKEA 1UG9A 1HKFA 4YIQB 3TN0A 3H8NA 5C0DA 1K5NA 1CG9A 3QO1A 1TFHA 1NC4D 1VEOA 4EIGB 1MIEH 1B9ZA 5SX4H 3U7WL 3LDBB 1XGQA 1WLHA 1ZHKB 4PG2A 2O61B 1B3JA 3OQ3B 4PRPD 5HYSA 3TP4A 1DFBL 3T8XB 1GYAA 3F7VA 2A2QT 1YMMB 4G6MH 1ZVSB 4I18A 4QY8A 2G5BA 5C0AE 2YXFA 3FZUC 3N85H 5GZOC 5D96C 4C57C 2E5EA 1HEZA 2R56L 1BF2A 3IKCB 1LO0H 1QQDA 4DKFL 2F58H 3EYOB 3G6DL 3PIQA 1OAUL 3V4UL 1F4AA 1KC5H 4UZGA 4OZFA 2R69H 5B8CC 4HKBA 1HQ4B 1ZVHA 1AO7B 1UQSA 2WWKO 4OQTH 3SGKA 1AFVH 2UY6A 5DFWH 2D0GA 1OTTD 3V6FA 5I1KH 5JOPD 2CRYA 4YR6A 3V6ZA 5T3XE 4HT1L 5HDQH 2AXHA 1MJJB 2AV1A 1AXSA 4ZXBC 4EDWH 1S9YB 4JR9L 4HLZH 1DSFH 4P2QB 4MWFA 4Y2DB 2IEPA 3RGHA 2A74B 1DANU 2DQGH 1JHKH 2X1OA 4LOUC 5EO9B 3RFZC 1JZ6A 3EYVA 5ICXA 3MNVA 3FN9A 3ARGC 4IRSA 3TLRA 3F5WB 2B0SH 1A1MB 1SY6A 4BKLB 2FJGA 3MRQB 4MDJA 4V2CB 1U3HD 4HWBA 3RNQB 4XVTL 1BD2B 1I4FB 4JO3L 2F74B 1E6JH 2CGRH 3WIFB 2AQ3A 2GSGB 4X4MA 2W65A 3UPAA 3DUUA 2VZUA 1TVHB 4WFHE 5DQJA 4BH7A 4KJPC 3ARDC 5MEOA 2V7NA 2VAJA 3QIBB 3MNZB 3P0YH 3QDGE 5FOBA 4QOKB 1IFHL 3MV9D 1LP9E 2K9UA 4XB7A 4JFDE 4K7PX 5EUOB 4M62H 4XT1C 3GSNA 4H0GA 3LS5L 4D9LH 1JZ3A 4CU8A 1E4WL 3S96A 5FO9A 3UTSB 4HQQH 1RVFH 4O2FA 1IZJA 2OP4H 3BVNB 2EXWD 4NQTA 2Y4SA 5AZ2L 1GIGL 5H37G 1LEKA 1BOGA 1OB1A 1FVEB 1NLBH 3G04A 5D2NB 3SY0B 5EO0A 1HWHB 1U2HA 2GUOB 3GMNA 3TIEB 4ERSL 4FQLH 3TEUA 1PD6A 5ESAB 2NXYD 1LEIA 4OD1L 3NA9H 1YEGL 1DDHA 1VFUA 1UT9A 3H9ZA 5DI8B 1DQMH 3K7UA 4YHOH 3STLA 1FL5A 3U4BL 4J3OC 3WN5C 3UYPA 2XKNA 1JJUA 1DL7H 1SEBA 3R1GH 1SEQH 2YD8A 4LPUA 3QB7C 2VR9A 1WSST 1P4LA 4LCCC 3L7FB 1GC1L 1J88A 3ZE2E 5FGCB 5DJ2A 4NCC1 1RFDL 1N7ML 4Z5RA 2DQUH 1BQHA 1O0VA 1DVFD 5BMFH 4M8VA 2C3GA 2RIKA 1QLFA 1QFHA 1OWWA 2AK4D 2W92A 1HH9A 1CK0L 3MGOA 4XBGB 2CKBL 1F4WL 5DJCA 5MERB 5I1LB 1D6EB 3B6SA 3TT1H 1CL7H 5CWSB 5GGRY 1A6WL 1K4CA 4B53A 5DS8A 2V7HA 3I50H 1ZLVH 1AI1H 4RISH 2AEQL 2C1PB 3MJ9A 4MA7H 4DFIA 5DD1H 1C12B 5JDSA 2VDRL 4JB9H 4MNGE 4HG4J 3I6GA 2VXTL 1F4XL 4APQD 5IOPB 4MVBC 2CRZA 2BRRL 3W11C 4OGXH 3JV4A 3KPTA 1TTUA 1C1EL 5ADPH 2G9HA 4XWOC 2X41A 5KANI 4UBDD 2PTTB 2VL5A 2DQEL 3PWPA 4LARH 3CFDA 2ZWLT 5E5UB 2DN7A 3HAEB 3GUTA 2CD0A 5KG9A 5H35B 3KYMB 1EK3A 2WBJA 2CK0H 2QADB 2DBJA 4JRXE 5MEQB 4RRPA 5EWIH 3MRCB 2A9MH 3VH8B 1KG0A 3LQZA 1EO5A 1G7HB 1OSZB 2P5ED 4TVPD 3OKEB 3TN0B 1P4IH 1YN6A 2VXQL 3DHJA 4RMUA 2X4PB 3IDUA 5C0DB 1K5NB 3L9RA 3BKCL 1CG9B 5CINL 7CGTA 1BGXL 2AVGA 4G6KH 3HUJA 4PJ9B 2OZ4H 5GJSH 1T5WA 4OLEA 4HH9A 2PYFA 3FZUD 1KB5B 4UUJB 2VWEC 3UTTB 2VXUH 3ARBB 4OF5A 4GLRI 5B3NA 3G5ZA 3F7VB 3TBSA 3HNVH 4Z7UE 4L8CA 4XC3H 4PJAA 2CKNA 4B50A 4TUKH 1HXMB 2OJEB 4I18B 5HPOA 1UWEH 2G5BB 4X7FC 4Z0BH 3UMTA 4GQ9H 4DGYL 1LMKA 1UWGL 1U6AL 5T1MB 2AI0L 3QG6A 3CSBA 5D2NE 2I24N 1XGPA 3PIQB 1G7IA 2CLVA 4JPVH 4HG4K 3DX8A 4LKXB 3H9YA 4MNHA 1QR1A 3VMOA 4ZXBD 4L29B 4OZFB 4PJHF 1YEHH 2E8ZA 2EIEA 1OP3H 2EIDA 4R7DB 3HC3H 1U91B 1QRND 4G43A 3UZQA 4J3SA 1WJ3A 3UCRA 3V6FB 4LOUD 4XP4H 1ZLUK 3ROLB 3L5WB 4IMLB 3FFCE 2X4OA 1RUMH 1JZ4A 2AV1B 4DVBB 3ARGD 4FQHB 1OF2B 4XNZC 1BECA 3CH8A 2X1XR 2RFXB 4JANB 4H20L 1CICB 1NBQA 3L3KB 3WIHA 1L7TH 2NTFB 5D93C 3MOQA 1FFPA 1A6UL 5J13B 4I0PC 1AD9A 4OLUL 9CGTA 1GZPA 3MNVB 4MJ2A 4HGMA 5EOTA 3F7RA 3MUHL 4HSQA 1S5IL 4KGLA 1PBYA 1QBML 2FJGB 2VZOA 4KJPD 2C3XA 3ARDD 5I73B 1U8KB 4PRHD 4RMVA 1HINL 3VXQB 2OTUA 1U8JA 5CSBA 4GBXC 1RJCA 3C08L 2VABB 2JB5H 4P9HL 1JHLH 4J23A 4TNVF 4P2CG 2FECL 3RBSA 2W65B 4I3SH 4KAQL 3ALXA 4K3JL 3WD5H 2P5WB 4NQEE 1EIBA 4PRDB 1A3LH 3NIGE 2DQTL 1LO2L 3HMXA 4OLZH 3SOBL 3VG0H 5MEOB 4M3KB 2NZIA 4KROB 4JE4B 3KYNB 4JO2H 4P99A 4J3VA 1QBLH 4YHIA 2NY0B 2J3SA 4GG8B 4WTXA 3LRSA 5IFHL 1R24A 2EO1A 2J12B 3OJVC 4P4RB 4CDHA 3OB0K 4O2FB 4S1SL 3HE7C 3EOYG 4PRBB 4ODWA 1IARB 1VEMA 1BOGB 5DK0A 3VXMB 1NCCL 1AIFA 2Z4QB 4CL7A 4XTRC 3S6CA 5F44A 5SWZB 3F12A 4L4TE 3LB6C 1DDHB 4PG9A 5B4MC 1WFNA 2W91A 4OBSA 2BXYA 1FL5B 1AQKL 2GSIB 3C8HA 3WDJA 3BISA 1JIBA 1OAZH 3VXNB 4IS6B 3BPCA 1RIVL 1DR9A 2DIJA 1I3UA 3GI9H 4WEMB 1AE6H 4WUUA 4YHZH 2VRAA 2EDXA 5E99L 1YJDH 2P42B 3DVGB 4NRXB 1XH3B 2X09A 4L5FH 1X5XA 4U1LA 1BQHB 2IPUK 4ZO8A 2HFTA 1MHEB 4CU6A 3O0RL 4PBWD 3H42L 1BZ9A 1QLFB 2KH2B 4MQ7A 5KSBB 4Y4HD 3BPNC 3N1QC 3MGOB 3PXHA 3ECBA 4JQVC 2AV7A 2EDBA 5CD5D 1MQKL 5E5MB 1EA9C 3AUVA 1KJ2A 5D7KD 3RL2A 5C09D 3EUUA 3LSOA 4MVBD 4MD4A 2W59A 5DS8B 3W11D 1ZHBA 5F71A 4LCYA 3SJVB 3DX9A 1UXSB 4JZJB 12E8H 2CSPA 5EOQH 3DURA 4BYHA 2N7AA 4X5LA 5CZVH 43C9A 2E6PA 2AXGB 1FNGB 2HTLC 4M6AA 1IVLA 1UVQA 3ULUF 4MQXC 1WZ1L 1YEJH 5BXFA 3C2SA 3SDYH 3B5HA 4FXGB 3TBVA 2G9HB 4OLVL 2Q8BL 4LAQH 1CDBA 5CILH 4G6AC 4HS3A 1LK2A 3W0WB 3D0VB 2Z91B 4D0CA 2WIMA 2X4SB 5GRWA 1ULVA 3BZDA 2Z8RA 2FR4A 4ONGH 5KG9B 1IQDB 2FGWL 3M17A 2WBJB 1D6VL 4EUPA 1TZHB 4JO4H 3SE3C 1RZJH 1MHHA 1JP5A 1QFWH 1T0PB 2HRPH 2P48B 1KG0B 1K2DB 2CR6A 1TMCB 1Q9OB 3RIFF 4XP1H 1YN6B 4JM2F 3ZSTA 1FAKT 3KYKH 2IPUG 2P5WE 2VDQH 4NFCA 1U8IB 4TTDC 3HUJB 3BH9A 4MXVE 4HH9B 5T1LB 5T5NG 5EZLA 1VEPA 3CFJA 4R3SA 1M1SA 1AJ7L 1P7KB 3P2TA 4ALAL 3HZKB 5I8OH 1L4IA 2ARJQ 4ZUVB 5DD0L 3G5ZB 2VLMD 2QQKL 1DQLL 2XG5A 2WV3A 3GMMB 1ZTXL 4U6YA 4JZNB 5IKCA 2DTMH 4QRRD 3JWOL 3OV6A 1KENH 3RTQA 5CKAA 3DSFL 3MYJB 3UAJC 3VXME 1OVZA 3EO9L 3QQNA 1B0RB 1XGPB 2CLVB 2XZAH 5C1MB 3BZEB 1QR1B 5GZNC 4QHMB 4NO0D 5SWZE 4GRLB 1CVRA 2Z8WC 2VH5L 2IQ9H 1YECH 3D18A 4M7ZC 1F4YH 4ZSOA 3BP6A 3WEXA 2Y7QB 1TJIH 4ZFGH 4YJZL 5ADOH 3M1BA 5JOFA 1F6FB 3CIQA 3RA7L 5CMAA 3HI5L 1AXTL 1XAUA 2NY6B 2VB5A 3PP3H 5INDA 3D25B 4A6YL 3V4VL 2EKSA 4GAJL 1SJXA 2AABH 1KV3A 3CK0L 4X9GA 1CIUA 1IAIL 1TETL 3ZT6A 4NO2B 5BV7H 5IEHB 3FB5B 1U8OA 1NCBH 5DDHB 2OTUB 1OCWL 3HN3A 4Y19A 1WK0A 2BNUA 4PREA 1ZGLP 1RV6X 5T3ZD 5FYKL 1EFXD 3L3GA 2R4RL 3KYOB 2EH7L 1FZKA 5E9DD 4AM0B 3ZL4H 3HE7D 4NRYA 4BQ6A 4UT9L 4HKXA 4WY7H 4ESKA 1T20B 3PV6A 4OSUH 2RCSH 1ED3B 5GGRA 4LLMA 5D72L 3MQIA 5TFSL 1WWCA 3T0EA 3QUKA 4YHIB 2XTJB 4XTRD 1W72H 4EKXA 3LQMA 1R24B 3D87B 4XPBH 2RHEA 3SO3B 5GISH 3LB6D 4H88L 4FMFA 4XAWH 5LCVH 3MACH 4KHXH 3MOBH 3PNWA 4HIJA 5FB8A 3B2VH 1VFBA 3QFJA 1F6AB 1JVKA 1I8LA 1NGXA 2ERJB 3PHSA 5SV3A 1IQWH 1V3LA 1AIFB 1ORSA 3QPXL 1T4KA 2OS7A 4Z7WA 1D5MB 5HVHC 3KJ4B 4NHUA 2ATKB 4FTVA 3OAUH 3GK8H 5BVJA 2AJSH 4ZUSA 5KJRH 4PR5A 2UUDH 3BPCB 2BVPA 3CXDH 5J56B 3BH8B 3T0DA 1CLOH 3BWUC 4KRPB 4RGOL 1PSKH 2ZUSA 3ZDZE 3VXTB 3O4LB 2BNRE 1ZT7A 4RBPH 3QI9B 5ACZB 4UILL 4UT7H 1I1CA 3QPQC 4HV8A 2Q3ZA 1A9EB 3BAEL 4N90E 3VFGL 2X9YA 4MQ7B 1TPXC 4GRWB 4JQIL 2EDFA 3K4ZA 3JUYA 4O9HH 2AV7B 1IMHC 2HTLD 2RBLA 4ZAKC 4MQXD 5CIPA 3MA7A 3LSOB 3HG1B 4XPGH 4YE4H 5EN2B 1A0QL 4O5LH 1GPOH 3K8KA 5D5MF 5AWNH 2NYYC 4E5XB 3DX9B 4PBXA 4WU5A 3TYGL 3ISWA 4EBQL 4PYHA 1R0AH 3DURB 4MCYB 2IANE 1FJ1B 4G6AD 2BVYA 5HI5D 1JFQH 5ITBL 4Q6IC 43C9B 5IB1A 2YUWA 2CDGA 1HH6A 3CSGA 2BNQD 4G3YL 3MV9A 4QKXB 1EJ6A 1YY9C 2HTKC 2ZSVA 5GRJL 3MV7D 4WV1B 1WEJH 4L9LC 5LXGH 5IG7B 1U58B 4HS3B 5IB2B 1U93B 4J6RL 5IB4A 4J1UA 2BVOB 5J6GA 1RZIA 3MUY1 5GRVK 2K7PA 1Q8MA 4JJ5A 2IF7A 3M17B 4TTDD 4U1KA 5EC1B 3CDFA 5FGRA 3BIBX 2XA8H 2H32H 2RJMA 4EUPB 3U36A 1EHLL 3NH7L 4X5XB 4PTTA 4OCRL 1FLRL 4AMKH 4IM8A 1RD6A 4IRJA 1WWWX 2ED9A 3I2CL 1IEHA 3T4AB 5CSZA 4WW2A 4Q9RH 1V3MA 4Y16C 3JWDL 3I85A 1LGVA 4Z7NE 1T22A 3I02A 3IU4L 4M6OL 3GGWA 5D1XD 5EZLB 5D9SA 1RHFA 3FMGH 3CFJB 2WMPA 3UAJD 1EVUA 4Y0GA 3U0PA 5L88H 2VDKL 3E6HB 4ZS6C 2XTJE 3CAFA 4NUJA 4KJYA 5BZWA 4NN7C 4WWKC 5GZND 3O3EA 1MRCL 2FHFA 5IKCB 1B90A 5IGXH 1F3JA 2AK4A 2B7DT 5FYJD 4G80A 4NO3B 4FQIL 4LBEB 1BBDH 5D8JL 1I7UA 1I75A 2NY4C 1NUGA 4XPAL 5C0GA 3UBXG 2YPKA 1T7VA 1QSFA 5C08B 3BRDA 1T03H 2OJZH 1FDLL 5EU5A 2IQAA 4QRPD 5KAQG 1F90L 3EDKA 2R0KL 1XGTB 3D18B 4HUWB 4Y4FB 4ZSOB 3V9FA 1EO8L 3WFCH 3GHEH 2ZZUT 4PV8A 2PO6C 1DQDL 3U1SH 1Q0XH 2CKBA 1SBSL 1DUYA 4YH6A 3QXUA 2OM5A 3M1BB 2H3NB 2IG2L 2VR4A 3O4LE 3OKNB 3BFOA 1Y6MR 5JIPA 5GGQH 1K8DB 5ETUB 1MCDA 4F9PA 2EKSB 5C70A 3SDCC 5B3JE 3VFUA 2VITA 1ZHNA 3Q3GA 4OZ4B 5C6PB 4BZ1L 1CXHA 3PXJA 4P2OC 1CR9H 5MEPA 2RAMA 1J0JA 4LVHC 1OPGH 5C3LD 2MNUA 4DVRL 5EFIA 5F9WC 3E6FB 3ZDZF 1K8IA 4JG1L 1WBZB 2BNUB 3DRTA 4PREB 3KLHC 4MCZA 4HULB 1NC4B 3O4OC 3H3PH 3U2SB 1YQVL 4K7PL 4X83A 2VLRD 2Q8AL 4MNQD 5CLWA 4NRYB 3QWQB 1U8QA 1CE6B 4PRPB 1JNJA 5FHBH 3ZDXF 4O02L 4X6CA 1VB9A 2X7LB 1ZANL 3LQAH 5JXEC 1OGTA 1ZVYA 4R4NC 4XPFL 3MRGA 2YN5A 2R1WA 3O45B 4BFGA 2R0WL 4S0TD 1MWAB 2D03L 5K9JH 1T3FB 1BP3B 3DGCR 5B38A 2EIZB 2FD6H 4QRQB 3V8CA 1RUQH 3PNWB 4HIJB 1DBML 4GMSH 3T04D 1VFBB 4NZJA 5F7MC 3NFSH 2JJWA 1A6VH 4U1MA 2YSSB 1MF2H 2MHAB 5E24E 1ORSB 2PYED 4F7TA 4UU9A 1F02I 3EJJX 3LPWA 4KPHH 3RUGB 1NBZA 4DW2H 5HHQB 5K9KA 3MR9A 1W0YT 1ZSDA 5BVJB 4AEEA 2BOCB 2RQ8A 4AY0A 2QV2A 4YGVA 3QPQD 3UTZA 2BVPB 2D9CA 4QNPF 1I1AA 1UZ8A 5BS0D 4CAGA 4X9IA 4MMZC 1YDPA 2DICA 1A7RL 2VDML 4PJDA 2HKFL 2EYTB 3TWCL 1DLHB 4P4KA 3OJ2C 4CJ0A 2R29H 3SE9L 3OR6B 4X5WA 2NYYD 4F2MA 4YDIH 2X2YA 4G8IB 4POZC 2XACC 4Z7NF 4TNVK 4K3GA 4WDIB 5C08E 2BFVL 5GS1A 1U3HB 4RWHA 4NNYB 4OLWL 4F33B 2BOBB 4LQ1A 1ZS8B 7FABL 1MLCA 1YY9D 4MHHG 1GHFH 4UV7H 4P2RA 3ZT7A 3MV11 5J1AA 3MRFB 2A38A 4G42B 5I6XC 4P49A 3U0TA 5TH2B 1OGAA 3D5OF 2AJXL 1G1CA 3ULUL 3GHBL 5MI0C 3MV9B 1AXIB 1D9KA 1MHPH 1FNSL 3EYUL 4FG6C 3CZFB 1S7UA 2Y23A 4JFPB 4GFTB 1FZMB 2J88H 1J87A 3VCLB 2L7JA 3ZYZA 4C56D 2FO1A 5CGYD 4HZLA 3VWJA 1DBBH 4UDTA 3V6OC 1LWRA 4CVZA 5EZOH 4UV4H 4Y5XB 2FEEL 1RAMA 5TGBA 1R3HA 4I8DA 3ARFC 4FZ8H 4ZOEA 5C07D 1BREA 2O5XL 3MRDA 1KLGB 5DHVB 2IBBA 3ESUF 4FFZH 1JTOA 4I77H 5GS2H 1KJMB 3WNOA 2BVQB 4NC0B 4N8VG 2NXYB 3DUHA 4ZS6D 3SKNB 4MYWB 4YC2B 4HWNA 4WW2B 4WWKD 5E2UL 1WVZA 2NY5L 1T22B 3TH4T 4KDTA 4HPYL 3QEQE 4PRPE 4QRUB 1JK8A 1S7TA 1FE8H 3UJIH 2CDFA 2DQHH 4AT6A 3TBYB 4WCYH 1RJYB 4B41A 3ZKXB 4ZUWA 2NY4D 3RWJA 4LVEA 2HFFA 4YDVA 3MRHB 5BCAA 3NZ8B 1SYSB 2ZNXA 1DVFB 1MIEL 4NQDD 1U8PA 3MLTA 1G0YR 2YKLL 3QXWA 2J1KA 2AK4B 4R0LB 2DQFA 4Y4HA 3SE4A 3R06B 1UYWL 4GW5B 4UB0H 1I7UB 4WNQA 2PO6D 4AIXA 4HK3J 3P9WB 1P7QA 5C09A 3PWUA 4X8JA 2BP3A 1SBBA 2IQAB 4G6ML 4LHUA 5TDPA 5F7NC 2LU4A 3CH1A 1ZWIA 5TDOB 5JOPE 2FWOA 3D9AH 2I9TB 2CDEB 3WNMA 4K7PY 4PJBB 4YK4C 1JN6B 3REWA 2EIBA 2UZXB 2NX5A 4HKZA 5IB5A 1PDKA 3SDCD 4APQB 1KC5L 4X80H 3NMEA 4LVOB 3DETC 1HI6B 2ZUXA 2W0FA 2ATPA 2D3VA 4OQTL 1AFVL 1GC1C 5A40E 4WO4C 5JHDE 4OUUA 5I1KL 4PGCB 2ITDA 4RFOH 5D1QC 3X3FL 3IDJA 2E9BA 3DUSA 5HDQL 5EZIH 3RIFK 4EDWL 3O2DH 4V1DE 4GSDL 1E4KC 2R9HC 3WKNA 3NZHL 1RZKL 1U8LA 1A3RL 1CLYH 1JHKL 1V8HA 2DQGL 4JEGB 5DURD 5MEND 3FCTA 2OSLB 3AREC 4G6JL 1JWSA 4NZTH 5EFIB 3GJEB 2P5EB 2YA0A 5JQ6H 2HT2C 1K8IB 1BIIA 1FO0B 1MLBA 3DRTB 2XWBB 5JXED 4MCZB 3RPKA 3OHXB 4CVXA 4R4ND 1D5ZB 4Q9QH 3MRKB 4OFPA 2BVEA 2YN3A 2NZ9C 5D96B 3S35X 1BAFL 4KMLB 4LLQA 5DJDA 2GFBA 3GSRA 2GJ6D 2XQYK 4QHLA 5HHMD 2IC2A 1KIPB 1MFEL 4JHZA 1QD0A 4JY5H 4N1EA 3RDTD 4YPJA 1VKXB 4YBQC 2J4WL 3VXSD 1MFAL 5DD5H 1FC2D 4JREB 1OARH 5B8CB 2QQNH 4RMSA 3OJDB 4OZIA 3RVXC 2NPLX 4Y5YA 3DV4B 5FAAA 5FEBA 5E03A 3HCVA 1U3ZA 4Z7VE 2VSDA 2W9LA 3P0YL 4MB5A 5CSGA 5MHSE 5E4EB 4M7KL 2D7MA 3CNKA 4ZXBB 3THMH 1UFUA 2ZG2A 1WCBB 2P8LA 5HGBA 5DK2B 3PABA 4HQQL 3OKMB 1QRNB 3NTCH 4EOWL 5J6HA 3T0AA 5K9KB 1S7WB 1FL6B 3EGSA 3CD4A 5AYUH 1RZ7L 3TNNB 3CFKA 2DYPD 1EHNA 1KFAL 4YGVB 1NANH 1NLBL 3UTZB 3ARGB 5JLZA 4R7NA 1JTTA 1BVKA 3TESA 5IVZA 4PJ5A 5GGVL 1YDPB 3RWGB 3HFML 1LO3H 1L7IL 4YXKL 4PGDA 2P7TB 3E3QC 2ZG1A 5FA3A 1G7MB 1TJGL 5HVGB 1DQML 4WI4A 3QCVL 4YHOL 4N1CA 4UTBH 3ZYOA 4ORGA 5L2KE 3K4DA 2GEEA 4TNWF 4ZPVA 3R1GL 2V2TA 3WXWH 2GCYA 3OXSA 4PGBB 3I9GH 3V5DA 5JHLH 4MAYD 3H9SD 4PRHB 3BSZH 5E8OA 3R0NA 5IIEA 3HPJA 3FB8B 4EVNB 2DQUL 4YPGB 5BMFL 1MLCB 4OD2A 4WRLA 3SDXA 3BIKB 15C8L 2YZ1A 4A6YA 4OZFH 4PJBE 5D7JA 5TF1H 3BHBB 3CVHL 5CP3A 1FSKC 1TJHH 1CL7L 3EFFA 1RUPH 4PJXA 3ARFD 2BHUA 4KJQC 2R2EA 1AI1L 4HPOH 4PTUB 4MA7L 3EYFA 5DD1L 1GL4B 4F7MA 4HZLB 4ELKA 5CEYA 4Y4KC 3WN5B 3LZFH 4L8DB 3LPFA 5TGBB 2XG4A 4JCMA 4BFIA 4OGXL 3VGEA 1ES0A 4IEFB 5KVGH 3L3DA 2OQJB 1JRHL 4ELMA 4LAJH 5HPMA 3DX6A 1PYWB 1HHGB 4HLZG 5KVFH 1SY6H 3CDGA 3S5LG 4LCCB 2D2OA 5I74B 4P9HC 3HI6H 5BO1L 4M93C 2AP2A 4HIXL 4BSVB 4HWBH 5EIQA 1MI5A 4GS7C 5CJOL 3MO1A 1KEML 1MCNA 2CK0L 2J2ZA 5EPMA 1S7TB 3LKQB 1UKQA 4OLYH 3VXRD 4F57L 3CUPA 4JN1L 3CVIH 2R2HA 4X6BA 5IBTH 3RWJB 2HH0H 5FDYA 5C9JA 1P4IL 4P3CH 2AK1L 2HFFB 2XQBH 4XPTL 1DP0A 3MNWB 1L0YA 4K9EL 5GJSL 1G7JA 3GSNH 4Y4HB 3QULB 5HVFB 2VXUL 1DBJL 4WNQB 4MA8H 3HNVL 4ODXA 5C09B 1CZ8H 1IM9D 2DM7A 3D1MC 4PJIB 1AGEA 3WDIA 2VDLL 4X6DE 2GI7A 1QSVA 4Z0BL 4LHUB 4I5BA 4S1QH 4GQ9L 4J4PA 1MPAL 3DETD 4LLWA 2EDYA 1ZWIB 1ZLVK 2GTWA 2FWOB 4CMMB 4WO4D 2CQVA 4QRSA 4JKPH 4KMTH 2FIKA 3NABH 2X10A 2WLYA 5D1QD 3CU1A 1LEGB 3REWB 4Z7VF 3ZTJH 4NKOA 1JZ7A 4OZGA 1T89A 2AJ3A 2O5ZH 1KJVB 4LSUH 5I71C 2R9HD 3G5YA 3QIUC 5D7LD 3C09C 4TQEH 1QKZH 4M61A 2JF1A 4U3HA 4OCSH 3HC3L 1G7PA 4QLRA 2W0FB 2Z8VC 3ARED 1CT8B 1SJEA 3VFPB 2HT2D 3FO1A 3P3YA 3IDJB 1WZMA 4Q0XL 1RUML 1U36A 2VLKA 4D0DB 2NMSA 2NZ9D 3MLWH 5CJXC 3V5KB 4GKSA 3QDME 4P57B 1GGUA 3FCTB 5F3HB 3TA3A 1L7TL 1FL3A 2IBZY 3HC4L 1JWSB 3D85A 2HT4C 1HQRA 3GMLA 3ARPA 5KVEH 5SWSE 4YBQD 5HGDB 4OTXH 4OB5H 5IVXB 3RX7A 1C08A 1F42A 5D1XA 1NDGB 4LLQB 3O6FA 3HNSH 4EQ3A 4UNVA 2L0DA 4U1SA 3MJ9H 4ZFFA 1EEYB 2X89A 4XRCA 5GGVY 4OV6F 2JB5L 5EUKB 1JHLL 3OPZL 1UH4A 3LKPB 1G6RA 4R4BA 4RZCA 1FCGA 1J0KA 1RI8A 1UB6B 5JW3L 1G7QB 3WD5L 4QRRB 2VDOH 1ODAA 1A3LL 1G0XA 4JVPA 4OLZL 5K59E 3KPOA 4GW1A 3O3DB 4LRIA 3FHAA 3F7YA 1FH5L 2BSTB 4NPYA 2QJDA 1KOAA 3VFTA 2IALA 1QBLL 3QH3A 4QRPA 4NO0B 2DMBA 4JHBA 4KI5D 5E7FA 4B7LA 1NAKH 2P8LB 3PABB 4H8WH 4NKQB 4HJJL 1D7FA 4HWEH 1FGVL 3NFPB 2JELH 3C8KB 3SCMA 5EIIB 1WBYA 1OP3K 3ULVC 1FNLA 4Y5YC 4LASL 5J3HC 5JMOC 4X6FA 5KW9L 5DVKA 3FN3A 3T4YA 3ZYIA 2M1KA 1CGWA 3QHZH 5TE7H 5ANMB 4HX1B 1CGSL 4GMTH 2P8PB 4DZ8A 5D71L 3QUYA 1T7XA 2AJYL 4M43H 2V5RA 3JTTA 4QHNB 3HI1A 3LKOA 4FABL 3ILQC 2ZCLH 4U1NA 4ZPVB 4ODTL 3GI9L 1AE6L 4NN6C 3STBA 4YHZL 3QAZB 3K1DA 4PJIE 5DRNB 1A2YA 3IDIB 3BKYH 3WO4C 1YJDL 3QFDA 2Z35A 3LD8C 1EHXA 1TNMA 4KJQD 1OW0A 2A6JA 2PNDA 3MRJA 5EA0H 1EFXB 1BFVL 3T0BA 3R0MA 4PJCA 3RWHA 2UWEA 4MJ6B 3IXTA 5E9DB 4MNQA 1FORL 1P1ZA 3NCMA 3VFRA 2M26A 1G6VK 4Y4KD 1N64H 2HLAA 3ILPB 2J8UB 3FKUS 2JK5A 2FX7L 2NNAB 1HCVA 4Z78A 12E8L 4NT6A 5FYLE 5L6YH 5EOQL 3S88L 2VQUA 3VRJB 5CZVL 1FFRA 3WIHH 1KLUB 1UCBL 2XIDA 1F58L 1MEXH 3VFVB 1B2WH 1N4XH 1WFOA 3IVKB 3WJLC 4CMHC 4GG6A 4LGSB 1ES0B 2I60H 2IFFH 2VWEE 3BT2L 3EYSH 1S78C 3L3DB 2WP3T 3DJ9A 2PYEA 4BFBD 2YD9A 5CILL 4OIAA 2R39A 1UJ3A 3CDGB 5AEAA 5C71A 1JNNH 4EI5A 2PW1A 1EMTH 5FUZH 4JO4L 5EPMB 3S4SA 5IR1A 1QFWL 2MPAL 5GSRB 5BS0A 2DJSA 3MA9H 4I9WD 2HRPL 2R2HB 5C0CA 3WNPA 1PZUB 5IJVA 2FYYA 4XP1L 4ODVL 1S9VA 3HMXH 5DA4A 4Z76A 4JZOA 2VDQL 4U6VH 4UIKL 3OX8A 1X9QA 4RCAA 1QO3B 2XNAA 1ZT4A 2G2RB 4PJEB 4XC1H 3NA4A 4OF8A 2N4IA 1JZ5A 4FHBD 5ACMA 1AGEB 3Q6FB 4U4BA 1KCUH 2H2SC 3HMWH 1BBJA 1NDMA 5F8RC 1T04A 5EUOF 4LLWB 2WBWB 3SHSA 3IGAB 1NUFA 3PL6A 4WVRA 1QLRA 1BEYH 2XZAL 4WW1B 3MLUH 3L3OA 3IETA 2BNQB 3BZFB 4HWZB 3T0WA 3VRLE 3MV7B 2IQ9L 1F00I 1F4YL 4LQFL 4HK3N 1QR4A 4KJWD 1INEL 2HT4D 3RRQA 5HDOA 1SJEB 1HNFA 4IIQC 1IGYA 5C0BD 4HAFA 5E6IC 1UXWB 3TO4A 1ETZB 5DA0B 3PF2A 1N6QH 4ZFGL 2DRUA 3IDYB 4IJ3C 5HY9B 5ADOL 5MP6H 4X4YA 4GKSB 1DE4A 4D0BB 4HXAL 3MLXH 1FL3B 1BQLL 1UM4H 4GRWH 3CXHK 5T3ZE 5GJTL 4K23H 5DUBA 4KRNA 1G9NH 2AABL 4W6XB 1KJ2H 3RWDB 1IGJA 1AP2B 3MRBB 1J1OH 4PB9H 4NQCD 5D1XB 5J12C 1NCBL 3IDNA 4ZFFB 1CDYA 4XRCB 1RQ5A 1CE1H 4AJ0A 3PQYE 1HKLH 5IV2A 1G6RB 2G60H 3IDGA 4NZDA 4ZPTB 1FNHA 4ZFZA 1RUKH 3D69A 3MCKA 3H7BA 2WUBL 4M7ZB 2B1HH 4Y1AD 4QYOA 4GW1B 2QLVB 3ULVD 4LSDA 1KT2A 5F1SA 1KN4H 4OSUL 3FQXB 4JKMA 2RCSL 3UYOD 1QTYT 3VFTB 2EDJA 3QSKB 1AGDA 3B43A 3QH3B 2ARJB 4QRPB 1EDQA 3OR7A 1L0XA 1W72L 4PLKD 4OJFL 4XPBL 1EPFA 2B5IC 3KDMB 4EUPH 1BWMA 2O26U 3WL9A 5GISL 3BE1H 4XAWL 4BM7A 1WBYB 3WUWA 5E94B 5FO8A 1I7TB 4KZEH 1NCDL 1A4JB 3JWDC 4MJ4A 3T4YB 3ILQD 1IQWL 2E7HA 3RY6A 1IC4L 1RIHH 3MREA 4L4VD 5HD8C 2Y06L 4QXUL 1NC2A 4U1JB 5E70A 4QTHA 2RR3A 2YR3A 4L3CA 4OCYH 4HS6A 3OAUL 5HYFA 2I25N 4XB8A 5EOCJ 3VFOB 3SCMC 5I2IB 3M8OH 5KJRL 4JDVA 3PP3K 4I3GA 2FDBP 2VISA 4ONHB 5KOVC 1PSKL 5MENA 4K3DH 4OFKA 4DZBB 1XFPA 4RAHA 1H3VA 3LN4A 1S9XB 4ZUUA 3QFDB 1FYTA 3F6IA 3SGEI 3SDDC 4YLQT 1YP