4F3FB

Crystal structure of msln7-64 morab-009 fab complex
Total Genus 42
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
42
sequence length
220
structure length
220
Chain Sequence
EVQLQQSGPELEKPGASVKISCKASGYSFTGYTMNWVKQSHGKSLEWIGLITPYNGASSYNQKFRGKATLTVDKSSSTAYMDLLSLTSEDSAVYFCARGGYDGRGFDYWGSGTPVTVSSASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVEPK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords MORAb-009 Fab light chain
publication title Recognition of mesothelin by the therapeutic antibody MORAb-009: structural and mechanistic insights.
pubmed doi rcsb
source organism Mus musculus
molecule tags Immune system
total genus 42
structure length 220
sequence length 220
ec nomenclature
pdb deposition date 2012-05-09
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4f3fB01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4f3fB02
5F93C 1R3IH 2NX5D 3CK0L 4OD2B 2F8OA 5K9OA 1NMAH 4F7CB 3BD4A 3VFMB 5JUEH 4N8VB 5E5RB 4QRUA 1D6EA 5GGRA 4PFEA 2A6JB 3EO9H 1VKXA 3HCVA 2MPAL 4PJBB 4PJ7A 5DS8A 1OTUC 4YQXH 4NKMA 2AKRB 1AO7D 4EUPB 5GIRA 4JM2F 1B4JL 3DROB 5I1LA 4XWGL 1Z3GL 4MA7H 3IDUA 3QIWA 1N5YH 4LAQL 5JW4M 2CR6A 4K8RH 4PJ8A 4WI3A 4HUVA 4JQVA 4WHCA 1E4XH 2VLKE 3ZKXB 1K6QL 2XIDA 4QKXB 2IAND 2LAGB 1ZV5A 3IF1A 4QOKB 2A1WH 4Y4KA 5BJTB 3O8XA 3NMEA 4CVZB 4P5TC 5KS9A 4GRMA 1KJ3L 3CCHB 2YD6A 3MLVL 4HC1L 4PRPA 3X3FH 5FOJA 3NCBB 1ZHKB 3OAZH 4J6RL 3DETC 5FYKE 1GHFL 3UYRL 3QDGB 4S11A 4Z7OE 3S5LG 4NQDE 1PEZA 2VQ1B 4IDJL 1XAUA 1T22A 4OGXL 3O3EB 2NXZD 4NN7C 4QT5B 4RNRA 3SGKC 4O5LH 5KVFH 1YNTA 3VMPA 3F58L 1SYVA 2FNBA 3QNZB 2IBGA 2NY6D 1LHZA 2EDFA 4U1SB 1NBVL 4QXWA 6CGTA 5E8NB 1R3JB 1F90H 1X5HA 2QR0B 5HI3C 4F7CA 1C16A 2BP3A 3MGTB 2YUXA 5ECJE 2UZXB 2HKFL 5DRWB 4GBXD 1MPAL 2VR9A 4RMTA 1QFOA 5KG9B 5EU6E 1RVFL 4EUPA 4PRIB 4OQTA 4PJFF 3ARGD 3QFJE 3P4LA 3BVNB 4EN3D 1V8HA 2GK0A 3KPRD 5I1GH 2YPVH 4OLUH 1ZLVH 2NY2D 5J6GB 3QAZB 4LKXB 1EEZB 1ZKAA 2YZ1A 5T5NG 3MRNB 4QOKA 2A77H 3UBXB 1FG2B 5I9QB 2W92A 2R0WL 3KJ6L 5D1ZD 3SHSA 1HHGA 5BJTA 2BMKB 4RAVA 5T1LD 1QSEE 4LMQI 1T3FB 4CVZA 2EICA 5IUSA 5DMGD 5EOCH 3AY4A 2ZSWA 5C0JB 3VXME 4ZOEA 3D0LB 1OSZB 2EDHA 3TJHC 1ZSDB 1E4JA 1WBXA 1G7PB 1YPZE 4JO4H 5FUZL 5EULV 3O3EA 4NFBA 4YHOL 1F11B 3GI9H 4BQ6A 4AEHH 1BFOB 2EKSA 3C9NB 2DWDB 3QNZA 4G6JH 5FUOH 5C0BE 3U46A 3ZDXE 4HJJH 5LGHL 4MMZC 5FHAH 1R3JA 2DLGA 4XAWH 2QR0A 4RGMC 1V3KA 3ALPA 4OM0H 2EIBA 3M1BA 4AYFA 2I60L 5DRWA 4I18B 4MHHG 4YHIA 1MCFA 5KG9A 3NFSH 4XZUB 5FOBB 3LKRB 5DK0A 4WU5B 4NKOA 5DHYA 3OR7B 4PLJD 4ZAKC 5BS0D 5MENE 1EGJL 3V5KB 4QXGL 3RA7H 3NA9H 3P4OA 2O93L 4YBLC 5J6GA 5JR1L 4LKXA 2I9TB 3ARDC 4N0UA 3KPQB 3C5ZC 1T2QL 1JJUA 2R29H 5TH2A 1EEZA 1EFQA 4NM4L 5JDJA 1F5WA 4HWEH 4LCWB 3ZDYF 3L5WB 4DGYL 2BSED 3HUJF 3S37L 3WFBH 1H8SA 2D03H 4XPAL 1T3FA 3SN6N 4KZEL 2Q8AH 3ZE1E 4CMHB 5C0JA 3IB4A 5E03A 1OAXL 4QWWC 2MKLC 5DEGB 4F3FB 5EZIH 4XVJL 2Z0BA 3O6ML 3QQ9D 5K9KB 3D0LA 4O2EA 4X6DE 3OAUL 1ZSDA 3U7WL 1LMKA 4JM2B 4Z6AT 5EZOL 3OGOE 4N8PA 3BGFC 1ORQB 3ARPA 4N8CH 4RWYH 1UZ8B 3HI1B 4PJ9D 5B4MD 1D6VL 2DDQH 2I27N 5IG7A 2DWDA 3K74B 5JZ7D 1HZHH 1MJ8L 5I75C 1RD6A 3MFFA 4OB5L 2A6DB 1N64H 5BOZG 4YUEH 1Z9LA 4UIMB 3SCMD 3ARBA 1PZ5A 1AXTL 1JPTL 1AFVL 2AI0L 4G9FD 4EBQH 1MVFA 2VN4A 1ZLSH 5SWZD 3ABZA 1KNOB 1DL7H 4XZUA 3FN3A 3MLRL 5GGSY 3LKRA 1BECA 5CIPB 3N1FC 5E95B 3CLEL 3OR7A 4YDVA 5BO1L 3FQNA 2C1PB 2VL5A 3MV7B 3V5KA 3HAEG 3UEZA 3T0EE 1OD9A 3DGGA 3KGRA 3GMNB 5DJ2B 1E6OH 5D8JL 1UH4A 4NQEB 1R3KB 2I9TA 3KPQA 3FFCB 1H5BB 5HHVH 1RZKL 3HZYA 2H3NA 4MNHB 1XGYH 3RGVA 2K9UA 4LCWA 3CXDH 1F00I 3L5WA 3HAEH 3HPJB 2IBBA 1Z5LB 4KKLC 3FZUD 4UB0H 1BD2D 2EH8L 5IMOA 5I15H 1MI5A 1FSKC 5DHVB 2MFNA 2MCPL 1OAUH 4JN1L 5GISL 5T1KB 4F3FA 2DTML 1CBVL 1ZHLB 2LABA 4KTDL 4D9QE 4EI5B 2AEPL 4PJ7E 4TVPL 4PJFB 4ODXB 2X9WA 1EEYB 1OPGL 2DJ4A 1U8PB 1UZ8A 2XQBL 3P4MB 3D2UD 4LNVA 1LWRA 1FDLH 1N59A 2CRYA 3CXHJ 4OZFB 5B8CB 2A6DA 3W39B 2D4FA 2E9WA 4UIMA 2D9CA 2F58L 5I74B 3V6FA 4XVSL 5I66B 1OAKL 1B2WL 5MEPB 1P84K 4ZO8A 3MYZA 3ULVD 3VWKD 3QDJE 7FABH 1FBIH 4PJ5B 3V0VB 4JDTL 4PGZA 5JIKA 5KS9E 1KNOA 3U30B 4U6TA 5DZLA 5FM5M 1CFVL 4KK9C 5HJ3B 4ODWA 1XIWD 3TYGL 3MV7A 2BSRB 2YPLB 5GS0D 1CLZL 2F53A 4EEEA 4M61A 4NZRH 4QGYA 4MXQD 1B4JH 5DJ2A 4P23D 4NQEA 3FFCA 5HHMB 5FM8A 4LAQH 3PGCB 3W0WB 4Y1AB 1K6QH 2V17L 1TPXC 4RMRA 3SY0B 4XVTH 3BE1H 3O6FD 4QHKJ 2NY4D 4GS7C 1NGQL 1B6UA 2MJWA 1ZHLA 4IM8A 3UZQA 1LDSA 2GUOB 3WLBB 1UM6H 3JWOC 3MLVH 1BOGB 4PJBE 1BF2A 4X80L 1DBBL 4ODXA 3EOYG 1I9RL 1J87A 4J3XA 1EEYA 1TCMA 5DF0A 1U8PA 1CXIA 1GHFH 3UYRH 3BDYL 4NZTL 4FQ1H 4U3CA 4OZFA 2XTJB 1OB1B 4G6FD 3WE6B 5MEPA 4QOKE 3HUJB 5HYQA 4H5SA 3BN9C 5H35B 1NBVH 1CDJA 2JKXA 3BP5B 4MXVE 1KENL 4E9LA 4G5ZH 5FF6B 4Q9QL 4WO4D 5HJ3A 4FQQA 1MPAH 2CDGB 2V5RA 3HC3H 2YPLA 4TULL 1MFCL 2ZUWA 3QDGE 1S9XA 2C4XA 4L4VA 4JFED 3AAZA 2Q6WA 1FL3B 1A6ZA 1AJ7H 3MV8B 3ZYIA 2WWMC 3PGCA 5DLML 1UJ3C 1YY8B 2E5EA 5D9SA 3OZ9L 4Y1AA 3S36X 1T21B 3CH8A 3MJ8A 3SY0A 1L7IH 5FYJD 4L8DB 3KLSA 1CL7L 3BRGC 1VERA 2VABB 1Q8MA 3LIZH 4GKOA 4U3HA 1EHLL 4K3DL 4MNQD 3I6GA 4ZS7L 1BQHG 2GUOA 4WEUD 3QJFB 3FO0L 5FKPA 5A40E 3GJFA 4PRIE 2HMIC 4F7MB 3MJ7B 5MI0C 5DDHB 5DUML 3EO1B 2GEEA 3PL6C 2ICWI 4HUUB 2W07A 4JPWL 2XNAB 4KK8D 5FUZH 5HVHC 3CFEA 5HVGB 4YFDB 3ZHLA 2FGWL 1OB1A 2R0ZL 3WE6A 2YXMA 3DMMC 3L3KA 1CDCA 1MCOL 5LGHH 3T09A 1JZ8A 4JDZB 3IDXH 1XR9A 1IQDB 1QNZL 1A4JB 1MELA 3EDDA 5ACLA 3IFPB 4C83A 4FQPA 1MAKA 1JFQL 5FA4A 1KGCE 3UMTA 3G5XB 4GAJL 1A7PL 1DP0A 3TF7C 4U1HA 4YX2H 5BVPH 3VRJB 1FL3A 4BH8B 5DJDB 4TNVK 1EGJH 2LU7A 1JP5A 4HXAL 2KDGA 1S7VA 5ALBH 2DBJA 4F57L 1T1ZB 5GGQH 4F7EA 1YY8A 2XWBB 3DPBA 1T21A 1JNLH 4NN6C 43CAA 5IB2A 1BAFH 4UI2A 3S37H 2E6PA 1OWRM 2VABA 5I1CH 1BZ9A 1CXKA 1XGRB 4KZEH 1QYGH 4LGRB 4YDIL 1OAXH 4OSUH 3HR6A 1SEQL 2DQFB 2WW8A 3L5IA 4N5EC 2N7BA 3MJ7A 5DDHA 1YN6B 1G6RB 1VACB 3OAUH 5DRXB 1NUDA 2VZOA 1EX0A 2COQA 2F8VA 4AEIH 2XNAA 2IH1A 2X89D 3RVUC 4IIQB 4Q0XL 1D6VH 4PB0H 4WY7L 4LCWE 4OZHB 1MJ8H 5CINH 1JZ7A 4OB5H 4KROC 5T33H 4KHXH 1PFCA 1CGVA 3JTTB 4PG9B 1OLLA 2BOCB 4JDZA 4N0RA 4PTUB 5I1JL 1AXTH 2AI0H 5A2JH 1P7KA 4X6EA 2LE9A 1T1XB 4WTZA 4YHKL 3G5XA 1A7BA 2VXUL 2PTVA 4JVUA 1H3GA 5DEFB 4NIKB 1YUHA 5BO1H 5ITFA 4BH8A 5HYSA 2YD7A 3TH3T 5L8LB 4J4PA 3QXAB 4ORGB 4GO6B 1A3LL 1BF8A 5EORH 3TNNB 3DX7B 1P4BH 4P2OC 5E6ZA 4H8WH 4F37K 5HGAB 1U8OB 3OAZK 1ZANH 4CMMB 1XGRA 3HR5B 1UKQA 4S10A 4JN1H 1JF5A 1B0GB 3MBEC 1FL6B 3D39B 5GISH 3SBWA 2DQFA 1CBVH 3SDCC 4L3CB 3ZKMD 2D0FA 5EBWB 3P9LB 4KTDH 4PJGF 5ADOH 1YN6A 3MV7E 3GBML 5ETUB 1RZJL 4OLXL 2P8MB 1NC4B 5C6WH 3L3GA 5D7IF 2X4SB 4QXUL 1OPGH 2XN9D 5CAYB 4IIQA 4NQEE 3FFCE 1MLBA 3GSQB 1HWHB 4JO1H 4MAYC 4ZOBA 4OZHA 3I2CL 2V9TA 4YXHL 1CXLA 4K8RC 1FFPA 1MQKL 5IJVB 2FO1A 3PWUB 3JTTA 2VXSL 4GG8B 4PG9A 2BOCA 3MRMB 4PTUA 4WFGD 2AK1L 2XWTB 4Y4HD 4OCWH 1EJOH 5JA8B 4XPGL 1FRGH 4KKCD 1V7NH 1I7RA 1IBGL 1MAML 2XZQL 2HN7A 2M26A 2IQ9L 1U42A 5SX4H 3L9RB 4OJFL 4PJFE 5DEFA 1ZLVK 3ZTNL 4WV1B 4Q9RH 2Q87A 2AABH 1K85A 2M2DA 5DK2B 4MQ7B 4ORGA 3BKJL 2ERJB 3DX8B 1AR1C 4YXLL 3BMVA 4P5TA 2Y1VA 4NUJA 3TNNA 5L88L 5C71A 5J4MA 3RJDA 4KVNH 5L2JB 4UUJA 1D5ZB 3QH3A 5HGAA 3CC5A 1YDPB 3FCTB 3VXRD 1QUNA 4CMMA 3HR5A 4PJ5E 4LHUD 3QT2A 1B0GA 2VDNL 1FL6A 1NFDB 4OTXL 1IC4L 5I16B 4HUWB 3SGKA 1PKQA 4L3CA 2ZOKB 1FLRH 5EBWA 4Y19B 3O6LL 2YPLE 2I9LA 5EO1A 3EUUA 4OLZH 1NC4A 3MPCA 1A3QA 4YJZL 2VB5A 4Q2ZB 5JW5B 3O9WD 4W4OC 2DS4A 5F7DA 2ZUVA 4I3SH 4ZXBD 5HHME 3GSQA 3F7VA 4NZTH 5E8PB 1J1PH 2A73A 2VTFA 1ONQA 4I0CC 1MWAA 1ZHNB 3REWB 3TC9A 1C7SA 4NJAH 5IJVA 1WF5A 3W0WE 4DOHB 5GZNC 4XB8A 4GG8A 4Y1AE 1NEZA 3MRMA 1E27B 4UU9B 3KPOB 3CFDA 5ESVB 1RZ7L 1WEJH 4TTDC 2V6HA 3GBNL 1KENH 2XT1B 4NCC2 3L9RA 4Q9QH 3QUMB 3CSPA 1EUUA 5DK2A 4HDIB 3LQAL 4MQ7A 4JZNB 4TULH 3K2UH 4Q6YA 3S9DB 3SDYH 1R5WA 1U92B 4U1GB 2XTJE 4MA8L 3ZDYE 2EKJA 3FTGB 5IIEB 1LEIB 3SCMB 5IT2L 3FCTA 4YK4C 1JBJA 2YRPA 1Q9OB 4XHJD 1U8NB 1NFDA 3OJMB 5DQDL 5I16A 4HUWA 3HFML 5J1AB 5TGBB 2HP4A 2QQLL 4ZS7H 4MLIA 5HY9A 3B5HA 1LO2L 3FO0H 4KRPD 4FTVB 1MCBA 3REVB 5D2NB 5ILTL 5DUMH 4QRSB 1KFAH 1OVZA 4D0BA 5F89A 5TPWL 3T1FB 5E8PA 4MZ2A 3MV8E 3BKML 1RK0B 3REWA 3SKNA 3ZSSA 2FGWH 2R0ZH 4KUCD 1MIML 4LCCC 3C60D 1E27A 2OTPA 1GJIA 3KPOA 1OSPL 3ULVH 1MCOH 2OTUB 4JKLA 4RMWA 3UZVB 4FXKA 1VGKA 4KXZI 5GRZA 4OZ4B 3WJLA 1NBYB 4AT6B 3ARDA 1ZMYA 4GAYB 3C5ZA 1CGSH 4FZ8L 4JM4H 2FEEL 1MHPH 3QUMA 3BEVA 1G7HA 1H3PL 4PJGB 1MQ8A 1KN2L 5GS0H 4HDIA 1A7PH 3FL7A 2H26B 3VD3A 4JZNA 4LNRB 4PRDA 5JTWA 1H3UA 2H32B 4ZS6C 3Q6FB 4UIKH 4XGZB 2B1HL 4ERSL 1PEWA 2ESVD 4HKJB 4HKBA 4KVCL 1BZ7B 4HXAH 3KYNB 4M1GL 1UB6B 3ZO0A 4BUHA 2AK4D 2BNQB 4F57H 4WW2B 2QHRL 4LF3B 1IAKB 1RUQH 4RFEB 1LDPL 1QFPA 2P5ED 1CXHA 1YQVH 1Q9OA 5IOPA 2XXCB 1GC1C 1IL1B 1U8NA 3EOBB 3PWPD 2YD3A 5J1AA 4LLUB 1IGJB 4YDIH 5FV1L 3U1SL 1WJ3A 4FTVA 4EI5C 4HK3N 1SEQH 3HC0A 3FQRB 5ISZD 5BZDB 4G8IB 1JPFA 5D2NA 1N5AA 4ZTPH 3TN0B 2JJSC 4QRSA 4NYLB 3MCKA 3O2DL 3U0PB 1YQ2A 3P73B 4L8CB 1M7DB 3PWLA 5GHWH 2P44B 4FXLA 4LCIH 1JTPA 3AGVA 4PRNA 5DFVC 3HNSH 1M1SA 4JFYB 5EN2B 1CN4A 2QQKL 1JGVL 2DJSA 4JKKA 3F5WB 3WFEH 5D5MF 2VSCA 1OAQH 3BQUB 4JQIH 4OZ4A 3O2WL 4EOWL 2K7PA 4KK6C 1W8NA 4AT6A 1NGPL 3TA3D 4GAYA 1IT9H 2P5WB 5ICZA 3T2NL 3UJJL 3KLHD 1XGPB 2H26A 2VXUH 4LVNB 4LNRA 1P6FA 2UV3A 2H32A 1EEUA 3Q6FA 1WTLA 4XGZA 4HKJA 5GSRA 4XAKD 4L8BB 3X14A 1ODAA 3KYNA 1UB6A 3MRDB 5J9PA 4OZHE 4WW2A 4I5BB 1UADC 4M93B 4MYWB 4Z7VF 2HH0L 5FYJH 1MRCH 3QXVA 3ISWA 3EOBA 2LVEA 1B0RA 3RVWC 1IGJA 2YBRB 3MXWL 5F9AC 1OARH 4NHCH 2EH7H 4HUXA 5DTFB 5E2UH 4ZSOB 1N4XL 4DQOH 2F54A 4ZUTB 2J5LC 3TN0A 3GBMH 4MS8C 5DVLA 5SX5H 2J8UF 1RZJH 1D5XB 3IDJB 3CFCL 5I1HL 1OTSC 3P73A 4X9GA 4L8CA 1M7DA 2B1AL 4XPBH 4IRJC 4P9HH 2FHFA 2YR3A 5DMJB 1NSNL 3RWDA 4WCYH 4WFEE 3O3UN 3OF6A 3U0TB 1JYXA 1FE8L 5EN2A 1UXWA 4XPHL 2PNDA 3I2CH 4YXHH 2DWEA 2X1XR 3F8UB 3F5WA 1NAML 4K3EL 3UXFA 1MQKH 3EAKA 3F62A 1UKTA 1G0DA 2VDMH 4OIIL 2AK1H 4U6XA 5M95B 3D39E 3HZKB 4TUKL 5C9JB 5DJYA 1JGDA 3K1KC 4HWZB 4M8QB 4W6XB 1XGPA 2XZQH 3ZZ1A 5EBMA 3NAAL 2IQ9H 5MHSD 1ITCA 1NC2B 3GGWA 4OJFH 1BJ1J 4V1DD 5JLZA 5I8CA 3MGAA 4L8BA 4YXLH 3WFZA 4APQC 3MOAH 1J0YA 1S5IL 4CAGA 3G6DH 4I5BA 4JFDA 5F7YC 5H2BA 5EG6C 2PUQT 3JVGA 3WDIA 1FNGB 3U83A 5FGRA 5E2VH 1KYOK 4JZJB 5CEYB 3IJYA 5KSAB 1C5BH 2BVPB 4OTXH 1F13A 5DFTA 1IC4H 1KPVA 5D7SH 5DTFA 2IPUG 4YHLL 5KTEH 4DAGH 2C3WA 3JSSA 2OQJB 1D5XA 1ACZA 2IADB 4C55A 2V5TA 3RVXC 3MA7B 1S5HB 1YEHL 3VFGL 3WN5B 2B4CH 2FIKA 4C58B 5D72L 1TJGL 2AJUH 3KG5A 1UM5L 1GH7A 5C07D 3G6JA 3ES6B 2Z31D 5HHOA 3NIGE 4Y5VC 4M7ZC 3P30L 1CICC 2OI9B 5KVEL 1FN4B 4C4KT 2AJXL 1NFDE 5FCUL 1ORSA 4JY5L 3HZKA 1HEZB 3K1DA 5C9JA 2IFFH 1JYNA 5CBAA 1FIEA 1O7VA 4OZIA 1W0YT 3B6SB 1NC2A 1J05A 4HWBL 1MIEL 1NMBH 3LQAH 2X4TB 4P57B 4NNXB 3O45B 1URLA 1BWMA 2QSTA 5DJZA 3NBNA 1QPXA 2GT9A 3IFLL 4DOHE 5D7JD 5K33A 1X5YA 4U1NB 4UTBH 3BWAA 2B7DT 5CJQL 1CGTA 3PL6A 3PV7A 3HI5L 4NFDA 2ZPKL 4I8DA 5LBSH 4JZJA 5CEYA 1IKNC 3VI3E 35C8H 3V8CA 3QNYA 1AGEA 2CKBA 2HG5B 2FECL 2ZUQC 4LSUH 1V05A 1KJVA 1MCLA 4IOSD 4TUOB 2JE8A 3EYQD 2IADA 5EUOB 3CSYA 3IS1X 4F9LC 3V6BR 5ILTH 5TF1H 3WN5A 2L0DA 4CVWA 1AHWB 4LLQB 5C0IB 4JFPB 1T4KB 4Z7VB 4UQ2B 3M17B 2PXYB 4GUPB 1AD0B 1JK8B 3DRTB 3TVMB 4YC2B 1MIMH 2MTPA 4M7JL 5KN5B 2GJZA 4L29B 2RFXB 1A9BB 4DW2H 4OI7A 2YHGA 3QISA 1UEYA 4TUJA 3LN5B 3B6SA 4FTVE 1H3PH 1KN2H 2J8UB 5D2NE 4F2MB 1CXEA 1DQJA 3O45A 4YHYB 3TT3L 3GSWB 3IDMA 4XBPA 4LHUG 3RY4A 2CMRL 1QSFB 4KVCH 3RX7A 1IAII 1F02I 2NXZC 5I1AB 4M1GH 3DGCR 1PBYA 3SE4C 4HSQA 2QHRH 3AS1A 3RY6C 1X5GA 2NY6C 2UZYB 3BEWB 3MLZL 1JRHI 1UC6A 3PABA 1BQLH 3BXNA 3TV3L 4KI5F 1CDHA 4Z7UF 4M4PA 4GBXC 3U1SH 5IB5B 4F8TA 3BPCB 5EUOA 3SKMA 3UJTH 3ARGC 1QRND 5I30H 4I0KA 4EN3C 3QEQB 1CD1A 3ARED 5IJKC 5EU7C 4LLQA 4ZFGH 3EOTH 3GUTB 4X7SH 1T4KA 2BNQE 1KIQA 4UQ2A 3M17A 2NY2C 1CFNB 5GS1B 1JK8A 2ICWJ 3TVMA 5KVGH 3SE8L 3RX5A 2RFXA 1DBAH 3WL9B 5F8RC 4H8WC 3OKKB 3R4DA 2FLBT 5D1ZC 4LSPL 1GZQB 3O2WH 4EOWH 3HG1D 4D0DB 3LN5A 5DMGC 1FNSL 4P2OA 1ZVSA 1HQ4B 5IVXF 3T2NH 3QBTB 2W0PA 4L9LB 3UJJH 4LFHD 1WC7A 1DZBA 2CLVA 4LEXL 3F7RA 3OBAA 3TESA 4Z77B 3BHBA 2KH2B 5CJ5A 5I1DB 4K23H 1YN7A 5I1AA 5DI8A 2FHBA 4WUUA 3BT2L 4FMFA 4R97C 2XWJB 4D0CA 3P11L 4CADB 3K81A 4LPCA 4GAFB 4M7KL 2HJFB 1A47A 3I75A 3MXWH 3PP4L 3RX8A 5IB5A 3WNMA 1A6AB 5FV2A 1I7TA 1N4XH 3C6LD 4LASH 2HTKD 5FUCE 4PLJC 4CN4A 4ZUUB 3E2HB 5TDPB 1NCTA 5J57B 4HCRH 5IESH 2PKDA 1JGUL 1CFNA 1G7IB 5HI4D 1YEGH 3IXAB 3VFUA 3VDCA 2EXYD 1WAAA 4HZAA 3HZMB 1H0DA 3WL9A 3OKKA 4H25A 1Z0MA 3S36H 5CZVL 5GXBB 3HMXH 1YC8A 4PY8I 2CIKB 1HHJB 1MHHB 3SDDB 3EYUL 4RX4D 4OV5A 2Z91A 4C56B 4TUKH 1HQ4A 1H15A 3CDCA 1F6AB 4NFCA 5I1IL 3BGMB 1I1AD 4ZSOE 1X44A 1M71B 3QQ9C 1HINL 5D1XB 1A7RL 1VEPA 3HS0B 3KR3L 1HDMB 1DQQB 3UTSB 4HD9A 5A1AA 4M8VA 3I3EA 3O4LD 5IVOA 1IRAY 3GSNL 4P5KA 3S6CA 3X11A 2P46B 4PJ9C 4TPRL 5B4MC 1BVZA 1S5IH 3CFKA 4YH6A 2P8LB 1WQVT 1KPRA 2Q20A 2Y23A 3G6JE 5AD0A 4JG1H 5JZ7C 5DWUL 2Q7YA 4KU1A 4WJ5B 5JDSA 2XWJA 3NACH 3QQNA 3Q1SH 2XICA 3OXRA 3KNBA 4DZ8B 3K4AA 3MZGB 2HJFA 5IVZB 1TQBB 3WS6A 1CR9H 4ODSH 5JQ6L 5EIIB 1YEEH 3SKJL 1I9EA 4ODHL 3AXLB 1A6AA 4TNWK 5D7KD 1KN4H 1CFTA 4YHLH 3MODL 1X5IA 5IROC 3ZDZE 2PYEB 1I3RB 4ZUUA 2BJML 2R39A 2FX9H 5B38G 4U1LB 1I1FB 1YEHH 4PLNC 5DD3H 3VFGH 1G7IA 1TENA 1TJGH 1MFBL 5C7XL 3IXAA 1ZT1B 2NLJA 5K9QI 2UYLA 3HZMA 3FZUC 4M1CD 2EC8A 1XT5A 1HHJA 2Q76A 3K4DA 4JQXC 4Z7UB 4NWUL 3NCYP 5SWSD 4NN5B 5SV3A 5I0DA 1BGXL 5D1XA 5IKCA 3KPPB 4XTRD 1HDMA 1DQQA 2DQJL 1RUML 5BRZA 1MIEH 2FB4H 4CJ0A 2VLLA 1II4E 1FFOA 4X5XB 4P49A 1AQDB 2P8LA 4B5EA 2J88L 4GXUN 4PG2C 5F21B 3VXPA 3HZVB 4S1SL 4N90D 5CJQH 4KGLA 3ROOB 1RZGA 2AXGB 4WHTA 4L9DA 3A0OA 1J0JA 2ZPKH 1JWMB 3ULVC 3VWKC 5IVZA 4IMKC 5I1EL 2G5RA 5EIIA 4YE4H 1TDQA 3CXHK 5E56A 1SBSH 2CO7B 5TE4H 2G2RB 3OG4B 4LCCA 4MVBD 1OCWH 1I3GL 1AE6H 4R4FL 1XIWC 3EYFA 4XPTH 3LQZA 1I3RA 2OLDA 2V2WB 1CDUA 1GVIA 1WLHA 5GS0C 2IALB 4ODTL 5IP4A 4U1LA 1I1FA 2Y25A 1MNUH 3WNLA 5JO5B 4NDMB 4MXQC 4U49A 4P23C 5MEOB 3MOBH 2F15A 2W38A 2EDJA 3TJEL 3EKCA 3GHEH 1PKOA 4F9PA 5AWNL 5EOTB 2DI7A 4OLWL 1TZIA 4RDQG 3O6FC 2NY4C 5DZOA 1F2XK 3TO4D 3RI5F 3ULUD 3KPPA 3WHE0 3F7QA 5EUOE 2Z8SA 3ZKQD 5JPNA 3FOLA 4MGXA 4ODBD 2GJ6B 2HJKB 1GOGA 1NGZB 3MRFB 3MXVL 5E00B 3MBXL 1OTTD 3VXNB 4BH7A 2NW2B 2W9LA 3EHBD 1AQDA 3N0PB 3BIBX 4Z7VE 4X5WA 3L5XL 4JFXB 5DXWA 4RGND 3HZVA 4OBRA 1WWCA 5IHZA 5DURD 1GAFL 3CDFA 2W9DL 1JWMA 2APFA 3SDXF 5JHDD 5JPMB 3E3QC 5DMIL 1I75A 3V4VH 5SX5K 5CHNA 3DLQR 3FOMB 2G2RA 1HXYB 1L7TL 4TSCL 1DJSA 4M6AA 4WO4C 3UTZB 2GY5A 3WDHA 5L9DH 1RULL 1PSKL 3WUZA 3IDIB 3UTPE 2ZJSL 3F6LA 1FPTH 2OBGA 4NDMA 1N0XL 4LK4A 3MLXH 4OF5A 4KDWA 2CH8A 1QSFE 5A3ID 3P9WB 1F3DJ 3LKSB 4HIXL 5EOTA 1BIIB 3BZFA 2QSCL 3SE8H 5IVNA 1ZEAL 4W6YB 3DYOA 1JGLL 4UAOB 4YR6B 1KXVC 4R26L 3ZL4H 3H3KA 4LSPH 5ENWA 4O02H 1CLCA 4CBPA 3OHXA 4HXBL 3L7EA 4FFYL 4LARL 1ULVA 3DNKA 4Q58C 1P4IH 4H20L 3QEQE 3OX8B 3PWVB 1UB5B 3VXNA 4J23A 3L7FB 2NW2A 4KK8C 2YUVA 4LEXH 3ARFD 2BERA 4X9IA 1FYTD 2KZWA 4WI8A 1WIUA 4M02A 4P9HC 2PTTB 3HE7B 2VITB 3FB5B 3VFVB 2X5PA 1X4XA 4XNUH 4E41D 1S8DB 1WAAE 2NY1B 3W5MA 3UTTB 2VMFA 4IRJA 2WIMA 3J7HA 4OUUB 4I9WE 1FV1B 4LIQE 1I8MA 2DLFL 2MOVA 3EO0A 3FOMA 1M7IA 3KPSD 3T3PF 2WWKO 3UTZA 3T04D 5D70L 4ODVL 4E42B 1EO8L 2VWEC 3PP4H 3IDIA 1GIGH 3A67H 3TWCH 2AEWA 3UBXI 3GSUA 3HPLB 5DRNB 5C2UB 1X5JA 1J8HA 3R06B 5LWYL 3O2VH 2CXKA 1ED3B 4JDVB 3QIBD 4L1DA 1AP2B 4XCNB 3LKOB 4JHAL 4KAQH 2BSSB 4HC1A 3HNTL 4ONGL 4M3JA 3B2VL 3FN0L 2VUOA 2AGJH 5DK3A 2DI9A 4OAWA 3RKDD 1WBZB 1BP3B 4O4YH 3ULUL 4UOW1 5EOQL 3GIVB 4FQCH 4F58L 1YNKL 4MCZB 3CSGA 3DUUA 3A6OA 2JIXD 2EE6A 4EDWH 5C0AB 3KR3H 3KXFA 3OX8A 3PWVA 4TSBL 4M48L 1FZMB 5LQBL 4LP4A 3U0WL 4G9DA 1CGWA 3GSNH 4I77L 2I24N 5EFIB 2BXZA 2PTTA 3HE7A 5LGJB 5D6CA 2FD6L 3T2PA 1AKJD 3BMWA 2B4CC 4N1CA 5CJ8A 1S8DA 2WP3T 5E8DL 2OX5A 2ZOLB 3UTTA 3TBSA 3PXJA 3HKFA 4G6ML 2R1WB 1FV1A 2EC9T 2HT2D 4C56E 5KW9H 3RWIB 3DBXA 4E42A 5DVOA 1EPFA 1DQDL 5HGDB 3LS4H 5B39B 2DM2A 3UTSE 1CICA 1FVDB 1VEOA 1X7QA 3GSXA 3UO1L 4PJCA 1I3VA 3HPLA 2BJMH 4AK1A 5D6DC 4OBSA 2XRAH 4JDVA 4QRTB 1EJ6A 4FN0A 3QUKB 1AP2A 4XCNA 3LKOA 3F12B 4HIJB 2BSSA 2ZCLH 1MFBH 5FFLA 1EBPA 4LEOB 4RWHA 2D7OA 4NO0D 4LFHG 3RDTB 4U31A 1JYWA 4RSVA 4A2MA 5IEHB 5TE6L 3U4EB 3GIVA 1BJ8A 1M05A 2VDLH 3BKYH 4MCZA 4MHHI 3IETB 3QEHB 4S1DD 5HYFA 3ZKMC 5IGXL 1FYHB 2JB6A 3QR2A 2PYEE 4RGOH 1FH5H 2NY5L 5F97E 2DQJH 1IKNA 1FZMA 4X0KA 4FA8A 1OGAB 1D9KB 3ZTJG 1EAJA 2BSTA 2A83A 2O5ZL 4P3DB 5EFIA 1T7XA 2CRIA 2HFEB 3U4BH 5LGJA 2EDEA 3AU1B 5DJ8A 4KFZC 4I0PD 2W65A 3BRFA 4D9RD 2NY3B 4Y16B 5ALCL 1X4ZA 3Q2CA 4YHMH 3L3HB 1WBYB 4K7FB 1J0ZA 2KUTA 3PHQB 1MRDH 2R1WA 1CE6B 5IK3B 4H1LH 5MP6L 4N68A 4KI5E 1QG3A 4Y4HC 4GKSB 3GM0A 2VLJB 5MERA 1EV2E 1EGJA 3RWIA 3SDAD 3HG1B 4KKCC 2ATPB 5KOVC 4FQXB 3DARA 2O5XL 5B39A 4QRPD 5C0FA 2NNAB 4U1IB 3RIFF 1FVDA 1KB9K 2YKLL 1DEEB 2IANA 2D7QA 4BKLB 1XH3A 3B9VA 4EDXB 1NMCC 3S97C 3S7GA 4ODTH 4UDTB 4QRTA 1CWVA 1MHEB 2XY1A 3AB0C 4X98A 3F12A 4MCYB 4G43A 3P3YA 4ENED 3RWJB 4AQOA 1CU4H 1AIFA 4LEOA 5GGSA 2C26A 1SVCP 2Y6SD 3RDTA 5JOFB 1K5NB 5IEHA 3LS5L 3FO1B 2IPKB 2OM5A 2ZCHL 5BXFB 4KY1H 5AUMB 5FECA 3IETA 1L0YA 2YEZB 3VCLA 3H0TB 1MCPL 3WSQL 3RY6A 2HT4D 1OHQA 1OP5K 5DD1L 3CFBA 1P53A 1YECH 3QZWA 5FYLL 2CPCA 4DGVH 1OGAA 3V4PH 3S35L 4PJHA 3O9WC 5ICYB 3GSRB 2ORBL 1QBLH 1QLRB 2HFEA 4ZXBC 3QCUH 5DA4A 3UAJD 1NKOA 3AU1A 2A38A 2B2XL 4GBXA 4PJAB 3L5XH 4Y16A 4XNZC 4TVSa 1WBYA 1IGCL 1KC5L 3L1OL 5JQHC 4FP8H 4P2RB 3MRIA 3ARGA 4C54A 1HKFA 4LPTA 5CGTA 2DYPD 4EN3A 5BV7L 4GKSA 5IJKA 4OIAA 1D5IH 2VLJA 5FCSH 4DKDC 3GKZA 1KEGL 2CLRB 1QQDB 3D85B 3RIAF 4NQXB 1SY6H 2NNAA 4U1IA 4XXDA 1DEEA 2IGFL 4BKLA 3I50L 4JPKL 4ZG1A 2GJ6E 1W72B 5D1ZA 2PN5A 4S1QH 2AJ3B 1TXKA 2XZAH 5T1LA 3DVIA 4UDTA 1CVSC 1LP9F 1MHEA 4LVEA 4X6BA 2Q86A 3T0WA 1QD0A 4MCYA 2HLAB 1VGEL 3JWNC 3RUGA 2O5YH 4FQHA 4G80B 4OKVA 4B41A 4X7TB 4Y5YB 5T1MA 4HIXH 4DUVA 4UQ3A 5JOFA 1K5NA 4L4JA 5IFJB 4DGIH 3W9EA 1JN6A 2IPKA 2QSCH 4NBXB 1ZEAH 1F8TL 5AUMA 3GNML 1G7QB 4XHJC 1CIUA 1RIUL 5CP7A 4K2UH 4L8SB 2YEZA 3H0TA 4XXCC 2XI9A 4PGDB 4KRPC 3BP6B 4M5ZL 4HXBH 4FFYH 3IU4L 4LARH 3V0AC 3QCTL 1IEBB 4RFOL 4PR5B 3VWJD 5HDQH 1QP1A 5ICYA 3GSRA 4H20H 3ROLB 3QWQB 1J8HE 1QA9A 2P7TB 4YIQB 3K8LA 3VW3L 1RUAH 4PJAA 2BNUB 3FO2B 4W4NA 5DUPL 2HLFD 3Q5YA 3C60C 2JCCF 3BPNC 1NFIB 4M43L 6FABH 1AGDA 3BESR 4FG6D 3DXAB 3RNKB 2BNRD 3B9EA 5C08D 3MACL 2VDKH 1KLGB 3GDBA 1FZOB 2DLFH 3NZ8A 5GPRA 1QQDA 1P7QB 3JV5A 4FQ2H 4WHYH 2AJYH 5CZXD 5SWSB 1FGVL 2GAZA 3EOAB 5TE7L 2DQIL 5T3XD 1DQTA 1MJ7H 3JBG7 1LK2B 3KXFE 4RMSA 2W59A 5LCVL 4I48A 4WNQB 1PW3A 2VDQH 2JTDA 1G9MH 1HYRC 2HLAA 4ISVB 4G80A 1K2DB 1T80A 4Y5YA 1DANU 4RMUA 4JHAH 2IAMB 2Q7NA 4PV9A 5IFHL 3UTTE 2L7UA 5IFJA 3HNTH 4MX7B 1A4KB 4KI1A 2HRPL 3FMGL 1G7QA 1MCWW 1QFUH 4L8SA 5GJSL 2AS5M 4WWKB 3PUCA 5E94A 3ULUH 4A6YL 4PGCA 4KUZH 4ODUA 4PGDA 3G6AB 3IVKA 3BP6A 1T89A 2OXHA 1W0VB 4PR5A 4OZGA 1UH3A 4AIOA 3ROLA 4G9FA 1AXSB 4YWGL 4TSBH 2P7TA 4NM8L 4PJIA 3TBTA 4YIQA 3C09B 2C4FU 2VLKD 3MLTA 4HS6B 5DJCB 3W11D 2BNUA 3MCLL 4AMKL 3FO2A 3PGFL 3WXWL 2OXGA 2H6PB 3QQ4B 4I3RL 3TO2A 3WUWB 2FJFA 1MWAL 1Q94B 2YN5A 3BZ4B 3VFTB 1NFIA 1G9EA 3GSVB 4R4BB 3RNKA 3QUXD 2H9GA 3SE3A 5CP3H 1T66D 1FZOA 5EO0B 1MCEA 3TA3C 4ALAL 1MCHA 4KMTH 2DIBA 4WW1B 3LRGA 1D5BB 5FYKD 5DC9B 3HC4L 4NQDD 3KLHC 1ND0A 1NL0L 1LK2A 5C0AE 4Y2DD 1U9KA 3O11B 3UO1H 3GMMA 5I19L 4JQXA 3D0VA 3LKPB 4ISVA 4NRZB 4Y4FD 3AMKA 5EZJB 4NRYA 2IAMA 2PO6B 4JRXB 1TLKA 1B90A 4MX7A 1A4KA 3DYPA 3DUHA 4GRWH 2B20A 3D2UA 4WWKA 5EU6D 5DUBB 3IFOB 4AG4L 3K3QA 3IFNL 2XTLA 3QFJD 5DEZA 5KSBB 4ZO7A 1Q0XH 4WEBH 1NDGB 2WQ8A 4JFFB 1U3HB 4PY8J 2C3XA 3FO9B 3I3DA 3VXUB 1AXSA 4PJEF 3FQUB 5E5MB 5HVWA 4HS6A 1R0AL 2OR9L 1DBMH 2O5ZH 2J4WL 4X6CA 3QQ4A 1C1EL 4XC3L 3JTSB 4EKXA 2L4OA 3WUWA 5CKGA 1XIWA 1Q94A 2WSKA 3BZ4A 2C7UB 3QDMB 3VFTA 2VKXA 1QSED 3N1QC 4R4BA 3E1F1 3WKML 2PETA 4G8GB 3VXMD 1T0MA 3RPIB 4A2LA 4IRSD 5E8OA 5EO0A 5HDLA 4WW1A 1CQYA 5C3TA 4K3JH 4WUKH 1ITBB 3WNPA 3WIHL 1FQ9C 2O5XH 1X5KA 3QNXA 4YBQD 3U9UB 1HH6A 4HPOL 4NZDA 1Y18A 2YKLH 1P4LB 1OGAE 2OK0L 4LPVA 3O6FA 2WNGA 2ADJA 4NRZA 5C0BD 2EDNA 3DI3B 1HILA 4DK6A 4HMDA 1N0LA 5HHNB 1KCSH 2B5IB 5AZ2H 43C9A 2PO6A 4JRXA 5I1KL 2JCCB 2EEAA 1ETZA 3GI8H 1H8NA 1QSZA 3HE6D 2CDFB 1UWGH 2VLJE 3WIFA 3TZVD 1BEYH 4KXZH 2R1XB 5AYUH 1VFMA 2LVCA 3IFOA 5C70A 1JF1A 5FGSA 5KSBA 1NDGA 5MEND 1MCPH 4YHZL 5F3HA 3WSQH 1W8OA 4OCRL 1CXFA 3VXUA 3FO9A 2ZUYA 5FGCB 3RTQD 1NGXB 3C2AH 4TOYH 3FQUA 5E5MA 5J1TC 3S35H 4OGZA 5E2WH 1J8KA 2ORBH 3FT3B 5JOPD 2EC9U 1AGBB 2CJUL 4WO4A 5I2IA 3IKCB 3QDMA 1RI8A 3GIZH 1S3KL 2Z31C 5C8JB 4G8GA 2ZSVB 3L1OH 4JFEA 3HRZB 4TVPE 3RPIA 1WZKA 2DRUA 3RKPA 5BV7H 2HA1A 1A2YB 4OCXH 4QXTA 5IBTL 4MDJB 2FLRT 1Q1JH 5CILL 2BVUA 4KQ3L 4KKBD 5DT1H 1Q0YH 3TPUB 4R8WH 2C3VB 3U9UA 1RJZB 4M62H 3TM6A 3FB7B 5BMFL 3OKDB 2IGFH 1P4LA 3I50H 2K7QA 1HK6A 3AS2A 2D2OA 5HGBA 5HHNA 4PJAE 3BW9B 3RI5K 1J12A 4PRHB 2JCCA 5D7JC 4Z0BH 1A7QL 1ERNA 1TETL 4M6MH 1UCBH 1WVZA 1NAKL 4P46D 4OM1L 1MCRA 4XNQB 4P2YA 1H3VA 4F8QA 1DSFH 3GNMH 3U82B 3T3MF 3NZHL 3IXTB 1NLDH 1EFXD 4LLMB 2Y07L 4MA3B 2OJEA 3T0ED 1CFSA 4QRQA 3VH8G 3EYQC 4JR9H 1U3ZA 1NGXA 1XZ0A 5K59E 4WFFE 4QF1B 2RB8A 1TTGA 3IKCA 1FO0L 2LV4A 2NY7H 3TBWB 1CF8H 1EXUB 1WSST 2R23B 2ZSVA 5DUPH 3HRZA 5F7MC 2NYYD 3AM8C 3T1WA 3DX9B 2QKIB 4M43H 3FRUB 2NY0D 1XGUB 1A2YA 4QHMA 4MDJA 3VFWB 4D9QD 4M7LH 5JHLH 2E27L 4R2GD 3UZEA 4I2XA 1RZFL 1FFNA 1KCRL 2C3VA 1RJZA 1UWEH 3KDMB 1FGVH 3FB7A 4GQ9L 4HBQA 3RWHB 3SOBL 3O6KL 4LBEA 5ADPL 5KZCD 4BFIB 1FZJB 4G9FE 4LCYB 4PJ8D 4PJEB 3KS0J 3T65B 4OCSL 1T5XA 4P2CG 3WXVH 4PLOB 2WWKT 4U4BA 2UY7A 1FNFA 1EZVX 1OM3L 3UYPA 1UGNA 4PRHA 4NZUL 1KXTB 3JWOL 3MREA 3QDJD 3O8XD 1RHHA 1RY7B 1NCBH 3P4NB 3MLYL 3CSBA 4JFOA 3DXAE 3QXUA 3TIEA 1I85A 3HMWL 3D5OF 4X99A 2HJLB 3ESVF 2VH5L 2WBJB 4HAGA 3FMGH 4UINH 5ICXB 3LPFA 3IXTA 5LVEA 5TQ2L 5GJSH 4NHUB 4NRXB 4JRYD 5KJRH 5J12C 4A6YH 4TRPH 3FFDB 4HMCA 4LLVA 3VGEA 3RL2A 2XQYG 4M6OH 4L4TB 5I8KL 1A1MA 3IDYC 3VXQA 5C2BL 3AREC 3VD9A 1UA6H 3EYOA 3TBWA 1ZK9A 2R23A 3ARWA 1ZT4B 4I3RH 4PP2B 1QTYT 5J6HB 3PWNB 2QKIA 4NPYB 3FRUA 4CVUA 1XGUA 2VZ3A 3L3IB 2VDRH 3O41B 3K8MA 5D6DA 3VFWA 4GW5B 1FVEB 3ECBA 5DJAB 2FYYB 4FZEL 5T3ZL 3V52H 3HC4H 4IS6B 1NL0H 4XP9L 2CGRL 1FZJA 2G9HA 4LCYA 5EU3B 2EEDA 2X40A 3T65A 4M00A 5LXGL 1K3IA 5TF0A 2ENSA 4XCCL 1T03L 5I19H 4UT6L 2WUCL 4ZPVB 4DEPB 3QIUB 4QOKD 2IBZY 1HKLL 2D0GA 2AJZB 1I1CA 4HJ0D 1MH5B 4XBGB 4IOIA 2J6EH 2DTSA 4P2QB 2BRRL 1KCVL 5E6IB 1TZGL 1O5DT 3KPMB 1CDIA 1EA9C 2HJLA 2WBJA 3GJEB 2XN9A 5D96C 3IAGC 4HQQH 4NRXA 2YMXL 3QDGD 4MDIB 3BSZL 4U1KA 3SGDH 1U8HB 3V2AR 1U2HA 3IFNH 4PGBA 2CDEB 1M6OA 3MNZB 1MY7A 2Z93A 5IW3A 1FAIH 5F3BB 3GB7B 4L4TA 3C6LC 2HTKC 2R1YA 3MNWA 2V2TB 2VR5A 1OAYL 2X9YA 2OCFD 4MA1B 1R0AH 1N3NA 3PGDA 3V4UL 2GQHA 3MRLB 4DN3L 4XC1L 2R56L 4JRXE 4PP2A 5HI4C 5J6HA 3PWNA 1JHLL 1CYGA 3WFDL 1N2RB 4NPYA 3WS3A 2EXYC 3EFFB 3QA3B 3O41A 3WKMH 1WT5C 2CO6B 4LLYB 4PUBL 1ZGLB 2PYFA 1HH9B 2DM3A 1RIHL 3C5SB 4PRID 1LO3L 1N7ML 4FFWD 5KSBE 5T3XH 2FYYA 3H7BB 3MRKB 2EE3A 1MCKA 4KWUA 5I18H 2ARJB 1RZIB 3WIHH 1MEXH 4LSVH 1I1AC 5IB1A 4FNLL 3VXUE 3VXRA 1WZ1L 3IU3B 1L0QA 2OK0H 4U1JA 4ZPVA 5FDYA 3QIUA 5E1AA 3D69B 4WU7A 3ZDXF 3QDME 4JZOA 1MH5A 4XBGA 5H8DA 4YHNB 4DCQB 4P2QA 4G8GE 4G8EB 3KPMA 5IW6B 3O9WA 1NGWB 4LRIC 3GJEA 4X6FB 3LN9A 4NC1C 3TBYA 3W9DB 1KGCD 4ZXBA 1X5ZA 3THMH 2FJHB 3QJHA 4WWID 2APXA 4K7PX 2A9NL 1U8HA 1RJYB 1HCFX 1KULA 4O9HL 4R3SB 1CDGA 3MNZA 5CUSL 3CVIH 3GB7A 4OCRH 3B3IA 1HXMB 1NAMB 4QHKI 5CLWA 1WCBA 2X4PA 3R0MA 3BAEL 4Y5XB 1CZ8L 4N0FB 1QZ1A 2CJUH 2JCCE 4ZYKB 4DVRH 1MREL 1IAIH 3QA3A 3EFFA 1JHKL 2JK5B 2R0LL 2VIRB 4IOFD 2X7LB 1ZGLA 4M1CC 3ZE1F 5D1QB 5IW1A 2GHWB 5I8EB 1MVUB 1JRHH 3C5SA 5FYKH 5J11B 3WFCL 4LSSH 2BY3A 5CEXB 2X1PA 2FX7H 4X6DF 1HWGB 4P3CL 3KHOA 3J8F7 4XTRC 5FGCE 3MJ9H 4LCUB 3C08L 2CK0H 1PY4A 4LKCA 3L5HA 3IU3A 4LQFH 1KT2B 1U3YA 4HIIA 4K9EC 2APTA 3OXSB 4HLJA 4LCWD 3VG0H 1QFHA 3KYMB 3TNMB 5IFAH 3VGAB 3D69A 1DVFB 1R3IL 5DRZA 4YHNA 2AV7A 4G7YH 1NMAL 3RZCB 3SO5A 5JUEL 3MV9B 1C12B 1A7QH 1NGWA 1TETH 3LVEA 5DA0B 3Q0HA 4X6FA 3W9DA 3ARXA 5KBNC 4Y0GA 3EO9L 4OM1H 5IB4A 3PIQB 2WMPA 2CUMA 4JM2D 2NTSP 1ZS8B 1BVKB 4R3SA 1FC2D 2J1KA 2AVGA 3C60A 4MVBC 1N5YL 2OSLA 2VISA 3DECA 3LKNA 4K8RL 4YHPB 4OKDA 5JOEA 4J7RA 1DBKL 3PJSB 3QXDA 3OJDB 4BQ9A 4ELMA 4J1UA 3IGAB 3HMXA 4KTEH 4Y4FB 4N0FA 4YGVB 4PRHE 3VGDA 2A1WL 2WM0A 1G9MC 2QL1A 1FO0H 3TYFB 4JAMA 1YMMB 2OL3L 3LKQB 4YNYB 1VFOA 2X7LA 1S7RB 5D1QA 5JXEA 3S88H 2NQCA 4JJ5B 5I8EA 1O7SA 4CW1B 4XNMB 5IV2B 3MV7D 3OKLB 3ILPB 5L2KB 4HF5H 4PJ7F 4H88H 1PDKA 3TO4C 1KCRH 3RWEB 3T8XB 3G5ZB 3ULUC 2P5EA 4EZMA 4GQ9H 2QADB 4NQED 4ZFFA 1JF6A 3FFCD 3SOBH 3O6KH 1KTLB 4O5LL 2DQUH 5KVFL 1KT2A 2DQGH 3OXSA 1WK0A 3PWPA 4EJ1C 4OCSH 1OW0A 5EZLB 5JW3H 1OTTC 4HAFA 1DVFA 2XZZA 3CFJB 3EHBC 2R2CA 5B21A 3RZCA 1FZKA 1PG7X 2YN3A 4RGNC 3MV9A 1C12A 5ISZA 3JWOH 5T1KD 1I9JH 1QSEB 4HX1B 4U7MA 3MUHL 1JGEA 1RZ8A 3PIQA 5KS9F 2VH5H 1ZS8A 2AEIT 1BVKA 3I6LE 5F1SA 2X44D 3LPWA 3QUYB 1KIRB 1M7XA 5CS7A 3L3DB 4JCLA 4NBYB 5I1GL 4S1RH 3WJJA 2YPVL 4OLUL 4PJEE 3AUVA 3PJSA 4JJHA 4OT1H 2KQNA 5I8KH 3OJDA 4OLYH 3ALXA 3IGAA 4GAGH 5IHLB 5F7UA 3QHTC 3QULB 3LMJH 4YGVA 5A3IC 5DMYA 1BQSA 3IT8D 2HKHH 5HSFA 3TYFA 2PR4H 5D93B 3QB7C 1RK1B 4PJ5D 1YMMA 4YNYA 1G7MA 1DTUA 1ADQH 2RCSH 1A6TB 1S9VB 5DQ9B 4HWBA 5F96H 3GRWL 4IJ3C 2VXQH 2YPLD 2PTUA 4M6NL 3DURA 4YZFE 3T8XA 3BPLB 4FZEH 1U8QB 5T3ZH 5HHMD 3GI9L 4NQCB 4AEHL 4L4TE 1V7MH 1LK3H 2CGRH 5HBBA 4G6JL 5FUOL 5EZLA 3B9AA 4HJJL 3V5HB 1VADA 2XV6B 5FHAL 5GJTH 3W0WD 4Y1AD 3VMOA 4F15C 4UT6H 2WUCH 3ARFC 4XAWL 1RUKL 5I6XC 4RFNB 4BM7A 4OGYL 3T0VA 1E4XI 1KCVH 1R3LA 1TZGH 3S34H 4UT9H 3TT1L 1KB5L 5C0DB 1C5CH 4J3VA 4I4WB 3WKNA 2J3SA 1Q72L 3MRJA 4LVOC 4GRLB 1VFUA 3L3DA 5FM4A 3RA7L 3NA9L 3VD4A 4LU5L 3JZ7A 1CK0H 4JKPH 4EQ2A 4XMPH 4Z7QF 3C5JA 2XTJD 4JY4B 3G9AB 2R29L 1BFSA 5A16A 1INQA 3QDAA 4HWEL 5L8JB 3QULA 1OAYH 1Q9KB 4LGPB 1Y6MR 4ZD3H 5KSVB 3STZA 1U8MB 3EDKA 2D03L 3QIBC 5IBUG 1RK1A 2Q8AL 1BM3L 3ET9F 4P2QE 2EYRA 1UKSA 4GMSH 1JHLH 4V1DA 4NQVA 5EZIL 4PY7B 3E6FB 1A6TA 1EHAA 5DQ9A 1YEKH 3I3BA 3QWOB 3U36A 3RKDC 4LSRH 4ZFOL 3P0YH 1KIPB 1KG0A 2BHUA 5TQ0H 4CUCA 4P4RA 1LO3H 4D8PA 4N8CL 1U8QA 4RWYL 4MAUH 1I1YB 5E8EA 4NQCA 4FNLH 3MV8D 1OF2A 2RHEA 1HZHL 3BPOC 1BLNB 2Q3AA 5IMLB 1N64L 1U8JB 1MF2H 4POZD 4OFYA 4YUEL 1G0XA 1GC1L 4PYHA 4EBQL 1ZLSL 2E7LC 3OMZA 5K9OB 3VMNA 1GGTA 4O2CA 5ID1A 5F7FA 1GYAA 5CEZL 4I4WA 1D6EB 3KJ4C 2FX8H 2HT2C 4JFZH 4CNIA 4AL8H 4ZFZA 1VKXB 3HCVB 1IM9B 2DOCA 2AJSH 4Z8FH 5C07A 3OKEA 2A9NH 2EDXA 4BSWB 5GIRB 2Z31A 5L8KB 4O9HH 5I1LB 1BZQK 2VXTL 1CT8A 3MRRB 1L6XA 3QIWB 5HHVL 5CUSH 1RV6X 5BOPA 4WDIA 1XGYL 1LVEA 4N9OB 1YEDA 3CXDL 4HUVB 3LDBC 4UB0L 3BD3A 4X4XB 5I15L 2E7CA 5KSVA 5IHUH 4EUPG 1A64A 1OAUL 4FOMA 1WIOA 4U6VH 3H9HB 4Y4KB 1WZLA 1JHKH 1MY5A 4JVPA 3QWOA 4U0RB 5KS9B 3B8YA 5IEKB 1KXQE 4PRPB 4YDLC 4Q6IC 3K46A 4OQTH 3LSOB 1KIPA 4PTTB 4HH8A 5D7JA 1I1YA 3GSNB 4S1DC 3LHPH 3V6OE 3BIAX 4HT1L 1IGFH 5IWLA 1T22B 5IMLA 2EIDA 1QBAA 3VXOB 1NCCH 3PHSA 7FABL 4NT6B 1FBIL 4HH9A 4I0PC 5GQBA 1C16B 2DLHA 1VFBA 5B3NA 1H9VA 1IM9A 1ZVHA 3OAYK 2V5MA 3SDAC 4CL7A 3Q3GB 4MMXC 4NZRL 4BSWA 25C8H 4D2NA 1IFHH 3M07A 4JY6B 2P5EE 3WNKA 3MRRA 5ANMA 1T2JA 1XMWA 2GK0B 2X9XA 2E7HA 4F33A 2B39A 1U2CA 4P3WA 4X4XA 1DBKH 1J0HA 4LHJB 1JMZA 2NMSA 4NC0B 4U0QB 4XVTL 3BE1L 3SO3B 3VXSB 4ENEC 1L0XA 3H9HA 3MV9E 1HHGB 4RAVB 3G5YB 2Y6SC 2OL3H 1UM6L 5IEKA 2XA8L 2ZSWB 4EIGB 5F9JB 1TQCC 1NCUA 3RY5A 4YO0B 3LSOA 2BVOB 2YRZA 3EYVA 4PTTA 1WFOA 2GKIA 3D9AH 3GSNA 3UBXG 1YZZA 1WBXB 4FQ1L 5GGUA 2HT4C 2P45B 5D2LA 1JTOA 3BP4A 4WFED 2K3TA 2BCKA 3EFDL 3VXOA 2EKSB 1X5XA 4H1LB 4OFVA 1N6UA 3U46B 3UAJC 4NWTL 2ENYA 1ZWIA 1MFEL 4NT6A 2J12B 3MFGB 1YMME 3D39D 3M1BB 3U79A 1CFBA 4G5ZL 3EJZD 4YHIB 3HC3L 2WAHA 3AREA 2GCYA 4M03A 2GJJA 3O4OB 5DK0B 1F3RB 5L2KE 4NKOB 3Q3GA 1NC4D 5DHYB 2GIYA 4JY6A 3JV0A 2YZ8A 1AJ7L 3P4OB 4ZNCD 3P9MB 4N0UB 3SPVA 5KSUA 5TH2B 1TZHA 2LTQC 1X6LA 1KEML 3TPKA 4BQCA 1L7IL 1OGTB 2LAAA 5AEAA 4P4KB 3TBVB 3VXSA 4LMQE 3LIZL 2HYMA 3CX2A 3FN9A 1XF1A 3G5YA 5F9JA 4W70A 4YO0A 1FJ1A 4YBHA 4DFIA 3CH1B 3CMGA 1C5DA 2BVOA 2H41A 3JV4A 2APVA 3DTXB 4O2EB 3GRWH 1KBGH 4M6NH 2ZWLT 4QHNA 2A9MH 2E7BA 1HOCB 4OD1H 3MYJA 5BZWA 2D7NA 3VWJC 5IG7B 1Y6NR 4H1LA 4U2YA 3MFFB 4NKQB 3QRFM 4U6HA 3WO4B 3Q48A 3ARBB 4OCNC 5F8QC 3IDXL 1PZ5B 2BK8A 2IG2H 4NQTA 1RUKH 3RVTD 2HLFC 3C6LA 4J3UA 1HSAB 1TVHA 4QTIH 4OGYH 3BOVA 4H0HB 4Y19D 4FG6C 4C57C 3TT1H 1KB5H 3PG2A 2ZUSA 1Q72H 4YDVB 4YX2L 5BVPL 3FQNB 4HIEA 2VL5B 4PB9L 4HGMA 1OWWA 3FQXA 5CZXC 1UVQA 4NQCE 1KJMA 2X09A 1SM3L 3DGGB 4LU5H 5ALBL 3MUGA 4HIHB 4OI9A 5BVJA 1WICA 3P9MA 5GGQL 1T04B 3HZYB 2FWOB 2H3NB 2SEBA 3RGVB 1JNLL 3VFNB 1OGTA 5C0ND 3RFZC 4P4KA 3TBVA 1BAFL 3NTCL 1UFUA 5IMOB 1MI5B 5I1CL 1LEKA 5E9DB 1QYGL 1BM3H 4PRAB 1FGNL 4OSUL 5CIPH 5J13C 3CH1A 4XP1L 3O4LA 5ESAB 3DTXA 3NGBC 3GMOA 2CD0A 4AEIL 5DD5H 1HOCA 4R0LC 4DKEH 4LRIA 1FL5B 2D7TL 3V6ZB 1DE4B 4PB0L 1GPOH 1N59B 5CINL 3F7YB 1DN0B 5T33L 4KHXL 5DHVH 3LPGA 1GC1H 3NPSC 4UZGA 3V6FB 4G42B 3W11C 4NUGH 5JORB 4YEFA 1UT9A 4ONHB 4U2ZA 4K71B 4XP4H 1SY6A 4I1NB 1HSAA 3RAJH 2H2PD 3GO1H 4NKDA 2C3HA 3MJGX 3QUXC 4OZFG 5CEZH 4FTVD 3FAXA 3S96A 4ODWB 1UWXK 4RISL 1T66C 2P8PB 2QQNH 2RGSA 3RGHA 4L1HA 3BH8B 2F53B 4M61B 1HN1A 4HIHA 5E4EB 5J7CC 2D4DA 5EORL 5F1IA 2VXTH 4Y2DC 3DVGB 1T04A 1P4BL 2FWOA 3QI9B 4MZ3A 4H8WL 3VFNA 2B0SL 5EU4A 1A6UH 4U33A 3MRQA 2DLIA 4J3SA 4Y4FC 2F5AH 5HI5D 1ZANL 3BO8A 5E9DA 2EDTA 4PLKD 2IMNA 4MJIB 2N56A 1DFBL 4PRAA 2A74B 1VA9A 4O51B 4ZUSB 5D71L 3S3SA 5ESAA 3T2QA 5ADOL 3T4YA 1NCAL 5I71C 5T1DH 2XZCH 3R8QA 1F4XH 5A2FA 4EIZC 3A6BL 2HAZA 3BJLA 5ANME 1FL5A 4JO1L 3V6ZA 1DE4A 4HT1H 4LSQH 2BNQD 2DL2A 3GMPB 5HHPB 1FIGH 3F7YA 3B9KB 1DN0A 5ACZB 4G42A 2XG4A 4JKWA 4Z7WB 5JORA 3OKMA 5HYQB 4H5SB 4ONHA 4OCWL 1EJOL 4JREC 2BOBA 4FQJH 1FRGL 4WGVB 1V7NL 4PRPE 3INUH 1JTTA 2GTWA 4FQQB 4Q9RL 2P8PA 4IRSC 2AABL 1H8OA 5JA9A 3ZKND 3TN0D 4KDVA 4XP5H 4L4VB 3BH8A 1S9XB 4JGUA 5FHBH 3AAZB 2Q6WB 2VDOL 2R4SL 3KYKL 1YEJL 2GITB 4YBQC 3QUZB 3DVGA 1A6ZB 5JXAH 3OF6D 4IBLT 4KVNL 1NBZB 3MLSL 3QI9A 1F4AA 4UV4L 1WV7T 4OZHF 3JUZA 1VCAA 3S4SB 4GRWB 2P24A 4G6KH 5D9SB 5EWIH 1HHKA 4UT7H 1TVDA 3TO4A 3BQUD 2WV3A 4DKFL 3MJ8B 4MJIA 2OR8A 3O3BA 2A74A 2P5WD 3HRPA 2YA2A 4O51A 4ZUSA 3QPXL 3I6GB 3SGJA 1FLRL 5FKPB 3HE6C 2XA8H 3Q5OA 3GJFB 1FNEA 5FKAA 3TZVC 4OLZL 1QFWI 3C87A 5FGBC 1IC7H 1Y0LA 5TJWK 4JVWA 2D3VA 4I3SL 1I8IA 3WYRA 3E8UH 1J1PL 1P9MC 4C4KO 1B3JA 3QWRD 1XR8B 3CFEB 3GMPA 5HHPA 3B9KA 2LU3A 5JHDA 4NJAL 3RTQC 5ACZA 5INCB 3QQ3A 3EFDH 4Z7WA 4ZTOH 5CP3A 3L3KB 3VXSE 1WEJL 4NWTH 1MFEH 1BHGA 1XR9B 4HHAA 1OT2A 5CGMA 3OKNA 1CI5A 4C83B 5FA4B 3TFKD 5IR1A 3BN9D 3K2UL 3ARTA 4E5XA 3SDYL 4U1HB 4KKBC 4Z7QE 4XT1C 1OP9A 5F6IC 2GITA 5F9WC 3QUZA 3JWDH 1NBZA 3DRQB 1S7VB 1AI1H 1R5VA 4WTZG 3H9YA 5D7LB 4F7EB 3S4SA 5EU5B 3LH2H 1KEMH 3WIIH 2YWYA 3LY6A 43CAB 5IB2B 2M8XA 5DJXB 1BZ9B 4JE4B 5HYJB 2DQHH 4P46C 3RNQA 1RSFA 1NC2D 4FABH 5E1HB 2IH3A 3VRIA 5CD5D 4PD4J 2VRAA 1KFAL 4HG4J 1A7NH 4K7PH 1GGIH 2O61A 2IH1B 3T0EC 1XR8A 2Y5EA 4N0UE 4LPYA 3CMOL 5INCA 4RZCA 5CGYD 2JB5H 4MSWA 2DQTH 3ULVL 4GKNB 5BV7B 3QPQD 4X7CC 2PCPA 1KELH 3CX5J 4R7NB 3NIGF 1BQUA 1NJ9A 5KSAD 4QRRB 4X9BA 5AG9A 1CGSL 1NPUA 4JM4L 2I26N 1P7KB 3C2SA 1NFDF 1MHPL 4X6EB 2H45A 2NYYC 1G6RH 3BKCH 2NY0C 5GS0L 4FHBD 4M1DL 3QO0A 4NOFA 4R2GC 1YUHB 1Z2KA 3M45A 5ITFB 4KRNA 4UIKL 4PB9H 5HYSB 4XCEA 1VDGA 2QTEA 5CWSB 3DRQA 1SM3H 1PX4A 4PJ8C 1T1WA 5D7LA 2MNUA 3DX6B 1RUQL 1GGUA 2XKUA 5EU5A 5E0QA 5J3HD 2YD8A 1YQVL 3LD8C 3GHBH 3NTCH 1S7WA 2JIXA 5DJXA 2EDWA 3O8XC 5IB3A 3VI3F 5HYJA 1FGNH 1VSCA 2ICEA 2FL5B 4XP1H 2EDOA 3SE9H 1PJ9A 4ZTPL 3U7YH 4S2SA 1WGOA 3L3GB 5GHWL 4GG6A 4LCIL 4RA3A 2X4QB 1MLBB 3HNSL 1IKFL 2D7TH 4F7TA 2EIEA 4QYOB 1LQSR 4GKNA 4Y8DC 2DMBA 2W0LA 3WFEL 1FFPB 4R7NA 2MQ3A 1MI5E 1OAQL 4JQIL 1UQSA 1WITA 5E9DE 5KVDH 1DEDA 2IMMA 4QRRA 3CUPB 1W0WB 1IT9L 3N9GH 1HCVA 3QDHA 1I7RB 2HN7B 1CLOL 1A7OH 4DTGH 1A9EB 4RISH 1CL7I 1NEZG 5F1NB 1R24B 1CG9A 3SJVB 2V7NA 3WBDA 5CWSA 4NO0A 5H94A 1P1ZA 5HHXH 4P5TB 3MNVB 1J88A 3NPZB 4NUJB 4MXWH 3DX6A 2PXYD 4Q6IA 3TVMD 5FYJL 1MRCL 4UUJB 2B0SH 3ZKXC 3QH3B 3MRGA 3CC5B 5DSCB 5LGKA 2EZ0D 2H8PA 1SJHA 4HJ0C 4AM0A 4A6YB 4CDHA 1QOKA 1DFBH 4NN7B 1OARL 2FL5A 1CGYA 4NHCL 1PKQB 2EH7L 5D71H 3EGSA 5E2UL 4E0RB 3ORJA 4DQOL 1NCAH 4KHTH 4QEGA 4ZQKB 5BQ7A 2I9LB 1KSRA 3UTPD 5EO1B 1GXEA 1JNNH 4DZBB 2F53E 1U6AL 1RU9H 4I0PA 4DFHA 4XPBL 3RWFB 4P9HL 3VH8A 2J7LA 5F7DB 3A6BH 4L3EB 2X4QA 4WCYL 4YFLF 1QSFD 1X5FA 3F7VB 1SJXA 2BVEA 5GRJH 3PHOA 3VJ6A 2A73B 5HDOA 1ONQB 1KCUH 4QYOA 1MWAB 4PGEB 4XP6H 3QEUA 1KTDB 1LGVA 4WW2F 1X4YA 1NEZB 1UJTA 3RRQA 2VDML 2V9RA 3ULUE 3CFDB 4FQLH 4MJIE 3CUPA 1W0WA 2XKSA 1P69B 5EIVA 3LZFH 2MWCA 2X4RB 5JMOC 2UZIH 4O58H 3D25B 4NKIH 1KCKA 2I07A 2QJDA 1VFAA 2EDDA 4CVXB 1A9EA 4PGJA 1JZ2A 5F1NA 5JIHA 1R24A 5ELIA 4FFWC 1RFDH 4KJPD 3SJVA 1F3JA 3QEQD 3MOAL 3C8KB 3MNVA 1R5WB 3G6DL 2VDOH 1BBJB 2R4SH 1YEJH 3KYKH 3FQWB 1QKZH 1MCNA 2WZPD 3QAZC 1OT1A 4NNPL 1W2KT 5EOCJ 4K94C 3MLSH 5C0EA 4HWUA 4RQQA 1R5IB 4K3GA 4UV4H 4ZPTA 4AEEA 1A8JH 4YGAB 4Z7WE 5C0CB 1MCSA 1Z9SA 3NCJL 1U36A 5DSCA 4OV6F 5E2VL 5I9QC 1H3XA 4DKFH 3T0XA 4A6YA 1C5BL 4I9WD 3ZSTA 3QUMH 3V95A 3QPXH 5D7SL 1A02N 3GBLA 1HI6B 4E0RA 5HY9B 5KTEL 4DAGL 3HB3D 4FFZH 4ZQKA 4DZBA 4L4VE 1AD9B 3RWFA 4RGMB 5FO9B 4X7DC 1A0QH 4D0BB 2B4CL 4L3EA 5F89B 5HGHA 5I17B 3LV3B 2AJUL 2EDRA 1P5VA 1U8LA 2X4NB 2HFGH 5GZOD 4PGEA 3PV6B 2V5YA 3SKNB 2KQMA 1KTDA 4N9GB 4GRWE 2PF6A 4ZAKB 4FXGA 1NKRA 2DQCL 3H9SB 1TMCB 4FXKB 1VGKB 4YBLB 2X4RA 2IFFL 1JZ5A 3D25A 3ARDB 4I18C 3C5ZB 4HPYH 4IOFC 3MRCB 1JV5B 4CVXA 3BEVB 1G7HB 3TP4A 5E6YA 1T7YA 1NMBL 1DDHB 1JPGB 4PRDB 3P2TA 3C8KA 1BBJA 3FQWA 2CRZA 2J6EA 4JHWH 4HKBB 3T77B 3U9PL 4UTBL 3GMLA 1R5IA 5C0CA 2KL6A 1JI1A 4ZDHB 4QGTA 3G6JF 4K07A 1T0NB 5LBSL 3E6HA 1DCLA 4D9LH 3BGFB 35C8L 5IOPB 3MX0A 3SDDD 2Y5TA 4CMHC 5LKNA 4C56D 1IQWL 4LSUL 2EDLA 1DQML 3VWJA 1ZHBB 1HI6A 5I75B 2VDPH 3T0DA 1MHCA 5D1XD 4NC2B 2H32H 2RR3A 5CSZA 3S37X 4OZIF 1AD9A 1KLUA 3HC0B 3OG6B 3UTSD 3CNKA 4JM2C 5FO9A 4QO1A 1JPFB 1N5AB 5TF1L 3EYSL 3ETBF 3PDDA 4UOW0 3MCKB 5I17A 3BDBA 3ZDZF 3LV3A 4GMTL 2QEJA 2X4NA 3PWLB 3V7AE 5LAXA 3IRPX 3PV6A 4HFUH 2BNRA 5D7LE 4N9GA 4PRNB 4UNTA 3CMOH 5C08A 3EIFA 4ZAKA 2QSQA 3WDJA 4DW2L 2R4RH 4FFVD 3ZT5A 3H9SA 4Q9BA 2VLME 3MRPB 3WIHA 5HYJE 3GMQB 3X12A 5ICZB 3MRCA 1JV5A 1GOFA 1NLBL 3DHJA 5FYLE 4HULB 1RAMA 1T7VA 1VHPA 1DDHA 1JPGA 2PYED 2QLVB 4M1DH 1FSKB 4OCMC 4Z0XA 3T77A 2FSEB 5GSRB 3X14B 1H5BC 1ES0B 5J9PB 4ZDHA 3UC0H 1J1OL 1T0NA 4W68A 5IQ7H 3NCMA 3EDJA 2IEPA 1BQLL 2DKSA 4QRRE 4KI5D 1K8IA 2YD9A 3QEGH 1B0RB 1D5MB 2F74A 1ZHBA 1TIUA 4IEFB 4RAHA 4LGSB 4DUWA 2AQ2A 1GZPA 2VLKA 4G8FA 1PLGL 4HUXB 3UJTL 3O0RH 2F54B 2ILLA 4KRMB 2ZUTA 3WLWD 2V2XB 2ARWA 5I30L 3IJHA 1T83C 4X8JB 4ZFGL 3EOTL 4X7SL 1BVLA 1FO0B 3QUXA 3RWDB 1IKFH 5B8CC 3STBA 2RJMA 1UXWB 1YEIL 15C8H 5KVGL 1QLFB 5I74C 2R0KH 2DWEB 3IDNB 1DBAL 5CCKH 1AGFA 4CDGC 4NQDA 3MRPA 4U6XB 1CE1H 2P43B 3GMQA 3U30C 4JFHE 5DJYB 1JGDB 3MJ9A 2O26U 4GLRH 4XCYB 5EBMB 3W2DL 1CLOH 3GGWB 1TPXB 2OJZH 4HK3J 5EUOF 5JLZB 5I8CB 4B50A 1WWAX 2Y36H 2ATKB 3AFLA 4GS7B 4L5FH 2FSEA 5EA0L 4K23L 1ES0A 3X13B 3X3GH 4JFDB 5EU6A 5H2BB 1G7LB 1NANH 3QFJA 2JJVA 1D5MA 4PV8A 3IJYB 1MCWM 1JNJA 1QVOA 3JUYA 2R2BB 5GRXG 1KPVB 5JIIA 1Z0NA 4LASL 1IGTB 2V2XA 2GJ6D 1N6VA 3SJVE 4R4NC 5FAAA 4X8JA 1U6AH 4HCRL 5IESL 2FEEI 1FO0A 1JWSB 3LN4B 1YEFL 2XTJC 2FIKB 1YEGL 3BUTA 1UM4H 4R90H 1QLFA 3G6JB 3IDNA 2Y06H 1AQKH 2WBKA 4MQXD 5HHOB 1QO3A 4PS4H 3S36L 4X4YA 3MROB 3HMXL 1YPZA 4XCFH 1FVCB 3KWWB 1ORSB 1PKQE 2V7HA 1K4DA 4PJDB 4JG0H 5CBAB 1UJ3B 5FM5O 4XCYA 3EW3B 1UZ6F 4OZIB 2XFXB 1J05B 3FB8A 3BZEA 2WP3O 2VLRB 1YYMH 2ATKA 1NUFA 4L3EE 1J8HD 4AEFA 1UACL 3X13A 1SVZA 1XF4A 4U1MA 32C2B 5DJZB 3HE6A 1LO5A 4LOUD 4QTHA 3H3BC 4JG1L 4UNVA 2DIJA 2GT9B 3TZVA 4POZC 4NNPH 3BWAB 3NACL 5FGBA 3Q1SL 5MI0B 1G7LA 5F1OB 3PL6B 4F37F 3NCJH 3NCCB 1S7XB 1WAAF 5HVHB 1CR9L 3OKOA 4ODSL 5DR5L 3X17A 1Z9OA 1IZJA 3QNYB 1AGEB 1YEEL 2CKBB 1NDMA 2R2BA 2UVEA 3RTQA 1C8PA 3KPLB 1KN4L 1EAPA 1TCRB 3DMMB 1KJVB 1IGTA 5DO2D 3PDOA 1S7SA 8CGTA 2FX9L 3CGTA 3CSYB 3FQTA 4WTXA 5DD3L 5TDNB 2VXVH 1JWSA 3CPLA 3LN4A 4GKZA 4KDTC 2HFFA 3HE7D 1ADQA 1QR1B 5C0CE 3PQYB 3JWDC 1WFNA 2NY1D 3N1PC 3UTTD 1NQBA 5TDOB 3MROA 1LE5A 2GJZB 12E8H 4WI9A 5C1MB 2D31B 1BX2B 3NFNB 1FVCA 2DQCH 3KWWA 1KV3A 5HD8D 4PBWD 3DV6B 4POYA 4TUJB 3MZTA 1SYSB 4PJDA 1UJ3A 5F6HI 2XFXA 5GS2D 3ZLQC 1CFQA 2VLRA 4NN6B 1JNHA 2FB4L 2KPNA 1DQJB 4ZODA 4BK5A 32C2A 1JPSH 3NN8A 2C1OB 3IDMB 4XBPB 5C08E 3U9PH 2WANA 1NCDH 4NGHL 1LILA 3VGHA 1EFXA 1L9MA 4HW6A 1S7XA 3MQIA 3H9SE 1EVUA 3T0EA 4M9OA 3P0GB 4YE4L 3PABB 4NO5A 3RVVD 4GW4B 1SBSL 1E4WH 1WTGT 5TE4L 3BXNB 1IQWH 2Y4SA 1DQMH 2DMKA 2NTFB 3KPLA 1OCWL 2P49B 3SBWC 1AE6L 5DD0H 1TCRA 3DMMA 3HNVH 4XPTL 4KROB 2F5BL 1DUZA 5C0AD 3SKMB 1MNUL 4O2FB 5TDNA 1F42A 2FATH 4Y88A 5ITBH 3EYSH 1MUJA 3MOBL 4QY8B 1CD1B 4IIQC 4GMTH 3Q5TA 1QR1A 3GHEL 1XCQB 1F45A 3PQYA 1KIQB 1LO4H 4WFHE 2FRGP 4WVRA 5TDOA 1IAOB 2D31A 1BX2A 3NFNA 1N26A 3L95B 5FYJU 4DWHA 3BN3B 5L7XH 3BP7B 3L6FB 4LP5A 1HIMH 3VG9B 2EECA 4HFWB 3DV6A 1SYSA 2VAJA 5I8OH 4ZO9A 3ZT7A 1UENA 3VXTA 1U91B 4P2OB 1ZVSB 3LEXB 5K9JH 1IEHA 3UX9B 1NLBH 4P0DA 3NCFB 1WC7B 2XKNA 4LLWA 2FEDD 2DJUA 4OLVH 3QDJA 4ONFL 4EQ3A 2C1OA 2CLVB 3MBEB 1HHIB 3BHBB 3SDCB 1FLTX 1YN7B 5DI8B 4WUUB 2EXWD 2DKUA 1J1OH 1XFPA 3RDTD 4DJMA 4JRYA 3MA9H 4OIBA 4D0CB 1XEDA 4LIQH 4X8XA 3L3JB 3V4VL 3OJ2C 4GW4A 1MRFL 4MAYB 2NTFA 5GRVK 3I75B 3EJZC 5ID0A 5L9DL 4H0IA 3O81A 2CSPA 1MCDA 2N7AA 3DYMA 1PLGH 1FPTL 1T1YB 1I7TB 4O2FA 4OD2A 1OGAD 2FBJL 1D9KD 3MLXL 3UPCA 2Y72A 5M7QA 4QY8A 3VFMA 3Q6GH 4N8VA 1ZE3C 3EZ8A 1MAJA 1K3ZA 1XCQA 4WI2A 2A6JA 2NY3D 4Y16D 4PJBA 2OL3B 1IAOA 1YEIH 2AKRA 3BGAA 3VFUB 5GGTL 4JN2B 4HEME 3L95A 3DROA 3UPRB 1H0DB 3BP7A 3ZL4L 3L6FA 4H25B 2ID5A 2VLJD 4HFWA 2GSIB 1J9CT 5HPOA 4O02L 2MHAB 4FQXD 4OV5B 1U91A 2Z91B 3LEXA 1H15B 3ZYZA 5ESQB 4N0YL 2F54E 4OQ1A 5F70A 3QHZL 4WV1C 1P4IL 1GGCH 3W2DH 3S5LB 4GSDH 2ERJC 4AIZB 2FECI 3MBEA 4GFTB 3CCHA 3SGEI 1HHIA 4P5KB 3X11B 5EA0H 3SDCA 1OP5H 1I7ZB 2IC2A 1ZHKA 2E9IA 3CFKB 3V0WL 4XNUL 1KPRB 5AD0B 2HVJB 2YD5A 4MB3A 2Q7YB 2PW2B 1SHMA 5IHBA 5ACMA 5JDSB 3QDGA 1F4YL 3L3JA 3OXRB 4TVPD 4TQEH 2VQ1A 5GGVH 1FNHA 1U0QA 3KNBB 2WUBH 1QHOA 3RVTC 4MAYA 4QT5A 1YYLH 3DSFH 5EUKB 4MJ6B 2MCG1 1GIGL 3A67L 4U1SA 1T1YA 3TWCL 1CFTB 5E8NA 5KANI 3EJYD 4N1EA 5C09B 3O2VL 3MGTA 4D3CH 5CJBA 3I9GL 4JFDE 4KAQL 1YEFH 3LEYH 2OL3A 4JN2A 4OF0A 4PRIA 3H42H 4P2RD 5EIQA 2NLJB 4YDKH 2UYLB 3BVNA 5C0NC 3UPRA 1SMOA 3HHRB 4TTGA 2AGJL 1SJEB 5DGRA 3QXTA 4JO2H 4O4YL 1XGQB 2GSIA 4OFKA 4KK5D 3WJLC 2EDYA 3CJJA 2Q76B 4XNYH 4FQCL 2MHAA 1G9NH 3D3VB 3D85D 3N85H 5ESQA 2VERN 2ZKHH 4EDWL 3MRNA 3OL2A 3RU8H 3KYOB 5IKCB 3UBXA 5JOPE 1FG2A 1LO0H 3WD5H 5C92A 3A6CL 3S5LA 4YK4B 4TSAH 2BMKA 4AIZA 5BRZB 1KLFA 2VLLB 4U1GC 2YC1B 1FFOB 1F58L 4WFFD 1UACH 1I7ZA 2D0HA 4BELD 2HVJA 1OSZA 2PW2A 5HHOE 3VXPB 3UCRA 2DM7A 3SCMC 1INDL 1G7PA 4W4OA 1KB5B 3T2OA 2G60H 4P9MH 2R9HD 1RZGB 5AYQA 4WHTB 5KW9L 1F11A 1BFOA 1VESA 5T3ZE 2H2PC 5DR5H 3EZJB 4PJDE 3C9NA 3G9VA 2X4UB 5EUKA 1Z6JT 3OTTA 4YDJB 3RHWF 4OZIE 1SMAA 3LS4L 4MJ6A 4LCCB 1MFDH 2VLRE 3EYFB 2VSDA 4JB9H 2VQTA 3LQZB 1QFWL 5D2NC 5C09A 2VZSA 4QLRA 2XRAL 3UJIH 4I18A 3QCVH 4KKAD 5FOBA 2ZCLL 3BIKB 4WU5A 3FJTA 3NVQA 4KV5F 3WMSA 1YJDH 1SJEA 5HI5C 1TZIB 3DXAD 3GRWA 1XGQA 4ZFOB 2ED7A 4PLKC 2VDLL 3BKYL 3D3VA 1P7QD 3T08A 4M9PA 4NZJA 3K80A 4G7VL 2BY1A 4Z95L 3KYOA 4RA0C 4RGOL 4XPFH 2F8XC 1FH5L 4BZYA 5CD3B 5JPNB 3FOLB 4OD3H 2YC1A 4PJCF 1FORH 3U4BL 5DEGA 4BH7B 1U3JA 2F19H 3PQYE 5K9KA 2DD8H 4X5WB 4WW2C 2IAMD 3TIDB 4YHML 4JM2A 2VZTA 1KB5A 4NGHH 5IHZB 1MRDL 1ORQA 4XB7A 2UY6A 3HI1A 4NP4L 5DVNA 4WWKD 1FAKT 3LEVL 5CHNB 5HYEA 2X4UA 4HUNB 4YDJA 4PYGA 1OAZH 3VDBA 3NCYS 2DQEH 1ZLWH 2F5BH 3ZKNC 3MOQA 4NSKB 3TN0C 3HAEB 5CFHA 1J18A 4KJWD 3CK0H 2BVQB 1OOAA 8FABB 1TTUA 1BPVA 3MCG1 3BIKA 1CU4L 5CIPA 1I4FB 1E6JL 4CU6A 2C1PA 4WI5A 3WV0A 3BZFB 2MPAH 4JRYE 1RHFA 4ZFOA 3ILQD 3BQUC 1EK3A 1SEBB 4KY1L 1A3RL 1RURL 3GMNA 4XX1G 5AZEL 4XWGH 1Z3GH 1R3KA 1DANT 1H5BA 2YA0A 5ENWB 3C8DA 4X4ZA 4MNHA 1W72L 3OHXB 3HPJA 1Z5LA 3L7EB 4LVNC 4U7KA 1YECL 4ZNEA 5CD3A 5DHVA 4DGVL 1J0IA 3V4PL 5FUCC 4G6AD 1QBLL 2ZCKL 5T1KA 3QCUL 4ONFH 1IILE 1KACB 2MQ0A 1KJ2L 1KJ3H 2YD1A 2FIRT 4HC1H 3VA6A 4EI5A 4K55A 3TIDA 4M93C 2PO6D 4JRXD 4PJFA 3JVGC 2J5LB 4FP8L 2JJSA 4ZOAA 4J6RH 3VU2A 2C4FT 1T83A 3P4MA 2OMBA 1D5IL 4IRJB 5F9DC 3FT2B 3AMLA 1I8MB 4IDJH 3EO0B 4OGXH 1M7IB 1MRFH 5B8CA 3W39A 1I9IL 1SY6L 3ARRA 2ZUXA 4JFFD 5IMKB 3F58H 1U3HD 1F4WL 3TFKC 5I66A 5JMRA 4NSKA 3VXUD 1IC1A 5L0QB 3HAEA 4S1QL 2XZAL 2QV2A 2ZZUT 4PJ5A 3V0VA 2FBJH 3GSUB 2BVQA 4UNUA 8FABA 2QSVA 1J8HB 4PJHF 1L9NA 2O5YL 4WUUE 2D7MA 1I4FA 2HKFH 3QDMD 3G5VB 3DHMA 4UV7L 1PYWB 2BSRA 1RVFH 4DGIL 4G8GD 3CLFL 5GGTH 1SEBA 4J3OC 3G08B 1U58B 1ZA3B 4APQB 4K2UL 4OAWB 3IS0X 1HYSD 3U6RB 1R3HB 1UZ6E 5GS2H 1BJ1H 2X1WL 3VI4E 2VQUA 2AW2A 3DUUB 3W0WA 4N0YH 4K9EL 3RZWA 1AC0A 5CD5C 1WFUA 4GJTB 3QHZH 5HDQL 1S9KC 3KXFB 2R0WH 2NPLX 3KJ6H 3H3PL 1JUFB 3I85A 3WLBA 1RUAL 1OY3B 4G9DB 1BIHA 1BOGA 3NCEB 5D6CB 1UXSB 3DVFA 5CGYC 3RUGF 3V0WH 4PD4K 6FABL 4YLQT 1JWUB 3TBSB 1OP3H 3QPQC 4HG4K 1F4YH 2DM4A 3FT2A 4JZJC 2VDKL 4PBVC 5KSAC 4FQ2L 2AJYL 4YHOH 5F9OL 1T5WB 5IMKA 2IPUK 2BC4B 3DBXB 2DBLL 4FMKA 3HUJA 1MJ7L 3KYAA 4Y5VB 2CR3A 5H35A 4M7ZB 3CX5K 1CICB 3GSXB 1X7QB 3BP5A 3PNWB 4CKVX 5E2TL 3EDFA 4PJCB 2VDQL 3E0GA 5BW7C 1G9ML 3WN5C 5FF6A 3I9GH 2I60H 3W5NA 1IGIL 2CDGA 3G5VA