4F3FB

Crystal structure of msln7-64 morab-009 fab complex
Total Genus 42
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
42
sequence length
220
structure length
220
Chain Sequence
EVQLQQSGPELEKPGASVKISCKASGYSFTGYTMNWVKQSHGKSLEWIGLITPYNGASSYNQKFRGKATLTVDKSSSTAYMDLLSLTSEDSAVYFCARGGYDGRGFDYWGSGTPVTVSSASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVEPK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Recognition of mesothelin by the therapeutic antibody MORAb-009: structural and mechanistic insights.
pubmed doi rcsb
source organism Mus musculus
molecule tags Immune system
molecule keywords MORAb-009 Fab light chain
total genus 42
structure length 220
sequence length 220
ec nomenclature
pdb deposition date 2012-05-09
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4f3fB01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4f3fB02
2XQYG 2P5ED 3AY4A 4ISVA 4M7LH 4PRDA 1MJUH 1RK0B 4RAUA 5DJ2B 4M6ML 5BS0E 1LE5A 1DVFC 4IHOA 1WZLA 3OTTA 1IGYB 2O5YL 4K71C 1QHPA 2A6KA 3FZUC 2OYPA 5ITBL 5HYJE 4YXHL 3NCJL 1YY8B 1JNJA 3MGOA 1AQDB 5F8RC 5T5FH 5MERA 1N64L 1HQRA 1LD9B 1U92A 3MRNB 3P4NA 4G3YH 1I8MA 4LPVA 2DQCL 3TZVB 2ADFL 2ICWI 1BQHB 4GBXC 1KB9J 1RSFA 3I6GB 2PYED 3EOTH 4HIXL 5HYQA 2VXVL 1FNGA 3QPXL 1TZHB 4NSKA 5AWNH 2MKLC 1GC1C 3H9SE 4NRXB 1ZEAL 4YHZL 4EOWL 2ED8A 1MSPA 2GSGB 5J6GB 5B38G 3I75A 2KQNA 5L6YH 1D5IL 1BX2A 4LCCB 1RZIB 1T7YA 1AO7B 3NGBB 4HXAL 1A5FL 3D0LA 1K3ZA 2VDQH 5CGTA 2IPUG 1FJ1B 4U1JB 4ZXBC 4E42A 2VZ1A 1RULH 4C4KT 4FQLL 4G6AD 1JF5A 3KHOA 4TPRL 4JG0L 5C0RL 2NY4C 3T09A 5JW4R 3WFHA 1FZKB 2RCSL 4ODTH 4XBPA 1OT1A 3CXDL 5DQ9A 1XGPA 1UWXK 3L3GB 4JGMA 2HTKC 4J3VA 4IRSD 3QQ3B 5A2LH 4QCIA 2VXQH 4G6FD 2ADJB 3P73B 2F54D 4AK1A 5GIRA 4Y19E 4AH2B 4XX1E 5D7JB 3F58L 3WS3A 4M6OL 3A6CH 4ZUTA 3QDGA 3I6LE 2DYPA 2UV3A 5TDPB 1A1OB 3P0YH 1GPOL 1CT8B 3D5OF 5F1NA 2BVYA 1MCPL 3EO1B 4NKIL 3WO4B 5ADOL 5J9PA 3DX7B 2YPLA 3MGTB 1MVUB 2NNAA 4MD4A 5ICXA 3C5SA 4N1HB 3GIVB 3NCBB 4OGXL 1IC4H 2GJZB 3ZE0E 3N85H 1IFHL 1YYML 4DGYL 4YHLH 1WBYA 4RRPA 1P1ZA 2ED7A 1EK3A 3MGOB 1KULA 1J1PL 3GBNL 3CFDB 2J6EL 3GJFK 3DBXB 2XFXB 4OLVL 2YC1A 4P57B 4AIZB 4QRRD 1SJVA 4CMMA 1DFBL 4XC3H 5MP6L 4U6XB 2Y7QB 5BVJB 5IIEB 2WIIB 4YDJA 1P6FA 4L3EB 4I18B 4NHUA 5CSZA 5EBGA 4P99A 4AEHL 3DUSA 3QUYA 4DEPC 4E41E 1FNAA 2EYTB 4KZEL 4A6YH 3OXSA 3H42L 4P5TD 1T20B 3RUGE 4M48H 1YPZF 5HHNB 2DKUA 3DX6B 1KBGL 3OKEA 5FO7A 1LP9A 4U1GB 3JV0A 1ZGLP 5IESL 2VZ3A 1X44A 2X4TB 1DL7L 3QUYC 4X7EC 4R4FH 4NJ9H 4PJEF 1PVHA 3TFKD 3SDAC 1BWMA 2R2HB 1A7PH 4I0PD 4OF7A 2D7TL 3I50L 3GSVB 1NLBH 2UZIL 5MEPB 3SGKC 3MRPB 1IZKA 3RWEA 4Q9QH 1SEQH 1YY9C 4WI8A 2A9MH 2COQA 2DDQL 2OTUB 1AXTH 1T89A 5FIEA 5IMOA 1E4JA 1FBIL 2NY0D 2Y06H 3WLWD 5SWZD 4PG2C 5I71B 3HNTH 1JHTA 3ARYA 4WJ5A 3SQBA 4EI5A 3VXPB 1SBSH 4YJZL 1NC4A 1CBVL 3HR5A 5BXFB 1PYWA 3CLFL 3QJFA 3FQNB 5I1JL 4PV9B 1KIRA 1A6UL 3U4BL 4X0KB 4TSAH 4NQEE 1LP9E 3KG5A 3VD3A 5EULV 2YWZA 1CICD 4CDHA 3DURB 5T3ZL 1BFOB 1INEL 1U42A 3HHRB 3EDJA 2R23B 5HYJB 3NTCL 1JUFA 5E56A 1OGAB 5GGVH 1T20A 1MNUH 5IG7A 3MO1B 4YHOL 3IDIB 3VE0A 2A6DB 4P9MH 1ZGLM 3DTXA 2GITA 3U9PL 2DI7A 2ZJSH 2V17L 3JWDL 2H9GB 3WIHH 5J11B 1U8JB 4LHQB 2X1PA 1TJHL 2VITB 3DSFH 1R3HA 3THML 3U2SA 1AY1H 4LSRH 3GNML 1KJVA 4LAQH 4HUVA 1T6VN 3H9SA 1UENA 3O2WH 4WENB 1IC7H 1XGUB 5I1GH 5D6CA 3QRGL 1JF1A 4OF5A 1EFXA 4ZTOL 2APBA 2CIKA 5C0EB 3GRWA 4G43B 5DJ0B 1Z0MA 3QDME 1J11A 4FQHA 4OZHE 4P4KC 3SCMC 1VFMA 4I5BA 1BVLA 1BQHG 2PTTA 5E6YA 3QUZD 3D69B 1G9NL 4R4ND 5JW3L 5L0QB 3TBYB 3IFLL 4TRPL 1WLHA 4RIRB 1RUAL 1H15B 1P69B 5EBLB 4OFYA 5EUKB 3M17A 4KY1H 4Z7QE 5I1DA 3UTPD 4R4NC 1ORSB 2YXMA 2H1PH 1LE9A 2VDML 3PGDA 4OZFG 2IANB 4LASH 4PP2B 3VFUA 4GUPB 5CZVH 1S7XB 4PJDF 5B8CA 5J13C 4M61B 4N0RA 3RIFK 4HDIB 2YPLB 4MD4B 4MNGB 2P43B 1EZVY 1P7KB 5CEXB 2VDOH 3ULVL 1RY7B 3MLXL 1ED3B 2VLRD 4WUUA 4KKNA 1D6VH 5DS8B 1R5IA 2AEQL 2WZPD 2GITB 5DZOA 5ESAA 3WJJA 4U1IB 1ZT4A 5HVFB 2XFXA 3REWB 3P73A 3GMRB 5IJKA 3NPSB 4LF3A 5D1QB 4IIQB 1QLRA 3GSRA 1KPVB 5FYKH 3MXVH 1TITA 4KQ3L 4XVJL 1GGBH 1Q72L 5H37G 5A3IC 1HYRC 4TUKL 3BN9C 4MLIA 4FXKB 5F7KC 4TSCH 1RJLB 1WWWX 1MRFL 4RWHA 1P9MC 4LKCA 3TBTB 1PKQB 2B4CH 1KJVB 3DGCR 2VZUA 3C5SB 4JO4L 2P45B 2OSLB 4AG4L 1NDMB 1N7ML 4MAYD 4WY7H 4GKSA 3MLUL 3QWOA 1MWAH 2DLGA 2IMNA 3S36L 4R7NB 1TZGH 2XY1A 4JDZB 4JQIL 4PYHA 4EDXB 1VHPA 5C7XL 1NCTA 4GOSA 1EHXA 1S7WB 4GXVH 3IDJB 4H5SB 5FHAL 3B43A 5HPMA 5ALBL 4GAYB 4BH7A 3B5GA 2HVKA 4G8GD 2I5YL 5IB2B 4U3HA 5I8EA 1AR2A 3HMXH 3HR6A 5ICYA 3SDYL 2R0ZH 3EJZD 1G6RH 3ZKSD 2ADGB 4HIHB 3QFDA 3AU1B 3UTSD 3UTTB 4APQD 5HI3D 4NZRH 4D9LH 5IHLB 4PJGB 5T5NG 1DBAH 4OZGF 1X6NA 3WJLC 1I85C 2NQCA 3EZ8A 2G75B 1Y6KR 5GGTA 3OBAA 1IAMA 4P2RD 5JOEA 4PLJD 4KK5C 4TQEL 3U7WH 1I7TB 4OT1L 4WWKA 1CGTA 4XNYH 1JPTL 2YUXA 3SKNA 3PF2A 4D9RD 5F97E 2J8UE 2FEEL 4LHUG 4GBXB 5B3NA 3QHZL 4DK3A 1RIHH 43CAB 3OMZA 5HI4D 4P5TC 1G7MA 2W65A 1MI5A 4NO2A 1U8NA 4PY7B 3MMEB 1KOAA 5I2IB 4R97C 5IGXH 3BAEH 3VXME 4JY5L 4LSQL 1GOGA 3SDDB 5K9QG 3GHEL 1V7ML 2QQNH 4Y16D 3ES6B 3QB7C 1LDSA 1A6AA 4QXTA 2PYEB 4JRXA 3WXVH 4KKAC 3QUYD 1G0DA 3VCLB 3I9GH 1S7QA 4POZC 1T66D 3KPPA 4XNQB 4P2OC 3RWHB 3F62A 5E4EB 3HCVA 1J8HA 4UTBL 4UOW1 5DD3H 1JMXA 2CLVB 2NX5B 3JV6B 4PJ5A 1AP2B 4GAFB 1MH5A 4HT1L 3VFGL 4LRIA 1G7IA 4DKFH 2NXYB 4EXPX 3VXUA 1BQSA 1MCIA 4PV9A 4NO3A 1C7SA 4J12A 3H3KA 5IF0B 1IAKB 3Q6GH 4FFYH 4LDOB 4M9OA 5A1AA 5I0ZA 3HRPA 4ZG1A 4UV7H 3C60A 3BP4B 1S7SA 4GAJH 3TA3C 2E5EA 1GZPB 5JOPE 5ESVB 1JGEA 1U3JA 4KPHL 3F5WA 4OAWA 4JLRA 3C09B 4WEMB 4MNQE 3FT2A 4HUWB 2EDEA 3IS0X 3NABH 3VXRA 2KDGA 1UKSA 1V3JA 4MNHA 3TFKC 3BZDA 3RIAF 4Z8FL 2R56L 4JFHD 1C5BH 3V0WH 3FT3A 5CJXA 1F97A 3SQOH 2ATPA 4NBYB 1DVFD 2FX9H 3V95A 4X6CA 4RA3A 1CL7L 4TSBL 3LVEA 2Q7YA 4MJ5B 4J7RA 2XTJD 1FYTA 1V3MA 1H15A 3I6KB 3RVUD 2OR7A 3AROA 2QL1A 3CXHK 2VIRA 3KWWA 3W81A 4N0CC 2VDNL 2C7UB 4LLWA 4YEEA 4MA8H 4F15B 4NKQB 4BQ8A 3QEGH 3HG1E 4GUPA 1XF4B 3VGGA 2EE3A 2EXWC 3V4PH 3DX8A 5DJ0A 4HIEA 4GW4A 1PZ5A 3B2UC 1OQXA 3X3FH 4D0DA 4KXZI 3RJQB 3MZTA 4PTUB 4RFEB 5EUOE 2GT9B 1RURL 3V4UH 4RAVB 2B2XL 1UZ6E 4HLZH 1MH5B 4O5LH 4MA1C 4DN3H 5ILTL 4IRJC 4PGBA 2AXHA 5FHBL 1TCRB 4Z77A 2CO6B 3FKUS 3M17B 4IJ3C 4OLEA 5AZEL 2B0SL 1JZ2A 1LK3H 1T89C 1EEQA 3GSNL 3NFPA 1CGVA 3U0PA 2MCPH 2OJEB 3B9KB 4FXKA 5C0GA 1ND0B 4X7SL 1FYHB 4IMKA 2ZUTA 2WANA 5E94A 2UVEA 3TO2B 4J3WA 5GS0L 1WUNT 4PLKC 1A9BA 4PGCA 1FNGB 1P4BL 4RGMC 4BQBA 1Q1JH 2VOTA 4JY6B 1G7HB 1W72L 3MV7A 1EIBA 4ONGH 5ANME 3TN0C 3DRTB 3WFCH 3C6LA 4HC1L 5FGCB 3MGTA 5DJCA 3HI5L 3HFML 5HYQB 3VFSA 2MCG1 1E6JL 3QIWA 2K7PA 4YH6A 4YHYB 4P46D 4S1RL 4XWGL 3H3BC 4N8PA 4JFHE 5C08A 3O41B 3RWJB 1OTSD 4OUOA 4NO5B 2DM2A 3NCYS 4JFQA 5CUSH 2Z31B 4HG4K 4MJ4A 4JFFD 5K9QI 2FL5B 4KXZH 3HC4L 4XC1L 4GG6B 3LD8C 4QTIH 3T3PE 1JP5A 3IU3B 1FZKA 1NAMB 1IAIL 1PY9A 4PJBB 4DZBB 1PG7L 4GMTH 5F88B 5L2JB 2P8LB 2Z91A 3C5JA 3X12A 1UACL 5HYFA 1TLKA 4NGHH 3STZA 3HB3D 2X4NA 4AMKH 3G6JB 4ZSOE 4DFHA 3RHWK 1YQVL 4NBZB 1N0XH 2MPAH 2BZDA 2NY3D 1OARL 4G3YL 3RJDA 2CUIA 2GTZB 2ADFH 3OAUH 4YDLC 3U30C 3ZTJG 5IVNA 5F7LB 5DHVH 4M7JL 3OWEA 4NQDB 4TTGA 3RI5K 5F7YC 2AJXH 3PGCA 4NC0B 1EPFA 3U82B 4B7IA 4DOHE 3B9EA 4I1NB 4GW5A 3W5MA 3PNWA 1ZEAH 4WIQA 2WWMD 4M4PA 3VXQB 1KG0A 4KMQA 3MV7B 4LHUD 5IROC 4XCYA 1B0RA 4GS7C 2VDQL 1YNTA 4G8EB 1DLHA 4X6CF 5IT2L 2H32H 5DO2C 1X4ZA 1OTTC 3FFCB 4LOUC 4LSUH 1S9WB 5JNYB 1FLRL 4JDTH 3OAYH 3M8OH 1F4HA 2BSED 1YECH 4JKKA 3OJVC 1JZ7A 4M5YH 3RVWC 1TENA 2BOCA 2EDBA 4I9WD 3MRQB 4CAGA 4FQPA 4R3SA 4C57C 2GJ6B 5JDSA 5I75B 5HVWA 3RWCA 3EW3B 1QFWL 3QDMD 1DQMH 4HPYH 3BDBA 3DX6A 1HDMA 4LVHB 4U6YB 5C0BD 4D0CA 1HWHB 5J1AB 5F7WC 4P59H 5TPWL 2MOVA 2VH5H 1GPOH 4Y5XB 5E2JA 3MROB 3BT2H 1NGXB 1T80A 4YZFE 3IDXH 1UKTA 4G9FD 1UKQA 1FCGA 1NEZG 1DBML 4NZTL 5EO0A 5F1IB 3C5ZB 5D7SL 5K9KB 2PCPB 4G8GE 2RFXB 5IEKA 5I16B 3T0EB 1KELH 1H8SA 1NCCH 3WS6A 4WI7A 1J0IA 1CYGA 2ADIA 1WCBB 1RJZB 1I4FA 1AXSA 2ZOKB 5TDNA 4KFZC 1HYSD 2F53B 4K3DL 4M7LT 5IB3A 1I1CA 4PIRF 3IJYB 1RJCA 1TJIL 1Q9LB 1QG3A 2FGWH 3HE7C 2K1MA 1DLFL 3KYMB 1SY6L 1NCDL 3RVVC 3SJVA 4X9IA 1YN7B 1A6PA 4JM4H 1GZQB 3O8XB 3GSUA 1T1WB 3RI5F 1EO8L 1YEJL 3PDOB 2OMNA 5BV7C 2DQHH 1IQWH 1GC1H 4CN1A 3TA3D 1J0HA 4MZ2A 4F80A 4C56E 3GI8L 1DL7H 4WWKC 3NN8B 4NN7B 1MFDH 3QPQD 3QCUL 2WUBH 35C8H 3RBSA 3MGAA 5F7EH 3WHE0 4F9LA 1NFDF 3MRRA 2VSDA 3EO9L 1EV2E 3VXRD 5DK0A 1KCUH 1NQBA 3DV4A 1FP5A 4ALAH 3CUPA 3O3DA 3U6RA 1P1ZB 1S7TB 1HDMB 1C16B 4F7CA 1UM4L 5CMAA 5C0FB 1WICA 4ZUSA 3RY6A 5SWSE 4QCIB 2OM5A 5D6CB 1KTRL 4MQ7A 2BVQB 5E6IB 3VXMD 1D9KC 4WCYL 2J8UF 4XCCH 2BJML 1MF2H 1H3VA 1T5WB 4PREB 2CXKA 3ZT7A 2EDLA 3BP5B 3SKJH 4MDIB 5IW1B 4RGNC 1I9RH 5ID0B 4GG8B 4GKNB 2Z4QB 1KUMA 1ZS8B 5FGRA 3OB8A 5DVOA 3QAZC 4RFOL 1BLNA 2VLKD 3GK8L 2EKSA 4XNZC 5EU3B 5IK3B 5IBLC 4GW1A 1BWWA 2DN7A 5FYJH 3S8WA 4JPKL 3BP7A 5EBWA 2QSTA 4L8SC 3K2UL 4X4XB 1I3GL 3N1MC 4Q58C 4M1GL 4YDIL 1KF9B 3MLRH 5HHXH 4PJIE 3EDFA 3CC5B 3RDTD 4ETQA 1JYNA 1ZKAA 3QEQB 4JM2D 2CD0A 1KC5H 4NNPL 5C0DA 1BOGB 3G6JE 4ZSOB 1NFIA 2LV4A 3Q3GB 4PRAA 5CEZD 5EN2A 5IV2A 4LCIL 1LK2A 3D3VB 3RZCB 3MRCA 4TVPE 5JHDA 2DS4A 5ECJE 2E7LA 5ESQB 4EIGB 1QSED 3OKEB 4JZJC 2DRUA 2BNRB 3Q48A 5TDOA 1H8NA 4M6NL 2FD6H 1T83A 2HVKB 4KI5D 3RX7A 1HNFA 4B50A 3MLTB 5HGAB 4KTYA 4OGYH 4KGLA 1KLGB 3FT4B 3DETD 3SDXE 1HHJA 4JPVL 1T6WA 1F3DJ 4OB5H 1C16A 4F7CB 3CSBA 3GSVA 4NZJA 1PSKH 5B38A 1KIRB 3T0EE 1OSZB 3QWQB 3ELAT 3TPUB 1LO2L 1RZGA 1I9IH 5F7HA 12E8H 2R0KL 4Z7VF 1QPPA 3L3OA 3TBWA 1LO5B 1UXWA 5SV3A 1ES0B 4JFZH 1RJLA 4M1CD 2Z0BA 2I9TA 2ITDB 2BNQB 5F9OH 4PY8J 1KB5H 4X5WB 4PLJC 3LAFA 4YIQB 5EZOL 1UXSA 3NZHL 1CTNA 1BGXL 1JCKA 5EZIH 5ID0A 4HC1A 5I1EL 2YMXL 1G9MH 5KSUB 2MHAB 1KJ2H 1ZHLB 1XGYL 2DLIA 4QRTB 2XZQH 1DZBA 5C0CD 3FQNA 3VXRE 2I07A 1W72A 1N4XH 1NJ9A 5I76B 3WHE1 4PJ9C 3HNSL 4L29B 3FONA 4LSDA 1KT2B 3FO0L 3S35X 3IDJA 3N9GH 5JPNA 1G7QB 4YK4B 5E4EC 1DQDH 1EEYB 3OAZH 3WKNA 4Y5YA 5K93A 4P4RA 1JGVH 1T1ZA 2XZAL 1YN6A 2ADGA 5F7DA 2QKIB 2I27N 4ONHA 1F13A 2R1WA 2GJ6A 5JDSB 1NANI 5KSAB 4ZPTA 3SE4A 5M7QA 2G2RA 1S7VA 5J1SC 3G5ZB 4PJGE 1U8IB 3V6ZB 4QKXB 4A2LA 4KC3B 2C3XA 3ZKXC 1J9CT 4JO1H 3VH8A 2DLEA 5C2UB 5HGAA 4E41D 4X4ME 3U36B 3W2DL 4RMWA 3MLSL 3LKNA 3O2VH 1D9KD 1PKQE 2UZXB 1DQLL 4K3GA 4P3CL 3WHXA 3NCCB 2DTML 1AGCA 4UNTA 2DBLL 4OBRA 2HH0H 1X5XA 2ZNXA 2EIBA 3RTQB 1GOFA 3EFDL 4G6JH 3S36H 3F12A 1MJ8H 2LVEA 4RGND 4BUHA 1OAYL 1T5XB 3O3BA 4Y89A 1IM3B 1FFPA 4XMKH 3KLHC 4FG6C 5C2BH 3QDGE 4GAGL 2I5YH 2WK2A 5EC1B 2B5IC 4GG6E 4LIQE 4BM7A 5L7XH 3RWHA 3LHPL 5TE7H 2R0ZL 3I6GA 1HIML 3ARQA 3IXAB 1PKOA 3FRUA 1FZJB 3DIFB 1YJDL 1ZWIB 1RQ5A 3TBYA 1L0YA 1RD6A 3ZT6A 4MVBC 4XP6H 4WGWB 2GSGA 1PEWA 3F5WB 4RMUA 3FOLA 5HGDB 5E95B 1YMME 3OR7B 2P8PB 3OHXA 4P46C 3VFUB 5B8CB 3QHZH 2DQEH 3IYLW 5DMYA 4JFOA 4MJID 3QXAB 1EZVX 1M1SA 3L3HA 1QFHA 3VFOA 1QUNA 4OI8A 5TE6H 1HOCA 1MCCA 1AE6L 4KI5E 5DJ2A 1T03H 4JR9H 1D3CA 1KTDA 1QFOA 3U7YL 3WN5C 3QDGD 3U0TB 3DARA 1G84A 1YY8A 1MCOL 4X4XA 5FYLE 1RMFL 1QBLL 1Z9OA 2HAZA 5B39G 2UUDH 4YPGA 2WUCL 4AEFA 3HC3H 4GSDL 1KIQA 5L8KB 3HPJB 4EZMA 1S3KL 2NTFA 1MIMH 3SJVD 3HRZB 1R3IH 1LILA 1OM3H 3UDWC 3GBLA 4DN4L 5I8EB 4GLRH 1PG7X 1FVEA 4C56D 4ZO7A 5I19L 3IGAB 2FX7L 2M26A 1VPOH 4D0DB 2FJHB 3OKLB 2P24B 4F8TA 3LV3A 4W4OA 3KPTA 3TNMB 4P5MB 4PGDB 1A9EA 3KYKH 4OQTL 5FYJE 2HFFA 1FZMA 1FRGL 3SE3C 1KYOK 3C2AL 2XA8H 4NQTA 1A0QH 2OJEA 3MCLL 5FA3B 4HBCH 1DANU 2VRAA 3PGFH 2QHRH 4H8WL 4YBQD 1ND0A 2BX5A 2O5ZH 3V5HB 5MENB 3S3PA 3NIDF 5BW7C 3L3IA 4OCMC 1D6EB 1VCAA 2PNDA 2VKXA 4K8RL 4P48A 4PRHE 1AKJA 5HVHC 3QFDB 3T4YA 5GGTL 1XGQA 1LP9B 4NQEB 4K71B 3O6KL 3OR7A 1G6RA 1DEEA 3LD8B 3RDTC 4XP4L 2QBWA 4OGAD 5EH1A 4I0PA 1A1MA 2J8UA 1HSBB 1CL7H 2G9HA 2QSCH 5JXED 5C1MB 4QHUB 4CJ1A 5KVGH 2Z92A 4MAYC 1A3QA 4WFHE 4IOSD 4R0LB 3ROLB 3HS0A 4MHHI 2AERT 2MHAA 3V7MA 3VFVB 3PHQB 2F53D 3G04A 3RWIA 4ORGB 1PLGL 3CVHH 4EUPH 2CDEB 3EYFA 1PGRB 3D39A 3CK0L 2WWKO 4FNLL 2BCKB 2R69L 5CGMA 4NHUB 5EBMA 3DOSA 3VRIA 1T4KB 3H9ZA 2ZP0T 2NR6C 2X4OB 5LKNA 3SN6N 1GZPA 4HPOH 4JY4A 4LBEA 4O5LL 1II4E 3MXWH 2YA1A 4JHWH 4NFBA 4K23L 5JW4Q 5KSAA 1BFVL 2IGFH 3VA2C 2B0SH 5KSVB 3OKDA 1KV3A 4FHBD 2YPLD 4U0RC 5DD5H 4HH8A 5FM8A 3PV6B 1X5YA 3HE6A 2ZOLA 4ODWB 5HYSG 3B9KC 2R4RL 4ZYKA 1MCLA 3LKSB 5D7IB 4ZPVB 2ATPB 1H5BC 3DWTA 1MRCH 5DI8A 4ZNCD 4JFDD 3DVGA 1NAMA 1T2JA 4RAHA 2CK0H 4Z7UE 1G7QA 1OAKH 5DD6B 2BOCB 4QRRA 3MRQA 4S10A 4UIKH 5FKPA 5L8JB 3ETBF 1JZ4A 1UB5B 2CJUL 1JTPA 3CDFA 2EDFA 4PRHA 5I1KL 5ERWB 1IEAB 4ACPA 1RHHA 1DEEB 2BRRH 3SCMD 1JNNH 1L0QA 2X40A 4Y5XA 3VDCA 2OI9C 4NPYA 2J8UB 4P23D 4XCYB 1INDL 1U8LB 4OFYD 3D0VA 5GRJH 4YHML 3GSOB 3CX5J 5JR1H 4OCXH 3FN0L 5HGHB 4H26A 1JZ8A 3C87A 4TN9A 4B7LA 2A9NH 4JAMA 2BMKB 2Q76B 4HJGB 5DXWA 3B8YA 3DO3A 1ERNA 3PWUB 3P9MB 2R23A 3F7YA 4UNUA 5AZ2L 4Y8AA 5DZNA 5HYJA 3DUUB 5E8DH 4KK5D 1V3KA 1P4IL 4O02L 4AENA 2F5BH 5E7FA 3QEQD 4PJHA 2ESVE 2IQ9L 3QIUA 5MEOA 1T04B 3DVNB 2JIXD 1TMCB 4ODXA 1TCMA 4P3DB 5AYQA 3AM8A 3PJSB 4UQ3A 4HUUA 1JYXA 5HTSA 3SOBL 5GGUB 1A6VH 3QISA 5DDHB 4FQ2L 4APQB 4Z76A 4QXWA 5T5FL 3VFOB 4OSUH 5D7LE 4PB9L 4J2XA 4ODVL 2V9QA 1UWEH 4Y5VA 2IQAA 2YBRB 1B6DA 1MCFA 4UILH 4EIZC 4F7EA 4XPGH 1OB1B 4WI9A 3O9WD 1OTUD 3NZ8B 1N0XL 5DD1H 4KH2A 2DD8L 4HF5L 1M7DA 5DRXA 1ZANH 4LVNB 3LKSA 3K4ZA 5ACMA 1INQA 2Z8SA 5GRVL 5GRUL 3VXSA 5J6HA 3T2OA 3WLBB 3D1MC 4YHZH 5FYJU 4Z7UA 4XI5C 4J4PA 5L6YL 3ARGB 3H0TB 3WIIL 2CK2A 2JTDA 4Y16B 5DR5L 4FXLA 2C3WA 5E9DE 2DAVA 2X10A 3CFBB 2WLYA 4TPRH 3T2NL 4G8GA 3AXLA 5IQ7L 4KRLB 3BHBA 3QHFH 1WC7A 4RZCB 5FCUL 5FOJA 4JZOB 1A9BB 2LVCA 1Y0LA 4NKOA 4X99B 4PJXA 4OJFL 4JY6A 7FABL 1YDPB 3QNXA 4K8RC 1GGCH 4GRWB 4WU7A 4LLMB 3MNVB 4HHAB 3ZYZA 4LKCB 5JIKA 5HI5D 1HILA 2FNBA 1AR1C 3NH7H 2HT3C 1T1WA 4LVOC 1FNHA 2BNQE 3ZKMC 4B41A 4EBQH 5JO5A 3LOWA 4X9FA 3VFPA 2FIRT 1S7TA 1ZTXH 1T04A 4KRNA 3TV3L 2M8XA 3MR9A 1MI5D 2DJSA 2FB4H 4M3KB 5C0BE 5DQJA 3DYOA 1QLFB 1LO4H 2LTQC 3CSPA 1CFQB 5KSBA 5SX5H 2IG2L 3G6DL 5FUCE 4MNGA 1UB6A 4PLKD 2AJSL 4WI2A 1UJ3C 3VFVA 1T5WA 2XQYK 5FDWB 4P23C 1WWAX 2A1WL 1I8LC 1JPGA 1MPAL 4QOKD 3WFZA 3Q5OA 1B0RB 1A7BA 1MLCA 1UEMA 4XMPL 1D9KB 4L4VB 1DBJL 4GRLC 2P42B 4PJ5D 3V5DA 2E27L 1GHFL 4TVPL 2VUOA 1J10A 2ZCHL 1HXYA 3EHBD 5MHSD 4L3CA 3VD7A 4HV8B 5EPMB 3T3MF 3WCYA 4HH9A 1Z9MA 2IBBA 1TPXC 3WS6C 3I2CH 4GS7B 2VAJA 1OGAE 5GGSA 4OFIA 2WBJD 1OD7A 3VXQA 2XWTA 3P9LB 1DE4B 2J6EA 1XF3A 1YEHH 5HI4C 2G60H 3QNXB 1R5WA 4DQOH 1FDLH 3D39E 1R0AL 1UXWB 1OL0A 2JJUA 3INUL 1J8HD 1VACB 3NPSC 1WIOA 3EO1A 4O58L 1E4XL 1HILB 1R3LA 4PGEA 4OCYH 5CSBA 1AXTL 3X3GH 3E6FB 4QHLA 4I2XB 5I30L 3LRGA 5IHZB 1JFQL 4FFVD 5IHBA 2P48B 3FOMB 1OW0A 3JUZA 5HHOE 4HXBL 4WNQA 5DJZB 3KLDA 4RWYH 5GSRB 1N8ZB 1JL8A 2NYYD 4XCCL 5EOQH 4YWGH 1GJIA 4KZDL 3ZMRA 2A77H 3U4BH 1J88A 4ODUA 3AB0C 1MY5A 2VXUL 2CKBH 4X8XA 5IR1B 43C9B 3MBXH 4DGIL 4LLUB 4EN3D 4FQJL 5D72L 1PEZA 3U0WH 1GSMA 3WN5B 5MEOB 4F33B 3PL6B 1JPFA 3MLRL 1C1EH 4UQ3B 2BHZA 3QFJA 3BH9B 1JGLL 3HZYB 5F72S 1D5ZB 4QXGH 2Q8AL 1FL3B 1ZSDB 3KPPB 1FH5L 1ZHBA 2KZWA 2ZJSL 1HHKA 5IFAH 3GM8A 5FKAA 3I85A 1XR8B 3EBAA 3LQAC 4ELMB 4Y5VB 1Z9LA 2B4CC 4YHIA 5J7CC 1F3JB 5JXEC 1V8HA 2WBKA 1I8KB 3GNMH 1KLUA 3QUZC 3RVTC 5T1LD 5CP3H 1NC2D 3UJTH 2QEJA 4PY8I 1IC7L 5F6HJ 5I1IL 5CLWA 4OZIA 3DVNA 3G5ZA 1BM3L 2JELL 3DXAA 3OAZK 3NN8A 2X4TA 3F6LA 4F9LC 4U1HB 2IALA 1VESA 4G7VH 2PXYD 2Q8BH 3L5WA 2VLJE 4JO2L 4O4YL 4NQED 4PV8A 4JKPL 2QLVB 3D25A 1WC7B 5DK0B 3J7HA 2VE6A 1OB1A 4P2RE 4NQVB 2GFBB 4O9HL 3QWRA 1ZLSH 1S9YA 4YXLH 2ICCA 4WTZG 4S1SL 5BJTB 3BJ91 4HFUL 4OZIF 2Q6WB 3VWJA 2VB5A 3STBA 2BVQA 4FQ1L 4M5ZH 3FAXA 1K4CA 1ETZB 3GHBH 4PS4L 3WLBA 2EDDA 4HEPG 5GS1A 1PZ5B 5E9DA 1IBGH 3MRGA 4LASL 5ICXB 4IS6B 4LHUB 1AGCB 1TNMA 3GMLA 4PGJA 1S9VA 2HFGH 2JIXA 2EZ0C 3DMMD 2OS7A 1FYTE 3G6AA 1TETL 4LLVB 5CWSB 3DETC 2NW2A 3HZVB 4LEXL 4C83B 1ZS8A 3L6FB 1D6VL 3A67L 5B39A 3GZKA 3CH1B 1A2YB 3QIWD 3MRJA 5BVJA 5IIEA 1NMCC 3BWUC 3U2SB 5F6HI 5C08D 3X17A 5GZOC 5TH2A 3O6ML 5EIVA 5I74B 5IBUB 5D6DA 5C6TL 1H0DA 2DM3A 1IJ9A 3O6LH 3QQ3A 4P4KD 5FF6B 4ZUWB 1CTOA 1XR9A 2GJZA 1X5HA 5FB8A 1X3DA 1J05B 2MTPA 4Z6AT 2I60L 4CVXA 3IDIA 1SMAA 1QOKA 5HDLA 3T0WA 5GQBA 4PJAB 4FA8A 1CT8A 5F1NB 2H3NA 2C3VA 3HPJA 2VLRE 2VDPH 1FLTX 1X6LA 4JG1L 3IDYC 2AS5M 2DTMH 5J89A 5LGKA 3TPKA 4EUPA 1G9EA 1YUHA 3BMWA 3LB6C 4OD1H 4OF8A 5DMKB 4U1MA 5DJAA 3OKLA 5FDWA 3EIFA 1OAYH 4X7CC 4ERSL 2XWTB 3QPQC 1WVZA 3ZYIA 1EFXB 1FCCA 5F70A 2R1XB 1KN2L 3O6FC 5C0BA 1J1OH 3LSOB 1YNKL 4IOIB 4MAUH 5LWYL 2FL5A 1F6AB 4IOFC 5HHMD 1I7ZB 1MHEB 5K33A 1YMMD 5TGBB 5FA3A 3QCVH 4IDJH 5ETUA 1KEGH 4Y5VC 3PV7A 3PNWB 1WSST 4QXUH 5C3LD 4LSTL 3GB7A 4LQFL 1JHLH 4AY0A 4HS8L 5DMJB 1DQQA 4V2CB 1OAZL 5HGBA 2W92A 3GBMH 5B4MC 3E6HB 4Y4HC 3T3PF 5F93C 4OZHA 4JZNB 5C0IA 5F6IB 1PX4A 3P0VL 1R24B 1QNZH 1UCBH 3QDMA 4Y1AE 4NM8L 3VW3H 2Z9TA 3L3DA 3PGCB 1QKZH 2VLME 1NL0H 3MO1A 1FG9C 2OTWA 3MJ9L 2HMIC 5J4MA 5L9DL 1N5YL 4DUXA 3P4LA 1NCWL 4GSDH 4JE4B 4M9PA 4MYWB 4JKWA 4OF6A 4XH2A 5JZ7D 2J8HA 1FSKC 3BIBX 4LRNH 5CAYB 1FORL 5FA4B 2G9HB 3REVB 2W59A 1S5HA 1ZVYA 3EGSB 4Z5RB 4CADB 1WFNA 3QR2A 4FQQB 3QUXB 4NZUL 3RTQC 3LH2L 4RMRA 2W0PA 4KKCC 4QNPE 1GYAA 1Q94B 1PYWB 3IB4A 2DQJL 4PJGA 1IT9H 3F58H 3FOLB 1RVFL 2AJUL 4WHYG 1Q9WB 1A4JB 3HG1B 4OTXL 3PL6A 2FECL 5CJ5A 4F3FA 1ADQH 1SHMA 4X6BB 3VXSE 5HGHA 1HQ4A 2QHRL 2VLLB 4JDZA 4E0RB 2DMBA 1K2DA 3NA9H 1F4WH 4HJGA 4HZLA 4H5SA 5KBNC 1NCBH 4P5KA 4TULL 4UT6H 2HN7B 5EG6C 3MOBL 1U8OA 5EO1A 2BNUA 2BNRD 2J6EH 3RL1B 4J3SA 1YQ2A 4HIHA 4S11A 4X7TB 1S9KC 3SPVB 3MC0A 3FRPA 1Z2KA 1FL6B 1KYOJ 2VR5A 4GRLB 4WO4A 5DI8B 1U41A 4NOFA 4Q9BA 3DVGB 4KVCL 5ISZA 1A6TB 2AJYH 1G1YA 4OZIE 5C07A 4HJ0C 5EA0L 1QLEL 4LHUA 3LKRB 4OFDA 4BFEA 3O2DL 4XXDA 4A6YL 4CNIB 4KHXL 3JV4A 3S4SA 3EDEA 4FABH 1UJ3B 3OZ9L 3S35L 2GK2A 3FB5B 3GJEA 1A6ZB 2IAMB 2QADD 3VXMA 4U1IA 3BKYL 1GZQA 3BH8A 3HUJA 1S7RB 3Q1SH 2IPTH 4ELMF 1T3FA 2P8MA 1CXLA 3FFDB 3TP4A 3NMEA 3O9WC 1CGSL 1H5BB 1RUML 1XIWA 5D8JH 1ZGLB 1T0MB 5ILTH 1EEZB 3QIBC 1A14L 2R2BA 1R3KB 1OAXH 3EYSL 2C4FT 5DEFB 2UY6A 4OCRH 4QGTA 3W9DB 5A16A 1KIPB 4F7PA 2DQIL 1NC2A 5BVPL 1MCWW 3VRJB 1QSFB 3GMLB 4RISH 2R2EA 4GKOA 1TVBB 4PLOB 1GL4B 4HULB 2BOBB 4OLWL 3TT3L 1C5DB 5HY9B 4YBQC 2JJTC 4ONFL 2Y06L 3OX8B 1E0OB 3QXDA 5INDB 4Y4KD 4KUCD 2C1PA 4QYOA 4GMSL 3CH1A 4WGVB 5I6XB 1OTSC 3MRDA 1Q1JL 1W2KT 3E0GA 4M93C 3MCKB 1FJ1A 4HKJA 2HKFH 2GTWB 2B1HH 3K80A 3UZEA 3WE6A 3QWRD 1JMZA 3MTRA 1AFVH 3MYZA 3RUGB 3ZLQC 1BIHA 3QDJE 2BRRL 2V6HA 5KSAC 3PIQB 5DHXB 1OCWL 1XGPB 3D39B 5IB5B 4E41B 5D2NC 3T65B 3RIAK 2FO4A 1WAAA 4U6HA 4BSWA 2VDLL 3MLWL 2DIBA 1Y0LB 2LU7A 5DLML 5LXGH 4KKCD 4UZGA 1CFSB 2PN5A 4L8DB 2HTKD 3MRHB 2HYMA 2YUVA 4MCYB 1A1NA 5D4QA 4XAWH 3AGVA 4ZSOA 1MEXL 2UWEA 1A7NL 2EXWD 5F7UA 5JPMB 4LLYB 2IQ9H 1A7QH 5F96H 4X4YB 1MJJA 1H9VA 5CP3A 4LARH 5DJXA 4GMTL 3O3AB 3P4OB 3DVIA 1F58H 4CDGC 1PZUB 1N64H 3B9AA 5D5MF 5D2LE 5D9SB 5KANI 1ZGLA 4HX1B 2CRZA 3OKOA 3KPQA 3LKQB 4YZFF 3BWAB 1OLLA 4HGKC 3ZDXE 3BGAA 1E4WL 3QEUB 2ITDA 4ZO9A 4Q9RL 4P4KA 3S34L 3BD4A 3AAZA 5KVEH 32C2A 2YRPA 4XPGL 4GBXA 5AYUL 5C0ND 3GMNB 4KK8D 3W0WE 4AL8L 3UZQA 5GZNC 1QA9B 1D5IH 3VWKA 2PXYB 2EDTA 4G6MH 4JFPA 4FFZL 4ZODA 2F5AL 4KHTH 5SWSB 3ZE1F 4HKZA 4WWKB 5SX5K 4QXTB 1Q38A 3HAEG 5DF0A 3MCKA 2RCSH 4I2XA 1OVZA 3ZHKA 1R24A 4JFXA 3QZWB 1DQJB 1KB9K 5MI0B 3S3JA 1Q94A 2JKXA 2PO6A 1LE5B 1IGFH 2PW2A 3TWCH 2NY3C 1JPST 4N0YH 2VDMH 3WFBH 4W6WB 4G8FB 4HS6A 4JPIA 3UPAA 3OPZH 4L4VA 7FABH 2VMFA 1U8IA 5TQ0L 3EJYC 3FO9B 1YC8A 4X6BA 4GQ9L 3CDYA 3DRQB 5DDHA 4H1LA 1R5WB 3OGCA 3RPIA 4CMMB 3R8QA 3OB0K 3L5HA 3MUJA 1CR9L 4OGXH 2DLFL 2DWDA 5MEQB 4JAMB 3I6KA 4LK4A 5EU6D 3RTQA 1OGTA 4OGAC 3WN5A 4MJ6B 3C08H 3O81A 4KRPB 4S1DD 4UIMA 5D7SH 2VLMD 1F3DH 2XN9A 1DFBH 3QFJB 1LO4L 1NDGB 3JV5A 2VJXA 4DCQB 5I17B 4FQCL 3PJSA 1KSRA 3MLYH 1FFNA 4NKMB 3RY4A 1WGOA 4MB5A 1JBJA 3C6SA 4DWHA 4I48B 5E2VH 3FN3A 3OF6D 2FRGP 2NY3B 3KPMA 4KUZH 3S37H 4LCWA 2DM7A 2NY0B 1KBGH 4FP8H 4L4TD 4PRPE 1K85A 4PJXB 5GGRB 5GSRA 4NRXA 3TBSB 1RIUH 4XWOD 2VLJB 1CE6A 5E1AB 3ZE2E 3DHJA 3FFCA 1I1YB 4YX2L 1VGEH 1G0YR 4UQ2A 1QVOB 1NGYA 4NJ9L 2Z35A 3BXNA 3WDHA 5BV7H 1GRWA 4Q9CA 5KVDH 4Q6IC 5IOPB 5KVMC 5EZJA 2ZUUA 2NY1C 1KPUB 1QRNE 3RPKA 4U4BA 4HQQL 3K46A 1JNHB 4JQVA 2BY1A 2HKHH 5FYKU 5IMMA 1AJ7L 4XPBL 5HDQH 1HHIB 1CG9A 3FB5A 4Q9QL 2A9ML 3CFKA 5J1AA 5CEZL 2X41A 4JZOA 5DC9B 4Z77B 4DVRL 2YPVL 4O2CB 1X5IA 4H1LB 2OR9L 5KTEH 1PQZA 2Z8VC 2B8OT 1H8OA 4KJWD 2GJ6D 1JPSH 1OPGH 5TDPA 3K81A 4LIQL 5F8QC 2DQDH 1BVLB 4OZ4B 4S1QH 1G0XA 4WCYH 4OLXH 4F57L 3CLFH 5GSVA 3BPOC 4P5MA 4PGDA 3WFEH 2EE2A 2E9WA 2APXA 2HFEA 4F37F 5I1CL 4IOFD 3O0RL 2XYCA 3I3BA 4NBXB 5T3ZH 3DO7B 3GRWH 3KPLB 1OOAA 5ENWA 4UOJA 1LEIA 5F6IC 5T3XL 5FECB 3V5HA 3VFNA 2F58L 3SCMB 5E8PB 4YAQA 1LNUB 3QEHA 5T5NF 5T33H 4AEEA 5BW7A 2XV6B 1FAKT 2HJLA 5FUZL 4LVHC 2J8OA 4JDVA 5I1DB 2VQUA 5M95B 2MFNA 3W0WB 2ZUWA 3S88H 4JO3H 3QO1B 2PYFA 4YGVB 4YPGB 1JRHH 4BFIA 3HI1A 5CCKH 1TQCC 1T1XB 2MQCA 4OUUB 2IBGA 3TH3T 4K3EH 4WW1A 2WV3A 2EDJA 1VFUA 4TVSa 4YFLF 3LN5B 3ZDYE 5FYKD 3C60C 1FC1A 3W11C 5KS9E 3OJMB 1PG7W 4RMQA 3O6FB 5ITFB 4WJ5B 1WFUA 4O2EA 5JUEL 4LAQL 1JHKL 4ONOA 1BZ9A 2W9DL 4PG9A 1NC4B 1WEJH 3LV3B 3NABL 2OJZL 5D1XD 1CIDA 3HZKB 3L3IB 2E6PA 1F00I 1FVCB 1JVKA 3WUWA 2C3GA 1ZA3B 2ZUYA 4RQQA 5FB8B 4PJCF 5C70A 4HKZB 3BEWB 3F7QA 4EJ1C 2X89A 3U83A 5DFVD 1DE4A 4LCCC 3P9WB 4FFVC 4UB0H 5E6ZA 5CZXC 3IDYB 4OM1L 1DSFL 4FMFA 4PJBA 4DZBA 1G7JB 5D93B 2D0FA 4JKPH 2SEBB 2WSKA 4JRYB 2P8LA 3C5JB 1F4YL 3KJ4C 4M7KL 3AAZB 3KAAA 1JI1A 4XCNA 2Z4QA 1P7KA 1BIIB 3HE6D 5F9OL 4EI5B 2D31A 2OXHA 3QDJB 5D1ZC 3DTXB 4KJYB 4Z18A 3BDYL 4ZUUB 2XTJE 4HFUH 3ULVD 2D9CA 5IQ9B 4NC2B 4JZNA 4HIJA 5FDYA 3OB0H 2IAMD 5E6IA 4KQ4H 4XVSH 3SO3C 4MAYB 3QULB 2VDOL 2Z92B 1PY4A 3ULVH 2ERJB 1ZLUH 2HFGL 5DUPL 5F1IA 5J12B 1WAAF 2FEEI 3QA3B 3LN4B 4D3CL 5JHLL 3R8BB 4OLUH 5JLZB 1MCJA 4F2MA 3RDTB 1NEUA 1Y18A 5GISH 2OSLA 1ITBB 1YEIL 3EJZC 1EFQA 5HVHB 1AC0A 4J3UA 2OI9B 3CDCA 3C8KB 2YD5A 5DMIH 5F9AC 2ZOLB 3CFCL 5CLTA 1LDPL 3O6FA 4NQCB 4BUGA 4TNWK 2APFA 4R9HA 4A6YA 3O2DA 1WFTA 3IJHB 2JF1A 3G9VA 4LSVL 4P2YA 3HUJF 1CQKA 4R26H 4J4PD 2PCPA 4RGMB 3ZL4L 4LU5H 1KJ3L 1OGTB 3ZYOA 4Z78B 4M1DL 4JQIH 1CFVH 4POUB 5C7XH 3WFDL 1EGJL 3VMPA 2GYSA 1FV1A 1HQ4B 2VLLA 3ZT5A 5C0EA 1S7QB 5LGJB 1K4DB 4YBLC 3D39D 4S1RH 1QYGL 2FJGA 3L95A 1UB5A 4PP1C 1I9JL 3SDXA 3RVXC 4KKLD 1RZJL 5KJRH 3D69A 3LPGA 2CLVA 2NX5A 4PJ5B 1D5BA 4OD3L 5HDBF 5TE7L 3OXRB 1GIGH 4KROC 5DRZB 4PRDB 4RAUB 1KLFA 4FOMA 2BVPA 5D2LB 5F9JA 1IKFL 3BIKB 4XNYL 2CDGA 1TQCB 1JPTH 3REVA 2FDBP 4MAUL 5HHPA 5ITBH 3LCYA 3T1FB 3QULA 3ILQD 3QUMA 1HQRB 4E0RA 5D7IF 3UCRA 1UJ3A 1FAIH 5ESVA 3P30H 5TE4L 4OBSA 3DX9A 5JORA 3MLZL 5IGXL 3AXLB 3TVMA 5IB4A 3ZDZE 3O45B 5A3ID 4TOYL 3PHOB 1CGYA 1QQDB 1XF1A 3RL1A 1CG9B 4NYLA 1SYSB 5HHQB 5AAWA 3PWJB 4MNQB 3U7YH 4LNRA 1KTKE 2E6JA 5IM7B 3VXUB 4XX1G 2BHYA 2Y36H 4PBXA 3FMGH 3TT1L 1IRAY 1O7SA 4OFVA 5KSBF 3MBED 3DX8B 4U31A 2J3SA 4TUJA 1NFIB 4H88L 4XB8A 5EO1B 1F4XH 3DI3B 3CU7A 4P2OA 1CFTA 3S4SG 1FIEA 4OZ4A 3IFOB 4MS8D 4U1LA 4JN1H 1X5ZA 1B9ZA 3CAFA 3DV6A 2A83A 4DGVH 5JW4M 1T5XA 3O3BB 1VPOL 3GSNB 4JKMA 4WW1B 3QDHA 3G08B 4FTVD 4ZFOL 1EXUA 1FVDB 4DKAA 5SX4H 1J5OL 4NUGL 4I0CC 1JWMA 3W9EB 4JGUA 1CGUA 4P5TA 5K59F 4GAYA 5JQ6H 5BMFL 2W65B 2IH1A 1A4KA 1EJOL 1A0QL 3MCLH 1NGPH 2P44B 1I8LA 1F6LL 1HSAA 4JM2F 1MLCB 4ZXBD 4JREC 1KCSH 1DUZA 5JIHA 2PYEA 4JRXB 1FO0A 2R56H 5HHPB 1NMCB 3L7EA 5DEZA 4JN2B 4OIBA 1F4WL 3O9WA 5FXCH 5E8NA 2R1XA 1E4XI 5FGSA 3LN5A 4WI4A 4U7MA 3GEWB 1IM9D 3EZJB 3ECBA 4ELKB 3ARDA 4LLQB 3GIVA 3TYGH 3BKCL 3MRFA 3RUGA 1T0PB 3B2UD 2EYTA 3WEXA 5H8DA 3MLPA 5I76A 1YEEL 2JB5L 3EAKA 1UFUA 1DDHA 3IKKA 2BC4B 5IM7A 5F7NC 3MREB 2WINA 4M48L 5EA0H 2UY7A 4DUWA 4PJ9A 1T1YA 3IF1B 4IRSA 3IAQA 3NFPB 1JGUH 4I18C 5IVXB 1EDQA 1NCDH 3EO0B 4L4TB 4DFIA 5IESH 3OHXB 4PJAE 1BJ1H 5GS2D 1KEMH 4XNMB 5FOBA 4ZDHB 1CLZL 2B2XH 5F7DB 4EDWL 4R4FL 5L0QC 4WDIA 2A83B 2ARJQ 4W4OC 2XZZA 3HC0A 2XKNB 4YUEL 5C0AA 4YGAB 2IANE 4IEFB 5FO7B 1CGSH 1RUMH 5D8JL 4QRTA 4K23H 3VWKC 3IDMB 3CLEH 3HN3A 3L3JA 2FATL 4NQXB 2KZ1B 4OCRL 1Z3GL 4WFED 1K2DB 4KDWA 3WD5H 5IQ9A 4LPUA 1EX0A 1Q0XH 1ZHNA 43C9A 2R2HA 5DGQA 5F1SA 4H1LH 3ULUF 4PGEB 5F7MC 4N0CD 4MA1B 1A3RL 1JNLH 2VIRB 3KWWB 4POZD 1KB5A 2NPLX 2AJ3B 3IDGA 4Z0BH 5EU7E 3O3AA 5E70A 4HAGA 4UIKL 2DYPD 1NBYB 1MFEH 1K5NA 2QKIA 4NQEA 4ONHB 1Y18B 4CGTA 3DRQA 1KJ2A 3L1OL 2NY1D 3DI2B 3ALPA 3V6OA 3PP4L 4N90D 1T0NA 3VH8B 3V6FA 4LPWA 1I9RL 5E2WH 3V4VL 1C12A 5T3XE 2H32A 4P5KB 2YPLE 4ZQKA 3GJEB 3MBEC 1OCWH 1ZLVH 5FYJL 1U93B 4G42B 2HWZL 4QRUB 5E9DD 2ZCLH 2E7BA 5HHXL 3JZ7A 1I8IA 3JSSA 1NFDB 4XPAH 2C7UA 4LLWB 3WL9A 3T4YB 1FHGA 3BUTA 2VABA 2IH3B 5IW3A 1D5ZA 1SBBA 4CVWA 1MCBA 3VGEA 3WSQL 3CZFB 3ARTA 3QO0A 1RI8A 4MA3B 3W0WD 3RGVB 1VKXA 2EDNA 3PWPD 1SM3L 1YYLH 4NJAH 2L4OA 1Z9SA 2YZ1A 4UT7H 3RWCB 3ARXA 5SWZA 3GO1H 2RFXA 4NQVA 5HY9A 2W0LA 3EOTL 3FO9A 4XGZB 4N8CL 5D7LD 1NGZB 8FABB 4NUJA 3QRGH 1HH6B 1NC4D 1NGXA 3PHSA 5BZDA 4PBWD 1S8DB 2VWEE 4Z7UF 4DCQA 2VLRA 1JV5B 1VSCA 1J7VR 4L5FH 4U1SA 1MAML 4YDKH 1XF5B 2CO7B 4Z7WA 2YOCA 5I74C 3P77B 1TPXB 4R4BB 4WI5A 3RU8L 3LPFA 5FK9B 4ZS6C 5FAAA 3IETB 2X7LA 4G6ML 1I9IL 1C7TA 5GGVY 2HLAA 3AMLA 5IT2H 3VE0B 5I6XC 3D2UD 3PDDA 1Q0YL 2X05A 1AH1A 3QXDB 3BIAX 3IS1X 4N1EA 3L3KA 3M8OL 2YR3A 1G9ML 5T1DL 4FMKA 5DMGD 1IAOB 3KXFA 5CJXC 1A21A 5IMLB 1A7OH 3V9FA 1P4LA 4JANB 1Z5LB 4P23B 5HHOB 1DQML 3STZB 2LU4A 4X4YA 4KDTA 4ZFGL 4DEPB 3BKML 4TTDD 5TQ0H 4HKXB 4JHAH 1NAMH 2CDFB 2EDRA 2PUQT 2NZ9C 4N5ED 5CIPB 3UC0H 4JN2A 3EDKA 5E5MA 2HFFB 1I3UA 1MFCH 3IDXL 2X1QA 1CR9H 3GBNH 4F7MA 1U8LA 1CFSA 4PJHF 4BFBD 4JVWA 3SGEI 4Z7WE 3U1SL 3RAJH 3IJYA 2ZNWA 1QRNB 5FYLD 4TUKH 2F54E 1OWWA 2YEZA 6FABL 2V2XA 1A4KB 3FQXB 3CCHB 5LAXB 4P2RA 1EBAA 2LFGA 4PJEE 4AEHH 4GKNA 1RUPL 4LKXA 4XCFL 5FGBC 4HWBL 4CVXB 3HLAA 3MLUH 3MLYL 3FHAA 1IEHA 1MWAL 3ROOA 1TZGL 3KPLA 1ZE3C 1QPXA 5IVXF 1MFBL 2N4IA 1FZOA 5CD3A 3OKMA 1EO8H 1YEJH 5CZXD 3F6IA 4MA7L 4FG6D 1GGIL 1RPQA 2F19H 4ZFOB 1RIUL 3U6RB 2FHBA 5F1OB 3CFIC 2IBZX 1W8OA 2YSSB 1ONQB 2P1YA 3I2CL 2B39A 3F7RA 3LHPH 1IGTA 1MCWM 3PL6C 5CJQH 3TBVB 2BNRE 3UTQA 5IVXA 1E4KA 4IOIA 3MA9L 1FBIH 4IM8A 5IBUG 4J3OC 3HE7B 5DVNA 5L2KD 1S9XA 1BJ8A 1HKLL 2PTUA 1AXSB 4ZOAA 4K2UH 5FM5M 3P11L 5CJOH 5KW9L 4JM2B 5I30H 2GAZB 3IVKB 1OSZA 3OKDB 3EJJX 1FSKB 1NMBL 3UO1H 1AR1D 1ZA6A 2J2ZA 1MF2L 2WIIA 3L3JB 2V2WB 4O51A 4TSAL 5DURB 2H2SD 4WU7B 3TCXA 1XMWA 4WHDA 1VENA 5DD0L 2EYRB 3TO4A 5MEQA 5JLZA 1B4JL 2VAAA 3IDNA 1QBLH 4RDQF 1FGNH 5I1CH 2KUTA 4YLQT 2H2SC 1IKNA 1D5MB 2L7UA 5EN2B 3F7PC 3PV6A 2JJWA 4ODBD 4FQJH 1MIML 5JHDB 4KV5E 4HT1H 5ADPL 1LO5A 3QI9B 3PXJA 2D4FA 3WO4C 4KMTH 2BNRA 2V17H 2SEBA 4TTDC 3RNKA 1JGLH 4YDVA 4YO0A 4MAYA 5EOCL 4KJWC 5DHVA 5C0AD 4FZEH 5IHUL 1FH5H 3Q6GL 3UP1A 3LMJL 3DSFL 2ZWLT 1IEBA 3QQ4B 3PWUA 5FO8A 1WAAE 5I2IA 4NQSB 4ZFZB 1RZ7L 3MV9E 1ONQA 1IGYA 2OTUA 2H8PB 3BPNB 3RL2B 1CFNA 4HBQA 3KPSE 3SDDA 5FUOL 3K1DA 3M1BB 1A6TA 4HUXA 4P3DA 2ZKHH 4Y1AA 4MNHB 4ZXBB 1MY7A 1JHTB 2DQUL 4V1DA 2JELH 2OZ4L 2CUHA 3MRRB 3LKPB 3DUUA 3SE8H 4E5XB 2NY5L 1XZ0B 5FYLH 1ROWA 5J3HD 5DZLA 1TZHA 4KTDH 1EVTC 2FEDD 4GRWH 2AXGB 2YA0A 4K3JH 4GO6B 1E6OH 4M43H 5CMAB 4YEFA 2XWJA 2AXFA 3BUYB 1M7DB 5DRXB 5E03A 4D8PB 5I73C 1LQSR 3O3UN 1JGDB 4OI9A 3MRLB 2AVGA 3TZVC 4EQ3A 2C9AA 4S1SH 1P2CA 3PP3H 4MD5A 4RMVA 3IXAA 3JVGA 3RWDA 1QQDA 4R0LC 2BVEA 3DIFA 3ULVF 2PYFB 4YGVA 2DICA 1RK0A 2X7LB 2RAMA 3MV9A 5GJTH 3QJFB 4XXCC 3KPSB 4IIQC 5KG9B 2C1PB 4QYOB 5HGDA 5KAQF 4PJ8D 2ZPKL 4ESKA 5KS9B 1N8ZA 3KXFE 2HT2C 2UZYB 5JMRA 5DUPH 1XFPA 3C6LC 2KBGA 1S5IL 3I3DA 5DHVB 1EAJA 3PL6D 2QV2A 1G7PA 1ZT7B 5HHVH 1IEBB 5J9PB 5D7LA 1BQLH 4X4ZA 4N68A 5E94B 2AGJH 4LVEA 4MD0A 3EOAB 4HGWB 2GY5A 2W07A 1MRCL 5F9JB 2Y9RT 2V9TA 4AH2A 2CDGB 3O6LL 1Y6MR 1H5BA 3CD4A 1KNOA 1RK1B 4WY7L 3I02A 1W72H 4HHAA 1BVKA 4GG6F 3W9DA 1X7QA 3VXNA 5ALCL 1FFRA 3QG6A 4WO4D 2EE6A 1NC2B 3CVHA 4HC1H 5DJCB 1KACB 5FHAH 4DUVA 1J8HE 2G5BB 1HWGB 2DQTL 3WFDH 1J12A 1CVSC 1VFAA 1DUZB 2X4SA 5B38B 1N5AB 2UVFA 1DN0A 2H2PC 2YK1L 4NM4H 1LE9B 1G6RL 3ULUL 4BZ1L 4CW1B 3QQNA 3Q5YA 1U6AL 3ECBB 1VFOA 5C6WH 2R4SH 4WV1C 4ZTPL 4XC1H 3RWGA 5F89B 4LQ1A 1J1OL 5D70H 3ARUA 5DJYA 1IAIH 3VA6A 4XBEL 1H3XA 4LLVA 5GRXG 2NW2B 3HZVA 4LDLB 1L0XA 5K59E 4PJFB 4RIRA 1UACH 3SOBH 3HPLA 3SE4C 4U6VL 1NJ9B 4AMKL 3BAEL 4L9LB 3L7EB 3MLVH 2MPAL 3DMMB 3GHEH 1OAZH 5C92A 2GJJA 1AE6H 4KAQL 5AWNL 5D7LB 1EEYA 2PO6C 2VR4A 3KJ4B 4L8BB 4ZUWA 5FF6A 5CINL 4PD4K 5EU4A 3SKUD 2WMPA 3L9RB 4OF0A 5LCVL 2EC9U 1WIUA 5DEGB 1RUQL 4XVTH 1BPVA 5I9QB 2V5YA 3OKNA 4C83A 5A43C 4PTTA 5FO9A 4U0RB 1DLHB 1YZZA 4CUCA 4H88H 5E2TH 2CKBA 3GIZL 3CXDH 3IF1A 2AJZA 4IRSB 3RP1A 1HEZB 4YNYA 4JFEB 3TCLB 5DJ8B 1ZLUK 2F54B 3LIZL 2XN9D 2VXTH 2OQJB 4LLUA 4FFYL 5ACLA 4HLJA 4LEOA 2Y25A 4WW2C 3WEXB 3UJJL 3PWVB 4J1UB 4NQDD 3UYRL 5D7IE 4AT6A 1IGIH 3A6CL 4BA8A 2XQBH 3UPRA 1MCPH 4WEUD 3VMNA 4Z7OF 1AGBB 4JFOB 4I77H 3GSQA 2P4AB 5D1XC 4PB0L 2BSTA 2P49B 2P5WD 3LKPA 5CZKA 2I26N 3TVMB 4PY7A 1BEYH 2FX9L 5EU7C 3TV3H 4QRUA 1FZJA 3FFCD 1QEWA 2HRLA 1WK0A 5BXFA 1I7UB 5KOMC 4XT1C 3EYUH 5D7KE 2W60A 1QRND 5BQ7B 2H8PA 2NY4D 1NCUA 4XNXL 3ZKMD 4MJ2A 3SDDC 4NPYB 1U36A 5D1XB 4ETYA 1KXQE 4R8WH 3LEXA 4MXWH 3BISA 3BKCH 4U05A 3ME0A 4HUNB 3H42H 3B8SA 3IFOA 3GMQA 3B6SB 5TF1H 2K9UA 5ERWA 1QLEH 1TJIH 5BZWA 4HWEH 2FGWL 4ZUVB 2H6PA 4JM2C 1CE1H 3CFEA 3X3FL 1MWAA 4KHXH 5DEGA 1S7UA 1OAQH 3D48R 3O45A 4FNLH 3HNVL 3F7VA 3RVUC 1R3JA 1ACYL 1H3TA 3D0VB 5HGBB 4UV4H 2Q3AA 2GCYB 3MNZA 5FHBH 4FQQA 1A6WL 4H25A 4JPWL 4POYA 2AV1B 5CILL 3I50H 1RZJC 5TH2B 1NGYB 5EWIL 1TXKA 2FHFA 3Q6FA 2FGZA 5FK9A 4RA0C 1NMAH 1X5GA 3BO8B 4HK0B 3BZEB 3MX0A 3PWVA 4ODHL 1AKJB 3ZO0A 3TYFB 1S9VB 3H9HB 3DV4B 1F8TH 4QRQA 3DROB 3CMOL 2QQKH 5DMGC 3CIQA 4O58H 1IMHC 5EU6A 2IH3A 3D18B 3QJHA 5TDNB 4NUJB 1HH9B 1MREH 2D0GA 4JJ5A 5MENE 5I1KH 3SBWA 4LHJB 1RZFL 3P40A 5GXBB 4OZGB 5CS7A 5GSVB 1VFAB 1P6AB 1YN7A 2CDFA 5D96C 1N5AA 3VFRA 2VZTA 4PRBB 5I1HH 1PJ9A 5DYOA 1VEOA 4NQCD 1J1XH 2AJVL 2EIZA 3GSRB 4RFOH 1CU4H 4N8VB 4LVNC 3SEPA 4WV1B 3QNYA 4AEIL 4ZOBA 2H3NB 3BE1H 4GXUM 3TA3A 1IILE 1WZKA 1MOEA 4QHUA 3VG9C 2IAMA 5E6ID 3FL7A 3VXMB 3HS0B 4Y4HD 3SGDH 2BNUB 5DMKA 1R5IB 4NSKB 1JYWA 3AREB 3TNNA 4X9GA 2GIYA 4UAOB 1MCDA 1YDPA 2VNCA 4WU5A 4BQCA 3U0PB 1T7VA 2A2QT 1XIWC 1M05B 3IFPA 2B20A 3MREA 1XF4A 1AY1L 4LLMA 5I18L 2HMID 1QLFA 2EYSA 1J8KA 4NN5C 2R0WL 1P4LB 1TQBB 4ELME 2JJSC 2CLRB 1BIIA 3BGMB 3C8HA 4JQXC 4X5XA 2YS4A 4L4TE 4PRPD 1UGNA 4KJYA 3FQXA 5B4MD 4BFIB 3S97C 3MR9B 4HXAH 1CLOL 4NO0B 2V5MA 1X5JA 5EUOF 4JZJA 2C1OA 1MUJA 3QEQE 4EI6A 1QSFD 2J12B 2D03L 3MLTA 4JJ5B 5JW3H 2F5AH 3D3VD 3QUXA 3RZCD 4ODTL 4PJDB 3PWLB 1WISA 3TN0B 5C9JB 3P9MA 2MKWA 2MMXA 1CDHA 4LSUL 1ZLSL 4H0GA 4IRJD 4PRID 3HCVB 2GJ6E 3NZHH 4KI5F 3L9RA 3QIUC 1OTTD 3VG0H 4RMTA 4AZ8A 2XN9E 4QHKJ 3KYAA 1I1AA 1I9EA 5F71A 3KR3L 1DJSA 5T1MA 4ZNEA 4KK6D 1REIA 5C0IB 3V52L 4ZS7L 3KPOA 2VTFA 1G7JA 4N0FB 1MIEH 1JWUB 1I7TA 2MQ3A 1QSEA 2OK0L 2AEQH 3N1QC 3ZKQD 4QF1A 5L2JA 1DQDL 3X14B 2YKLH 5B3JF 1UVQA 4JHAL 3SKOA 3UTOA 5C8JA 4HJJL 1MQ8A 4Y4FB 2OQJA 5DFTA 5T3ZE 1HXMA 3BP6A 1WF5A 3N50A 4KQ3H 5D9SA 5MP6H 3WXWH 3NACL 4PGZA 2O61A 1UH2A 3FRPG 3DMMC 1N2RA 2X09A 2NX5D 2GUOB 4NFDA 5LBSH 2WAHA 2IFFH 4YO0B 1SY6A 1QBML 2A1WH 2V7NA 2E8ZA 1MPAH 2YRZA 5DUMH 1M6OA 3FB7B 2YPKB 3O2VL 2R1WB 3H7BA 5E2VL 1T66C 4NQSA 2F15A 1DBJH 1QEWB 4NO0A 2BVPB 4X7DC 4XP9L 5D2LA 1QR1B 3LY6A 3ET9F 2E27H 5SX4I 4NP4H 1Q9KA 2J88L 5I8CA 2G5RA 1MFBH 3GSXB 3ARFC 1IQWL 4XMKL 2LAGB 5DEFA 3SDYH 3FHQA 1A7PL 4J6RH 1IAKA 3BPCB 1BD2D 5HD8D 3UZVB 2BXYA 2FH8A 1B0GA 2I9LA 5DWUL 2BOBA 2XKUA 2GT9A 3QQ4A 1KN2H 5INDA 5FGCE 5CP7A 5LGJA 5HDQL 1ADQA 2P5WA 4WTWA 1VGKB 4TNVK 3V6ZA 1J0JA 5ANMB 2AEPH 3GMOB 3SDXB 4LSTH 4RGNB 1X4YA 4CVUA 1MJ7H 1JFQH 3Q5TA 3RGVC 1AC6A 3E8UH 2CLZB 1D5BB 2DQEL 3T04D 1AO7D 1LEKB 5CJOL 4FTVA 2P47B 5I0DA 4JANA 3KDMB 1I7RB 1OAUH 3ISWA 1EERB 5SV4A 3JTSA 3TYFA 3WXVL 2F8XC 3VGFA 3KPNA 4OLXL 4CU8A 4F57H 4KJQC 3VFPB 4P9HC 4JPIB 3NAAL 3TGXA 3RA7H 2R2BB 3HE6C 4QY8B 2IPKB 4NDMA 5IB1A 1JWMB 3B3IA 3W9EA 1JGDA 1U8JA 3K0WA 3KJ6H 3K2UH 5IWLA 4PV8B 3MUHL 3KYMA 5HI3C 1M6OB 4Y8DC 2VC2L 3ULUD 1WBZB 2NY1B 3IGAA 3MRIA 3GDBA 4YHYC 5TFSH 1S9YB 1YEFH 1ZVHA 4Q0XL 5ADPH 4PJHE 2LABA 5CBEB 3MV9B 1JF1B 3ULUC 4WVRA 5FUZH 2WQ8A 3ARDD 4E9LA 4YXKL 5IFAL 3B5TA 4FQXA 5DRWA 4X5LA 1A3LH 5DC4B 4N8VA 3NOIA 1JF6A 3RRQA 3BQUC 2Y5TA 1JRHL 3V5KB 4HEME 1CD8A 5E9DB 1IAIM 4MD5B 3RVTD 3PG2A 4RX4A 1B3JA 2DQJH 3LZFH 2FJHA 1KPRB 1SYVB 2X4UA 1U8HA 1ED3A 3MFGB 3R0MA 4I48A 4KK9D 3L3HB 4H8WH 4J3XA 5INCA 4L1HA 4PJ9D 4U6HB 3PE9A 2BC4A 5I1IH 3FAWA 2VE6B 4K8RH 4C56B 5DJXB 3SQOL 1BFSA 3BVNA 2KQMA 3RWEB 3TVMD 5GGTH 3ZZ1A 2CIIB 1J86A 5HHME 3UTSA 5E2UH 4K7PL 1J87A 2OL3L 4XWOC 3PWNA 4ZDHA 5FOBB 1BVKB 1LWRA 2NY2C 1EBPA 1JK8B 4YHKL 4Y2OA 4OLZH 1V7NL 2PO6B 2DOCA 4MA8L 1A7RH 2EXYD 3AMKA 3ZKND 3HMXA 3GMNA 1D5MA 3O11A 1OF2B 4HS6B 5GJSH 4YXLL 2APVA 4WI6A 1SMOA 3G6JA 1F4YH 4JEGB 1JPFB 4L9LC 3BP7B 3AUVA 4ODSH 1W0YT 5EBWB 3CZJA 5CZVL 3EYOB 1X9QA 1B2WL 4XHJC 25C8H 3FQRB 4F7TB 1I8MB 4PRHD 2Y6SD 4H20H 5LGHH 3VFNB 4ELKA 4GG6A 1AQKH 4R7DA 2FEDC 1YMHB 3MLXH 2GSIB 2P46B 2XACC 4L8BA 5HYEA 5MI0C 3ARBA 4XVSL 3VU2A 3QIWC 5FV2A 5FFLA 2C4FU 1QA9A 4K94L 3JTTB 4PUBL 4JHWL 2D7OA 1DDHB 2E7LC 3L5XH 1JGVL 3HI1B 1NDMA 4JHBA 2MCPL 1R6VA 5F1KC 1CDIA 1TJGL 4JREB 4MB3A 5IROA 5EORL 4XVJH 4ZFFB 5DD5L 4FQIH 1BZQK 5HPOA 2ILLA 1AKJD 1F6AA 1I3RA 1T83C 3EYQC 3LPWA 4YHPA 4ZD3L 5HHVL 1LMKA 1UH3A 5DGRA 1QFUH 43CAA 5ETUB 3B9VA 4S2SA 4WHTB 3SBWC 2YD8A 4OLWH 3QIUD 3TT3H 4OF3A 4LEOB 2D2OA 4QRRB 3W5NA 1J0YA 1FE8L 4XNUL 1FNFA 4XPTL 3SJVE 1IM9A 4CMHC 1I8IB 5JIIA 2FWOA 4L3ED 1LK2B 1XGUA 2NY7H 2P7TA 3A6BH 2CIIA 3MV7E 3GGWB 4OD2B 3QG7H 3NCMA 1T1XA 3VJ6A 5ALCH 4GRWE 4ZS6D 3D85A 4GKZA 4OZHF 4HKBB 2VISA 1DUYA 4FQHB 3FQWB 1DEDA 1M7IA 1D5XB 1KLGA 4MJ6A 1DVFA 4YFLI 3VXSD 1N6VA 3NIGE 1RZJH 5DT1H 4DAGL 3T1WA 4XZUA 2BY2A 5B39B 1YNLH 1IQDB 4XCEA 3TH2T 4L29A 1C8PA 1GIGL 2NY6D 4PJEA 1ORSA 4GQPH 2ERJC 1CE6B 4Y4HB 1FGVH 2YD1A 3QDJD 2M1KA 1F5WA 1MEXH 1P5VA 3K4DA 4QXUL 2IMMA 4ZQKB 5IOPA 1JE6A 3LN4A 3FTGB 1XCTB 3KPMB 4NWTH 4YIQA 3HAEH 4PRNB 4QT5A 5D5ME 2AXJA 4F2MB 5BS0B 4KK6C 4ODVH 4WUUB 1RUKH 3FT2B 3KPNB 1JWSA 5TE4H 1K3IA 4Q9RH 2HJKB 2IADB 3DVFA 5DD1L 4BSJA 4L8SB 4MX7B 4TVPD 4EEEA 4EOWH 1FL6A 2VXSH 4GRLA 5D93C 2J7LA 4NO3B 2BSTB 3C9NB 4AL8H 5IF0A 5IMLA 1WBZA 3BPLB 3BZEA 3ARGA 3H0TA 3IFNH 2JLLA 1R3IL 3BJLA 4FQLH 4BKLA 2IAND 3MRMB 4LPYA 4KHTL 2EH7L 3CFBA 3IETA 3WJJC 5DURD 1OW0C 5CIPA 4QRSB 1MWAB 4JLRB 4RZCA 1NGWB 5IQ7H 1U95A 1ZVSA 3QFJE 5E2TL 4JB9L 2XRAL 5HYJD 5F21B 1ACZA 2VLKE 3V6BR 3MV11 1BZ7A 2E7MA 4DGVL 5EFIB 4XMLL 4F3FB 1RK1A 4M5YL 2V2TB 3FCTB 3BQUB 3H8NA 4LLDA 4M6OH 2FJGB 3STLA 4UTAH 1FRGH 4ENEC 3WNNA 4QOKA 3MNVA 1NSNL 3S4SB 1N6QL 3WFBL 4I3SH 5BZWB 1IC5L 1F90H 1X5AA 2ZSWB 4PD4J 3GSWB 3PGFL 4P23A 3E3QE 3WNOA 5ID1B 4XP1H 4AJ0A 3K4AA 3T4AB 1PX3A 1FN4B 3SPVA 4OZHB 4F15C 3DYPA 4IRZH 3RX8A 1J1PH 1BX2B 1DBMH 4LCCA 2AV1A 5D1QC 3VFWB 2QADB 4GRMB 2ENSA 5TDOB 4Z7NE 4MCZA 4XC3L 2C3HA 1BBDL 4F7MB 1S78C 5C0DB 5DRNB 4KV5F 3BZFA 4KKBC 2VDNH 5BRZD 2AJSH 4DVBB 5I8OH 3NFNB 4UBDC 5A40E 2A38A 1A47A 5GRVK 5CKAA 4PJFA 2EICA 5C71A 1ZA3A 5DVLA 5FO9B 4MMXC 5LG1A 2EKSB 3OL2A 5EU3A 4KKBD 2AEIT 3DRTA 3WDIA 4WO4C 4P0DA 1GAFH 3O8XD 4W4NA 5L2KA 1CGXA 1MHCB 1CXIA 1CF8H 2XZCH 4X9BA 5AAMA 1EHNA 3KHQA 3OGOE 4L8DA 1CFTB 3TA3B 3HA0A 2DKMA 5C08E 3OKMB 3PIQA 3TO2A 3UBXB 2QQLL 3K8LA 3MBEB 4JFFE 2FO4B 3ZTJH 2FBJL 2RB8A 2ICEA 1EXUB 3OQ3B 1KCLA 5C09D 1CD1A 1GVIA 1BZ7B 3P9LA 4KMLB 4OCWH 2NXYC 1RU9H 2IGFL 3W82A 4YUEH 2D7NA 3FONB 5T3ZD 4Z9KB 1F6FB 4HQQH 1Q8MA 4MCYA 1NMAL 3SDDD 2BDNL 4G7YH 5GS0H 1E4XH 2CR3A 4QHLB 5GRYA 2DQGH 4Y1AD 3QNZB 1PDKA 2ZUXA 2OR9H 1W72B 1JI2A 4V1DD 2EH8L 4X6FA 4IMLA 3KYOB 1JPSL 2MQ0A 4KKLC 3UX9B 5I1LB 3VJ6B 4HXBH 4P49A 1D7FA 2G2RB 1UCTA 5CFHA 1VACA 2AKRB 2ATKB 3M07A 4NFCA 4PJIA 3DPBA 4K94C 3MUGA 1Q9OB 3HI5H 4PJCB 1E6JH 4GRWF 1O7VA 4Y19D 3ZE2F 3PQYB 1IC1A 3GMQB 3K1KC 4HCRA 2BNQA 3PDGA 1TIUA 4ZAKC 5LVEA 5T1LA 4LSSH 1IL1A 1FNSL 1UXSB 5I1HL 2DMCA 1FYTB 2EYRA 3TO4B 2XKSA 5DUBA 3O0RH 3V4VH 4BYHA 4FXGB 2DJ4A 4I8DA 3LS5L 4Y4FC 5D72H 1R3JB 4OV5A 3EDDA 3RVVD 2FSEA 1W0WA 1T0MA 1T1YB 1KC5L 2QQQA 3MZGB 3NPZB 3R06B 1C1EL 4X98A 2GHWB 1ZMYA 5E8NB 2X4OA 2FYYA 1KIPA 1AD0B 1LHZA 3WO3B 3TIEB 1TJHH 5D5MA 1LO3L 2HT4C 3L95B 2YUWA 4WDIB 3S88L 2DWDB 3RX5A 2A6IB 3N1FC 5HJ3A 3VWJD 2NXZD 5T1KB 1F58L 3QRFM 1YYLL 2BY3A 1YQVH 1DVFB 2AXGA 2PYEE 4WTZA 2HJKA 1S7UB 2IADA 4M6NH 4UILL 3E1F1 3X13B 2Z31C 5JUEH 5L88L 5AUMB 2R0WH 5I17A 2GQHA 1HHGB 2CMRH 3VRIB 4P2QB 5JXAL 5IVZA 1AGDB 2WQRA 4XHJD 2WBJA 4FFWC 4NNXB 3QNZA 1XGTB 3QXAA 2NTSP 3QZWA 3ARGC 2EC8A 3HMWL 5DSCA 1K5NB 1NBYA 1CLOH 2D9QB 4YBHA 2OLDA 1U58B 3D85D 4TNVF 1K6QH 4Z7NF 3T2NH 4O9HH 3UTZB 4HGMA 3QHFL 4K9EC 2GUOA 1FLRH 3IJSB 5I8CB 2Z8WC 4YK4C 6CGTA 4GFTB 1CDCA 3GFUA 4JGJA 3VGBA 4PJ7A 4Z7VE 2JJSA 4N0YL 3FJTA 3MMEA 4Y7MA 4V1DE 5T1DH 2R29L 1CICA 2HVJA 5D2NE 3KR3H 3T8XB 3S37X 3TC9A 3ES6A 3MA7B 3V52H 4KQ4L 3LKQA 1G7LB 3N85L 1XGRB 4JFQB 4EN3A 1ZTXL 3PP3K 4TUOA 2VLKA 4Y5YC 5KS9A 1CLCA 2XZAH 4D3CH 4JCLA 1CIUA 1OP9A 5FYKL 5E8OB 2EO1A 1DBKL 2V7HB 4PJXF 1ZLWK 3IU3A 1MCNA 2VLJD 3MRIB 4U1LB 1A1NB 1OP5K 1QTYT 3SJVB 1EEUA 4LVOB 2R8SH 5IEHB 4F58H 4N9GB 3U0TA 2W0FA 2XNAA 2C1OB 1TTFA 3JTSB 3OV6A 1QO3B 4Z95H 4AG4H 1I1FB 1MELA 4K3DH 4FQXB 1EUUA 5DRWB 3QIUB 4MQXC 3W2DH 4MSWA 2XTJB 2YHGA 1FN4A 1A22B 4DTGL 4X80L 1NBVH 4LSVH 1SJXA 4U0QB 2HH0L 4R26L 1PKQA 2FZ3A 4MCZB 4BQ9A 3UROR 4JM4L 3EFDH 1UYWL 2MJWA 3SDAA 4OKVB 1K8DA 2HFEB 4NP4L 3EYQD 5C2BL 3GMPA 4J3TA 1JIBA 3GI8H 4YX2H 4ERSH 2MSPA 4D94A 4BK5A 2JJTA 2BVTA 2UZIH 3DMMA 1HIMH 2WP3T 2EC9T 4ETQB 3MRJB 4EUPB 1YJDH 2VKWA 1LNUA 3D2UB 5CJQL 3MJ8A 2L7JA 4NN5B 2D7QA 4NQUA 3VI3E 4ALAL 5LWYH 1ZHKB 1FG2B 4R4BA 1L7IH 5DJYB 2CDEA 1KTLA 2Y6SC 1XH3B 4I9WE 1KCRL 3BPOB 4PP1D 3LRSB 3AREC 2EZ0D 2AEPL 5HHOD 2ZUQB 4HIEB 3P30L 5BRZA 4I18A 4YHNB 2L0DA 3ESVF 3VG9B 2BXZA 4H0IA 1NLDL 1IL1B 3KS0J 3IAGC 1CXKA 1OSPL 1G1CA 3L3GA 2XG4A 5EO0B 2IEPA 2AEWA 3JTTA 5DK2A 2XKNA 2WUCH 2ADJA 2OX5A 3HPLB 3I84A 4K7PY 4JPKH 4ORGA 1RV6X 3ZDZF 3AU1A 1NAKL 3BP6B 2WIMA 1KXVC 3G5XB 3OR6A 3FQTA 1FGNL 5GGVL 4DKFL 3OG6B 1OGAD 1YEKH 3MJ9A 3AS0A 1JRHI 3IDUA 4PJIB 3MFFA 4D0BA 5D5MB 1CFQA 5KSBB 4C55A 4CADA 2VO5A 3JWDH 3WIHL 9CGTA 5T33L 3DLQR 1QBBA 4PJCA 5D7KD 2J1KA 2Z31D 1QRNA 4I13B 4NZUH 4EI5C 3THMH 4HIIB 4JO3L 2DWEB 3S9DB 4WWID 3GMPB 5IHUH 4QNPF 4OV6F 4G80B 3LMJH 4U3CA 4YXKH 5C0JB 1C5CH 1WWBX 2DQFA 4U1GC 1H3PH 2FECI 4RQQB 2AI0H 3P3YA 2FD6L 5CD5D 4LPTA 1GGYA 4ZFFA 4OTXH 4OLYH 2J5LB 5DJ6A 4OGYL 4ZTOH 3UJTL 1UH4A 1XF5A 3L7FB 1EHLH 1YY9D 1NGPL 4JPVH 3B6SA 4APQA 2PW1A 1M7IB 5E99H 3RFZC 1F2XK 3MOAH 4XVUD 4AT6B 2HG5A 2O5XH 4JRWA 5IJVA 1CLYL 5JW5A 4JO2H 4O4YH 3HI6L 1LO0H 3JV6A 4NCC2 3VGHA 5H2BA 5HYSB 3TJHD 3IRPX 3IFLH 4UINH 3KYNB 5E2UL 5GGUA 5FYLL 3TJEL 4JJHA 3CH8A 4PJXE 5KVGL 5BRZB 4WEBL 5ENWB 3NFSL 1KB5L 2NMSA 3TZVA 4NQCA 1IAOA 3KXFB 3LQMA 1HHHA 4HW6A 2H1PL 2HN7A 4YAQB 5E8PA 5KVFL 1PLGH 2JCCA 4XAKE 5GJSL 3K7UA 4M5ZL 1NEZA 4OIAA 1YEGH 4DJMA 3HZMA 1BJMA 1U8PB 3GHBL 1FIGH 3CK0H 4JFDE 4XPFL 5EDXA 5IMKA 4MJIA 4XGZA 5AG9A 2PTVA 3JWOL 2OXGA 4K3HA 3ARFD 25C8L 3HUJB 1HH6A 3BKYH 4M1CC 2XXCB 4RFNB 3IVKA 1ZSDA 3V6OC 4H20L 2Y5TB 3RHWF 3V5KA 2EDYA 1AQKL 4F37K 3LS4H 4NQDA 3C9NA 3TF7C 3L3KB 4CJ0A 4M7ZC 1Q72H 2VYRE 1VEPA 2CPCA 5LQBL 1MRFH 4HMEA 1PW3A 3CLEL 5IB4B 3JUYA 4UOW0 1N59B 1Z3GH 1MFAH 3BW9A 3T0AA 1NGQH 3MODH 1DN2A 1NFDE 2AGJL 1YEDA 4JO1L 2CK0L 1AIFB 4PRPA 4QWWD 1EEZA 3E2HC 1NKOA 4HWUA 2B1AH 2NY5C 4Y4FD 3QI9A 1KCVL 4MX7A 2CJUH 1MHPH 1SEBB 1DQLH 1JK8A 5EC1A 1J0ZA 3QUXC 1FE8H 2HJFB 3BKJH 2Z93A 1QSFA 4Q2ZA 1KTDB 3C2SA 1U8HB 4NRZA 2NY7L 1BBJB 4X7FC 5EOTA 3OXRA 1MAKA 1FVCA 3DBXA 4P57A 4AIZA 1FO0L 1TZIB 2X4PA 3SDCD 1M05A 3IFPB 2A9NL 3MPCA 5E2WL 3BVNB 1CFNB 2CIKB 4NZRL 2X44D 3RZWA 3UBXI 5K9OB 4HKJB 4ZUTB 3X11B 4NCDA 5E8DL 4OQ1A 3D9AL 4M6MH 2FX8L 2FJFA 2R9HD 4Z7VB 3M45A 4OZGA 1P7QD 3RNQA 1OY3B 4XP6L 2ESVA 4UUJA 3O41A 2EEDA 3VFRB 3KNBB 1VERA 2DIAA 3QCVL 5M94B 1ZHLA 2W9LA 4F9PA 2FR4A 5FYJD 4ZFOA 3C8KA 4OCNC 1FGVL 1HINH 1RIVL 2WWMC 3OX8A 3AM8C 3DUHA 4PB9H 5GS0C 2AV7A 2QQNL 1S7XA 4HSQA 2VXVH 3QPXH 3GO1L 5HXMA 1T03L 3FZUD 4L4VD 2W9EH 3S34H 2GTWA 3WIHA 1D6EA 3P0VH 4IS6A 3LQAH 4YC2C 1ZHKA 4HF5H 5EBLA 1IGML 2WNGA 4MDJB 5DS8A 5JOFB 3RWFA 3AFLA 4XPHH 5ESAB 4L4VE 3FB8A 3L6FA 1MAMH 4GKZB 4JG0H 4D2NA 1NCWH 1RUQH 2W38A 4LF3B 5D1QA 1A2YA 3VFTB 3SE9H 2VWEC 3QIBB 4RGOL 3FQWA 4YHNA 3GKZA 4JCMA 3UDWA 2NXYD 4YQXH 1JTOA 3HE7A 3OJDA 4Y4KC 3PXHA 3GIZH 4DVBA 2Z8RA 5EOTB 3H9YA 3LEVL 3QUML 2E7HA 3LIZH 4QO1A 5I1LA 4OI7A 2WINB 4G6AC 4KPHH 4D9RE 3MYJB 2ICEB 8CGTA 4KI1A 4QTHB 1T2QH 5IKCA 2HTLC 5CHNA 2AJUH 3EO0A 3ZKXB 3UTTD 2O5ZL 1HSBA 3KPRA 5BRZE 5L2KE 5EZLB 3NIGF 1DUYB 4J8RB 4OGZA 1QSEB 4Z8FH 4DGYH 1AD9B 1AGEB 2YPKA 5SWSD 3ARDB 1NKRA 5K9JL 1ULVA 1XEDA 2LQRA 4PJCE 5KN5A 5DUBB 5IG7B 3MJ7B 2ENYA 4NZTH 2YZ8A 5SWZE 4W81A 3UC0L 4OLVH 4JFFA 1F3JA 3O6KH 4D0CB 3MRFB 5HHQA 2PR4H 1ZLVK 2VN7A 1HI6A 4PBVC 1NCCL 3HZYA 4LDEB 2WP3O 3C08L 3MROA 2E9BA 2AK4E 2EEBA 3MRLA 4PFEA 3RVXD 4XNZB 1JYVA 3A6OA 1HHHB 3AB0B 3QEQA 2AKRA 4PJ9B 3VWKD 4XNQA 5H94A 3ZDYF 4PLNC 4XNXH 4UDTB 3SKNB 1IGJA 3N06B 3V4PL 3SKOB 5C8JB 5EU4B 2PW1B 2VSCA 2V7NB 4R8WL 4Z0XA 5IMKB 4HWBH 5FO8B 1CS6A 5AD0A 3NBNA 1OGAA 3RWFB 5CD5C 4K8RD 4W6YB 2NR6D 2ZCHH 5JMOC 4G9DB 3GM0A 4OCSH 4LOUD 1JGUL 2PO6D 2XZCL 1UM6H 5KS9F 3Q1SL 1OP3K 1RFDL 1FL3A 2VABB 4HPOL 2P5EE 4ZPVA 1U8MA 2Q76A 1U3ZA 4ZAKB 2WBJB 1LK3L 1NLBL