4F3FB

Crystal structure of msln7-64 morab-009 fab complex
Total Genus 42
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
42
sequence length
220
structure length
220
Chain Sequence
EVQLQQSGPELEKPGASVKISCKASGYSFTGYTMNWVKQSHGKSLEWIGLITPYNGASSYNQKFRGKATLTVDKSSSTAYMDLLSLTSEDSAVYFCARGGYDGRGFDYWGSGTPVTVSSASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVEPK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Recognition of mesothelin by the therapeutic antibody MORAb-009: structural and mechanistic insights.
pubmed doi rcsb
source organism Mus musculus
molecule tags Immune system
molecule keywords MORAb-009 Fab light chain
total genus 42
structure length 220
sequence length 220
ec nomenclature
pdb deposition date 2012-05-09
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4f3fB01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4f3fB02
2BSTA 3GSQB 4BUHA 4NQEE 5FECB 1YMHA 2R0ZL 3PWVB 4JQIH 3BQUA 1NFIB 2AEPL 4AM0A 5DS8A 1HYRC 4Z95H 5C0ND 5IEKB 4YGVA 1QPXA 1MCQA 5KAQF 5ETUA 1TZGH 3CX5J 1WCBB 1R5WB 1VKXB 5E8DL 2P5WA 3ALPA 3WUWG 4PJCA 1BJ8A 4MAYA 3DLQR 3DVFA 1X5XA 5KG9B 4QCIA 3L5WA 4MCYA 4X0KA 2AJZB 5TDOB 1WAAA 3MNVB 4RMTA 4LOUD 5C86A 1L7TL 4JG1H 2VR5A 3DMMA 2P8MB 5KSBB 2HRPH 4XVSL 4FQXA 2PYFB 5CHNA 4LLWB 1HEZB 1WWWX 1SEBB 4NPYB 5E2WH 1RZJH 1ZHBB 4Q9QH 3GB7B 3VFRB 1BD2E 2MJWA 2YN5A 5KG9A 1QLEL 4NQCD 1WBZA 4Z7UA 4R4NC 3FFCA 1MAKA 3R06B 1KOAA 2BSRB 5LXGL 4ODXA 2EDQA 3MRKA 4CVZA 5T3ZH 3GSNL 3QUMA 3QUXB 4JG1L 5EOQH 1E4XL 2YD3A 3V95A 4HWZB 4LGPB 4POUB 3SQBA 4DKEH 5F7YC 2BHYA 1NDMA 3EOYG 3RWDB 3VMNA 1HCVA 43C9B 2ZOKA 1DEEB 3KPRA 1JGDB 3JWOH 1AD0B 2GIYA 4QT5B 4HF5L 1J8HB 3REVA 5EIVA 3MLUH 1YN6B 1ND0A 3OAYK 4OCXH 4I0CC 4KVCH 5FDWB 3MLWH 4OV6F 2BNQD 4YXLL 4L9LB 5ALCH 4KQ4H 3MRHA 5KVDL 5JLZA 1V7NL 2XN9D 3GSQA 3F7RA 1WT5C 4ELME 1UA6L 3L5IA 1CGYA 4XPGL 2A0LC 2DBJA 4FMKA 3ZO0A 3HRPA 3O6LL 4HC1H 1KEGH 4NZTL 2F15A 4S1DD 4XPTL 5DVNA 1LO5B 6FABL 1MREL 2W0FB 5DHYA 4BK4A 5B8CC 1NBVH 1KIQA 3WKNA 4PJ9C 3TVMA 5F8QC 3SOBH 3UAJC 5IROA 1R5VA 2K3TA 4GKZB 4OM1L 4D0DA 3V52H 3C2SA 3REWA 4V1DE 2Y07H 1IAIH 2GUOA 1MCDA 4KKCC 5IEHA 4JDVB 2VZ1A 2XG5A 4IM8A 4HIJB 2D31A 4FTVB 3QI9A 3B9DA 1KCVH 5LQBL 2EEBA 1IBGL 2AERT 5D2LE 4OI9A 2RCSL 1UKTA 1Z9OA 1DQLL 1BZ9A 4ZPVA 3OL2A 3IJYB 1KEMH 4XWOC 1JHTB 4NJ9H 5CIPA 4B7LA 1A47A 2MOVA 3O45B 2NCMA 4JJ5A 5FKPB 2HT4D 4R2GC 4HZLA 2X4OA 3W0WE 1R3KA 4EI6A 3QXVA 2HWZH 1RIHL 4U6HB 3V6FB 1YY9D 4Z7OF 2R4RL 5IB5B 1A21A 4G7VH 3MBXL 4ZXBB 1NC2B 4G43A 2E6QA 3CDGB 2GK2A 3GIVB 4ODWA 3M07A 1RFDL 3RTQD 4JQVA 2NXZB 3P11H 1AD0A 3EDDA 1A6UL 3KPRE 4K3DL 2NTFA 2HTKC 3CIQA 1ZGLM 3V0VB 1EFXA 3DIFA 4ZFOL 2APTA 4GAGH 3QDJA 4WENB 3O0RH 3U30C 4HX1A 1Y6KR 4S1QH 4BELD 1XGYH 1AQKH 2EIZA 2YD5A 1OAKL 4LMQE 1JHTA 4TVPL 4NN5B 4AEEA 3MLXH 3O3AA 4XP4L 4AYFA 3I9GL 3MBEC 1KIUA 2NY4D 3VFVA 2M2DA 3QIBD 3VFPB 1LP9F 1W2KT 4ZQKB 2HFEA 4DGYL 3S88L 4LCCC 4M5ZL 2Z8SA 4FZ8H 4RMQA 1S7XB 4OSUL 4XNZB 4NO2A 1K4CA 2HVKA 4HUVB 3B8SA 4NSKB 4O2CB 1PY4A 3OKDA 3TN0A 4ODSH 4JZJA 3NCJL 2O93L 2VXSH 4IMLB 5DJZB 1YEJL 5ESVA 2JJTA 5F9OH 5AG9A 5DRWA 1KXVC 4S11A 1X4XA 3NABL 3O8XA 1Y6NR 3ARBD 4JO3H 1Q0YL 3C5JA 3O3UN 2XT1B 4HPOH 4LSSL 5JW3L 1Q0XH 3EYUH 3S6CA 5BVPH 4AENB 4D9QE 3VW3H 4PJ7F 3ULUE 1MVUB 4JE4B 1CFTA 1N8ZB 4NQEA 4PBWD 3HI1A 3REWB 1YMMA 3W0WD 1YEIH 1T66C 1W0VA 3BMVA 4X5LA 2NY3B 4XVTH 4GLRI 2R15A 1EUTA 5JPNB 1NBZB 1FVEA 2F53A 2JTDA 4OJFL 3N1FC 3BDYL 1T1ZB 3VGAC 4R2GD 5C0DA 3VXNB 4PJBB 1G7QB 1YPZB 3CFCL 2DIJA 4ZAKC 4MAYC 3C2AL 1E6JL 5DT1H 3VXSA 4NZUL 3BP6B 2PXYC 4M6AA 3O2VL 5DMGC 2UY6A 4QF1A 4RAHA 1AR1C 1QLEH 1Z6JT 2YA0A 3BT2L 3PXJA 1ZLSL 3C9NB 2VLRD 3ES6B 2EE9A 4PGDA 4G80A 2XZAH 3QP3A 1EMTL 4P5TD 1T1ZA 4IOFC 2Q7YB 5FHAL 4E42B 4NQCA 4JANA 3LKNA 4ZDHA 3B5HA 5KSUB 2D03H 1U8OA 4P23A 5DSCB 3ZE1F 1TVDA 2VL5A 4AEHL 3UDWC 2WWMC 2BVOB 1EGJH 5DA0B 1GSMA 3T3PE 5I15H 5SWSA 4XNMA 4CDHA 4P9HH 4HS8L 3PWPB 5KS9F 4Y5XC 2HG5A 1TJIL 2VUYA 4FXLA 5TQ0L 2VMFA 3R4DA 5IM7A 4NQDE 4LLMB 5E00B 2NLJA 3QHFL 4GQPH 5CEYA 3KAAA 4NO3A 8FABB 4WI5A 5GGTL 2YC1B 4OCWH 2VABB 4U31A 4JRYB 1ZA6B 4NZTH 5E2JA 3L3GA 5MI0C 2ICEA 2OR9L 4P2QE 2X4TA 1JWMA 5JMRA 4P3CL 1NBYA 2FJHB 2R2HB 3H42L 4PLKC 3GBMH 2GYSA 1RK0A 2YD8A 1AHWB 1U93B 5SV4A 2QEJA 1AO7D 1M4KA 1ERNA 3WXWL 3ZDXE 3G6JA 2E7LA 1EA9C 1FL3B 5BW7A 1UB6B 5JDSB 3WD5H 1ORQB 1BD2A 1KCVL 3VD4A 3MR9B 1PX3A 1LEIB 3QRFM 3BDBA 3KYKH 1G7PA 2E6JA 1FO0A 2KZ1B 4LNRB 1M7DA 3BPCB 2FHFA 2FEDD 4BSVA 4GKSB 4NN6B 3VA2C 3ZE2E 2IADA 3E6HA 4LSSH 5FYKH 3P3YA 4XNXL 4WJ5B 4PJ5A 4MXWH 4N8VA 5DI8A 3TWCH 2EXYD 5EPMB 4UTAL 1IC5L 1NGPH 3TH3T 3BH8A 3SDXF 5I1JH 1FL3A 4WI4A 4PJDA 1OT1A 2X10A 3QULB 4PRPE 4ZO8A 1LK2A 1R6VA 1JHLL 5F9JA 3H9HA 3MV8D 3DO3A 3FHAA 4KDTA 4WU5A 4H8WC 5GZOC 1D6EB 3FRUA 1P4LB 3GMMA 5DTFA 4X98B 1UA6H 4Z7OE 1UXWA 1OB1A 1LMKA 2VAAA 3MRBA 4HGKC 4X6FB 5H35B 2R1WB 3OV6A 5FHBL 4CU8A 3MOAH 5D72H 4XP1H 2OL3B 3VD3A 2WBKA 2Q6WA 1FFPA 1ADQH 3ISWA 4TVSa 2D0GA 4JQXC 4OZGE 1E27A 1IE5A 4Z7VA 5L2KB 4UT9H 3TJEH 3UTQA 3I02B 3HAEG 3LSOA 4LCYA 4F7PB 5K9OB 1QR4A 3SBWC 4KK5D 5T5FH 1M6OB 5IFHH 1MFEH 4YDIH 4OI8A 3UPAA 3QQ4A 1HHIA 4KJWD 4PJAB 4FQQB 4AL8L 3S35L 3L7EA 4TUKL 4JHZA 5BS0B 4K3JH 3O6FD 4N0FB 1B9ZA 3MFGB 3QDMD 4F9LC 4RGMB 2M8XA 2VYRE 3T08A 5EULV 3ULVC 4JFFA 4UILL 1IQDB 4NRZB 3M8OL 4ZG1A 4DVRL 2V5TA 5CWSB 5IFHL 3KLHD 4OF8A 4KRMB 3GKWH 1EMTH 3KHOA 4FRWA 1KNOA 2BVQA 3MA9L 3NIGE 3QT2A 5E8PB 4WFHE 3T1FB 1Q72L 2I25N 1ACZA 3JTTA 1ZEAL 4MB5A 4H88H 2A6IA 3G6JB 3HKFA 1T89C 4HBCH 1JZ2A 1K9TA 4UT6L 1HQRA 1N6QL 3LPFA 1HHKA 4AIOA 4ZD3L 4M48H 1KPUB 1T7XA 1P4BH 1X5YA 2CUIA 1UM6H 2DTML 2DQGL 3VGFA 5T33L 5H35A 4MJIE 3F7VA 4HLZG 4JKWA 3W81A 1QRND 5D5MB 3P77A 3UJJL 2A2QT 2YPLE 3A6BH 2B1HL 3GMPB 2JLLA 4KI5E 3F58H 4FABH 2XPGA 5I1AB 3LN5B 4HDIA 5CEZD 2QBWA 3KPPA 5HVWA 4M43L 4PB0L 3QJFB 4F2MB 5DFVD 1KB5A 1UZ8A 1P84J 5ID0B 3MRLB 1HHGA 1JPSL 5DJAA 1DLHB 2FHCA 3JTTB 5DGRA 4RMWA 3NIDF 2B7DT 3NFNA 4JFXB 1ZHNB 1U3ZA 5SV3A 4G6KL 1MCFA 4DGVL 1NAMH 1IM3B 2EIDA 2BFVL 3P9LA 4F7EA 5JIPA 3C8KB 3QUMH 1L4IA 4Q58C 2XPGB 5I1AA 1U2HA 4XRCB 4P5TA 1XAUA 3V7AG 1BVLA 1AHWC 3MCKA 3WSQH 2CR6A 1ZHKB 4PV8B 3MOBH 5D7SL 4PRBB 1A6VH 3SDAA 3UYOD 1XGRA 1A7BA 4ZOAA 1RJCA 2EC9U 5H94A 3S36H 1N6VA 1PJ9A 5L8LB 2QL1A 1T5XB 3O9WC 4OJFH 5HY9B 5KVGH 4WI8A 2XFXA 3ET9F 1U8PA 4PS4L 2X5PA 1IAKB 2AJXH 4JFEE 2ATKA 5TGBB 1AD9A 3H2WA 1BP3B 2YWYA 5IMKB 2P5WB 3OQ3B 1M05A 2VZTA 3W11C 2ORBH 4F7CA 3L5WB 5A2JH 1CF8L 1D5MA 4P49A 1NC2A 1JK8A 4Y5XB 1FC1A 2V6HA 4HK0B 3UEZA 3GBLA 4JJHA 4X7SL 1KV3A 3ILPA 3EOAB 1HSBB 3QNXA 3MUZ1 2FJGA 1CFQB 5CJXA 1BQHB 5J6HA 4MLIA 3PGCB 1RV6X 4LVEA 2VDOH 5KZCD 3VGDA 4PJFA 1FQ9C 2DM3A 4UOW0 3ARFD 4YIQA 3PWNB 4MJ5B 3HC0B 3FFDB 5EZJB 1WAAE 4IJ3C 3QEGL 4WNQB 3QFJD 1FN4A 4M7LT 2CLZA 4PJ7B 3FQRB 1J8HD 2YKLH 1V3MA 1RMFH 3HI1B 4MA7H 5GS1C 1CR9H 3IDYB 5H37G 5I1GH 5M95B 3WYRA 1HZHH 2NW2B 1LDPL 3LIZL 4QRRA 1P4BL 5JMOC 4OLYH 4Z0XA 4LK4A 3GRWL 1UJ3A 4K7FA 4B0MM 1MELA 3OJMB 2I5YH 4PJ8A 2JCCA 1XIWC 1HXYB 3NCBB 4IHOB 4LCWD 1BFSA 2ZOLA 5EUOB 4BA8A 5EB9A 3G5XA 2Z8VC 5D93B 3EYFA 5A1AA 1DQJA 1CBVL 1VFMA 3TYFA 2X4UB 1MVUA 4F8TA 3HG1D 1WICA 5IMLB 1BWWA 5GSRA 2LVEA 1QSEE 5T1KA 4PJEB 2IALA 2IH1B 3P30H 4QRRB 3GZKA 3LHPH 4M7JL 4Y19E 1HILA 1WBXB 3IDIA 3RY4A 3RPIA 2IJ0C 3CLFH 5HHNA 1CXKA 1I7RB 3P4OA 1YDPB 1KCUH 4FQ2L 2JB6A 1AKJD 2HG5B 1IFHH 4Q2ZB 5ACZA 4N9GA 4S1SL 1MCOH 1QLRB 1T04A 5HHQB 3HE6C 3C6LD 3OR7A 4BFIA 4DGIL 4WUUD 4MS8D 4RNRA 1CZ8H 1YJDH 2WUBL 4HKJB 1MWAL 5JIHA 2B2XL 2EIBA 3VG0H 5BZDA 2YPVL 3HFML 2EDBA 3CFJA 1U8MA 4NN5C 3WFZA 1CQKA 1H15A 4MXVE 4EUPH 4Z7QE 4WHYG 5JXED 3HI6H 4BSWB 3OZ9L 2W65A 3NCMA 15C8H 4U05A 1GGCH 4JN1H 4LQ1A 2VN7A 5IBUG 2BNUA 4RIRB 3GSRB 1CL7H 2NY4B 3VWKC 3LKRB 1FP5A 3DV6A 2APWA 5CSZA 5JDSA 2NY6B 5AEAA 4EI5D 4GAGL 1EEZB 1CGXA 1IGFH 1NFIA 2FBOJ 3BUYB 3CH1B 5CD5C 3BW9A 2GAZB 1ZAGA 4ZXBA 5CD3B 4QHKJ 1TMCB 1U58A 3DJ9A 2BVOA 4G7VL 5DD6B 1VGKB 4QRPB 2CUMA 5C0BB 3ZYOA 4N0YL 3IDGA 1RZGA 4DOHE 2DBLH 3EZJB 4M9PA 1S7RB 3IFNL 4Q0XH 1UXSB 3R1GL 1X6LA 2JIXD 4LPWA 1QRNA 5I8EA 1AC6A 2X40A 3FN3A 3I85A 1GGBL 4M1DH 5EORL 3RNKA 3BQUD 5D7IB 4WCYL 1F4HA 4BQCA 1CLOL 8FABA 5IT2L 3SDXE 5FUOL 5EWIL 3RDTA 3FAWA 3RWIA 1CFSB 1V05A 4GS7C 2BC4B 5EC1B 3ZSTA 3IFNH 1A14H 1KT2A 1JTTA 3TC9A 2RFXB 1K5NA 5C71A 2KUTA 5CAYB 1MFCH 5DDHB 5C0GA 1WBZB 2DOCA 4XBEL 4MX7B 5JR1L 2NX5B 2FX7L 5I8EB 4LRNH 3MNWA 3L95A 4HIEA 4Q0XL 4DGVH 2DYPD 2XQBH 4LCUA 4DFHA 1RZGB 5I8KL 2JK5A 1FZOA 1JPST 1RUAH 4R90H 5J0BA 2HH0L 2QKIA 3HC4H 4HQQL 4LCIH 2ZCKL 1YNTB 4DEPC 2EYRB 4JN2A 2P48B 2Q7YA 1KT2B 1XGUA 5KS9A 2OZ4L 1BIIB 1S7QA 5ESQA 4XVTL 4GRLA 4G9DB 5C3TA 1NSNL 2EXWC 2DN7A 2I9LB 1F2QA 3N9GH 4MQ7B 4GW5B 3QDME 5L2KD 2Y7QA 1JN6A 3JSSA 1T6WA 4Q9RH 5FUCC 4J8RA 5SX4H 3BD3A 4G6FD 1VENA 2FLBT 4YXHL 3SKOB 1E6OH 3HR5B 4WW2A 2FATH 4PJBA 4FQ1H 3RZCD 2HJFA 3O9WB 4HV8A 4RGNE 4KVCL 3IAPA 2X09A 5BXFA 2M26A 3QQNA 3RWGA 1QSFE 3L3KA 1XGQB 2WUBH 3O6FB 5IQ9B 2WINA 4ZSOE 4OF3A 1A6UH 2HLFD 4TNWK 4YNYA 2WWKT 1RZKC 3LKOB 1R5WA 1VKXA 4I18C 1N0XH 4KKAD 2Y4SA 4K71B 5ICYB 5INCA 1HZHL 5D1ZA 4Z7VB 4UT7H 4W70A 5GJTH 2PUQT 3PGDB 5CJBA 1MH5B 2ICWA 3OKKB 5GSVA 2AGJL 1VACA 4L4VA 3L7EB 1QSVA 3DROA 3AAZA 3EZ8A 1N3NA 1GPOL 5HGHA 3I2CH 3K4AA 1ZHLA 2DQCH 4DKFL 2R8SH 4L5FH 4ONGL 3HZMB 3IU3A 1TZIB 3S88H 5TPWL 5IG7B 2EZ0C 4G42A 1CG9A 2J2ZA 3UAJD 5F7DB 1YEDB 3EGSB 5CJOH 1MRFL 3BX7C 3TYGL 1CBVH 5CJQH 3W11D 3VJ6B 4DAGH 3S4SG 2J6EA 1FFNB 4FTVE 4J4PC 1ZXQA 3QG7H 2A73A 4NKMA 1Q9WB 4MNGB 5IIEB 3ZKND 3QR2A 2EDJA 3GIZH 5EPMA 2A0LD 1S7WB 4UDUB 2NZ9D 1OWWA 3UYRH 2BRRL 3SKJH 4MQXC 4MJ4A 5ESAA 1D3CA 4X6EB 5T3XL 2VABA 1P7QB 3Q0HA 3N1PC 4YE4H 1BFVL 4AK1A 1Z0MA 3IXTB 4U3HA 2G75B 4JO4H 1CLCA 3PWJB 2A6IB 2LAGB 2A73B 1QR1A 3DUSB 3ALWA 2YSSB 3QFDA 1Q9KA 2W91A 5EO9B 2X4PB 1CDYA 3RAJH 4I3RH 4MQTB 2J5LB 3SBWA 1I1CA 3CFKA 1MWAA 4GMSL 3L3KB 3LS5L 3SDYH 4LKCB 4U7SA 3TIEA 1T5WA 3BJ91 3RU8H 4N8CH 2EICA 5BOZG 1X7QA 4ZTPL 1LO5A 5IQ7H 1PSKH 3CVHA 4M1DL 4AJ0A 1U8IA 4ODVH 3ARDA 4KU1A 2ZUVA 1UKSA 4OT1L 5ANMB 3TA3D 3O2VH 4CMMB 5ADPH 3L6FB 5DD5L 4F9LA 5T3ZL 4PRDA 3UJTL 4XAWL 3BDYH 1KUMA 2D7MA 3BIBX 1H3WM 4WUKH 3REVB 1ZTXH 2UYLB 5C0IB 2XZQL 2NW3B 4ZUTA 2MCPL 3TN0D 1VPOH 3GJFB 3U7YL 2P1YA 2A6DB 1A6WL 2I07B 4FFZH 5DHVH 2EDDA 4YHOH 5BW7C 2OTWA 1ZT7A 3QO0B 1RUKL 3QCTH 5EZIL 1IILE 2O5XL 5C07D 4U4BA 3F7QA 3QDGB 3QWOB 1NGYA 4Z78A 4ZXBD 2HFFA 1VHPA 4YXLH 3VA6A 3ZLQC 1HH6B 3GUTB 5ISZA 3WEXB 1CVRA 4XCEA 5HHOE 4YQXL 1RPQA 4GJTB 1L9NA 4Y4KD 2GCYA 4YEEA 3MUY1 2E9JA 4HK0A 1VFAB 2HKFL 1T03H 2WW8A 5E8NB 3BMWA 3QEQD 4E9LA 3LQMA 2OX5A 3CUPB 4PRPA 1EO8L 3SPVA 3WLWD 4EEEA 2V7NA 3AC0A 2V5RA 4OZFA 5IMOB 4NO5A 4D94A 4PJ5E 5KSVB 4G8GD 5E2UL 4BKLB 1DQML 3GJEA 3TM6A 5KVMC 3VFTB 1DANU 4X6CB 2E7MA 3UXFA 4BK5A 1SVCP 4MB4A 4F37K 5FAAA 3QFJE 3DETD 3C60B 3G5YA 2RR3A 4R7NA 4GW1A 1JUFB 4YBQD 4TSCH 1S5IH 4ONHA 4L8DA 4X5WA 2NY0B 5F7MC 3ILQD 3MODH 2HVJA 1ZOXA 3PUCA 3BP4A 2UZIH 3UTTB 3WFBH 5E2TL 3ALXA 5I30L 1KELH 1T21A 4NC1E 2W9EL 3ROOB 4JFOA 4WV1B 1FL5B 3CSPA 3TO4D 3DX7B 4BSJA 4YHIB 5J8OA 3MCLL 1NFDF 4UAOC 3LV3A 3KYMB 3H9YA 4YHPB 1IGMH 1F58L 1M7IB 4HIIB 4J23A 2OZ4A 3BP4B 5KOMC 3VXMD 1BD2D 4TTDD 3O6KH 4F15C 4WFFE 4GMSH 1KXQE 3HUJE 4QCIB 2R0ZH 3RWFA 1DUYB 2BOCA 4D0BA 4R7NB 1FJ1A 4EUPB 3RZCA 1IKFH 3FO9A 3UTOA 2P44B 3W39B 2H1PH 4GRWB 2R0KL 7CGTA 4JRXD 3BP5A 4NBXB 1VESA 4DW2H 4ZAKB 4R2GB 5DMKA 1GRWA 4L3AA 4LLVB 1T3FA 3KPMA 5D7LE 3QCVL 3DSNA 3QRGH 4Y4KB 3I6KB 3MV8A 2BVPA 3LEXB 2EDOA 4RRPA 3OR6B 4HWEH 1O7SA 4LP4A 3QUML 3ROLB 2FYYA 2OXHA 4HIJA 5IW1B 4AT6A 4N9GB 4PLOB 3SDDB 3WMSA 3W9EA 1D9KB 2EYSB 1TLKA 3V6ZB 4NBZB 5DA4A 5C2BH 1HK6A 1HH6A 3GUTA 5DJ6B 1YEJH 1TETH 1FGVL 1GHFL 5BV7B 3TV3L 4W6YB 1SJXA 3GJFK 5D70L 5SX5K 2IFFL 2RB8A 1LO0L 1MJ8H 1D7FA 1BQLH 4U2ZA 2NY6D 4TN9A 2EE2A 3TBSB 2VDNL 3K2MC 1BBJA 1C5BH 4PJ9B 4YFEA 3RNKB 4PJ8C 3WJLC 3RGVD 3PJSA 4ENEC 1F4WL 3P2TA 4P46B 2FH8A 2BK8A 4QYOA 4KHTH 1OAXH 5C08A 2VDLL 4YE4L 2PNDA 2XQYG 5IJKC 1NPUA 3S97C 5D7JA 3WHE1 1RI8A 3U4AA 1IZJA 3JUZA 4KXZH 3ULUF 2IFFH 2DM4A 3V8OA 3OAYH 1YMMB 4I0PD 4G7YL 3HHRB 1H3PL 5IMMB 4KRLB 4D9RD 4PJHE 5F3BB 4KROD 2FX7H 3PJSB 1MLBB 4FTVD 3GSRA 5E94A 3MBEB 3QPXL 1AJ7L 5J6GA 3BUTA 1MF2H 2HH0H 4UTBL 4GRLD 4WI9A 1CFQA 4UBDC 4WEBH 4B7IA 1I1RA 2QQKH 2GQHA 1XF5A 2Z93A 2DQEH 3LB6D 5TE7H 3FFCE 4G9DA 2UV3A 3GO1H 1UJTA 4OUOA 2VDOL 4LLYA 1UB5A 3VXUE 4PB0H 1IC4H 3DRTB 3E3QC 1XT5A 3OGCB 1A7PL 4OD1L 3SGKA 1QOKA 5IP4A 1BFOA 1QTYT 4LKXB 1LE9A 4JFPA 5MHSE 1WFTA 4LHJB 2LTQC 3K46A 2I26N 4JO2L 3S3SA 5ACZB 1G7LB 2IAMB 2IQ9H 4U7MA 3MNWB 5E2UH 4B53A 5B39B 2X4OB 3FQUA 1LGVA 2FSEA 4L29B 4J3VA 3W39A 1R5IA 2PN5A 4XPHL 3LQAL 5J6GB 4Y1AD 5I15L 1K3IA 4KQ3H 2NXZC 1FRGH 2VDPH 2FO4B 4QHLB 3HR6A 1JI1A 4XCYB 3M17A 3BVNB 1XGTA 2DICA 5IFAL 1YN7A 5D1ZB 5J7CC 1QHPA 3ARBC 4H1LA 1YNLH 2VE6A 2SEBA 1JNLL 3TYFB 2YD6A 3OKLB 1U95B 2EYSA 4MCZA 5GS1B 4YPGA 2F8VA 3FONA 4QTIL 1MCWM 4ZOBA 4UDTA 4WDIA 1XGUB 4F58H 5IGXL 4K9EL 3NIFF 1I3UA 4YBLC 3HNTL 4L4TA 1QEWA 5DQ9A 4QHUB 3PQYA 3RWJA 4X7TA 5CZXC 4DZ8B 3UROR 3W5MA 1DL7L 1H9VA 1LO3H 1PLGH 3C09C 4F7EB 3NFSL 3T0WA 4EN3B 5DJXB 5D1XA 5JPMB 2DI8A 3ZE0E 3QIWD 4U6XB 2Z35A 1G7QA 1YPZA 3OXSA 4V1DA 1UH3A 4PLJD 4NNPH 3QA3A 3BESR 4OCSH 2GSGB 4N1EA 3OPZL 3S3JA 3V0WL 3MUGA 1XR8B 3DX8A 1IVLA 4PRHD 4U1SB 3TBWA 1LP9B 3EO0B 4ETYA 5DDHA 1I1AD 4YDLB 3CSYB 4JFDE 4LPCA 2H32B 5FV1L 4NQDA 1UEYA 3LRHA 1T6VN 1FYTD 1BVZA 1JWSB 5FFLA 4K3HA 3ZSSA 1AGEA 5FECA 1P7QD 1A6TB 5GGSB 2DQDL 4J1UA 3GRWH 1LO0H 1MJ8L 3X12A 4OZIF 3MRCB 4RCAA 3D0LB 4MXVF 3VXSB 4JFFD 1LEKA 3FT2A 5ANMA 1Y18B 5ELIA 2F54B 3EYSH 5BCAA 3HZKB 5T1LB 3IKKA 5BMFH 1RY7B 1BLNA 1SJHB 1OGAA 4KK9C 1A14L 5TQ2L 2NR6D 5IWLC 1MCBA 5IHLB 3VFMA 2ICES 4M00A 2Q86A 3LRGA 1P2CA 4TSCL 4HJGB 1A9EA 4R7DA 4KZDH 3Q5OA 2CIKB 3I6GA 1U3JA 4HZLB 3DXAA 5DEGA 3GMRA 4PJIB 4OLEA 3F5WA 3VWJA 2GW5A 2CPCA 4GXVH 5J1TC 2VXVH 3HLAB 1EV2E 3ILQC 4OB5H 3GMLA 4HPYL 2IANB 4UV7L 3KYNA 4N9OB 5JDJA 4HKXB 2VQ1A 4LARH 1FE8H 2HT2C 3DYPA 3QDGA 2MSPA 2ZKHH 4XCCL 3P0VH 4P2QD 2P8LB 4IRZH 4YDVA 3O9WD 1PEZA 3EOBB 3U9PL 1FBIH 2I9TA 1FORH 3LS4H 5LGKA 2KQMA 3EYQC 4LGSB 3P30L 4HKZA 2YA1A 1JRHI 4NYLB 5DK0A 5SWZA 5FUZH 4NBYB 2AABH 5EZOL 5D7JD 4E41B 1FZJA 5D5MA 3ARED 5JXAL 3NACL 4LVOC 1OAUH 2XV6B 3WIHA 1OL0A 3EOBA 5ALCL 4RMVA 5BRZA 1I1AA 2WMPA 1JF1A 1N5YL 1IKNA 1N5AB 3QAZC 5KVEH 1N59A 1JFQH 1FFQA 4MDIA 4RQQB 1UWGH 5IW3A 3FRUB 5TFSH 4LDLB 4WUUA 4OZ4A 3HAEB 1BD2B 2Y06H 4RFEB 3MJ9A 1T1YA 3IS0X 2V9TA 3PHOA 1UM5H 3C87A 4E41A 2FECL 1U0QA 2K1MA 3VFGH 4TRPH 4U1JA 3QQ9D 1LK2B 5F9JB 2F58H 2VTFA 1WZ1H 2UY7A 4Z7NE 4LQFL 2OJEA 4YDKL 4GLRH 5L8JB 4JRXB 1N3NB 4BZYA 4RGNC 3MLSH 3T4YB 2Y06L 3SE8L 3TBVA 3GK8L 5I17B 2IADB 3S34H 4RGOH 1A6AA 4KGJA 4QWWD 1G9MH 2D0HA 1KBGL 43CAA 4HAGA 3BD4A 1E4XI 1I8LA 3MRGA 3G5ZB 1UH4A 1D5XB 5F1KC 4XNUH 2ZPKL 4HIHA 5IJVA 2Z92A 3QWRA 2NTSP 5DRXB 1KN4H 5ID1A 1RURH 1OPGH 2DWEA 3VGEA 4KFZC 4JRXA 5HYJE 1BX2B 3MYZA 3VFMB 2K9UA 4PIRF 1EUUA 1K8IA 4HJGA 4GG8B 4JFDA 4BFEA 4YPJA 5HI5C 4OZGF 1CT8B 3QH3A 3KR3L 4X9BA 3W0WA 2BRRH 3WL9A 4L3CB 4PR5A 4HS8H 4AH2A 3P11L 2EYTA 5GS2D 1A7OH 1NCDH 3LRSB 4XNQA 3SGJA 3MROA 3ARBA 4S1RL 5I73C 2DDQH 5FK9B 2XI9A 3N1GC 5BV7C 1VFBB 4P5KA 2GTWB 4LASL 4PYHA 1G9NL 4JKLA 2LVCA 3CGTA 1ZLWH 3CFDB 3KNBA 3ZKNC 5DVKA 4NRYB 3OAUH 4JPVL 4YHYB 2F74A 2P8PA 4YIQB 5IHBA 1HHKB 3RAJL 5T5NF 1Y0LA 1BZ7B 4KRPB 3ARFA 1EGJA 2GHWB 5C0JA 4R8WL 2DQUH 4I0PA 3W0WB 3HNVH 3HPJB 1I8MB 5LAXB 3HMWL 4QXTA 3MV9E 1EZVY 2ATPB 4GAYB 1S9WB 3RGHA 4L8BA 1UVQB 4CBPA 4YHLL 1EDQA 3QHZL 3FZUD 1U3HD 3U0TB 3H7BB 3QUXD 3TO2A 4MCYB 7FABH 3F7YB 4PTTB 3MRIB 1HXMA 4JQVC 2EH8L 2X4NB 4MA3A 3RUGA 4AIZB 3LOWA 4C58B 3FCTA 4LIQE 3HNSH 4PJDF 5KVFL 1GZPA 2P42B 5A3ID 3TFKC 4ERSH 2NX5E 4UNUA 5ALBH 1HEZA 1IAKA 5F1SA 1P84K 1NFDA 4HW6A 4UAOB 4K94H 2P8MA 5KSBA 2AEIT 3V5DA 3LKSA 1AY1H 4BSWA 4TUJB 1FNGA 5FGSA 4WWKA 1PKQE 2GFBB 3FB8B 5JPNA 1UZ6F 1H5BB 3TLRA 2QQNL 3MJ9H 3N9GL 4QRQA 2P5EB 3MJ7A 1C16B 2XWBB 3L9RB 2D9CA 1HHGB 2B39A 5IB3B 1VFAA 1GZPB 2RCSH 1UFUA 2Q7NA 2HT3C 4ZQKA 5IJVB 4L3EA 3T8XB 4GRMA 5ISZB 4Z6AT 5D71L 3CX5K 3PWPD 5T1DH 3UCRA 1PVHA 4DKEL 1AFVH 5FM5M 5K93A 1IFHL 3AREC 1YEEH 3O6ML 1K85A 2CMRL 1LO4H 3D2UA 5E9DE 5KSBE 5DTFB 1RUPL 4X9GA 2XQYK 5TH2A 4PJHF 2EDFA 1MPAL 4MNQE 2V2XB 3GNMH 2MFNA 5GRZA 1T7ZA 3U0PB 4M8QB 4K3GA 3CDGA 3GIVA 1BWMA 5T3XH 3CD4A 5FUZL 3ULUC 1I9JH 3BP7A 4U1IB 3DV6B 4PJDE 1OW0C 1AGCA 1EBPA 3I9GH 5A2KH 4ZFOB 5JOFA 2P49B 2R0WH 1UG9A 1WTLA 1IAIL 4TNVF 4APQA 4LP5A 2VLJA 1HQ4A 1U8HB 2NY2C 4OQTA 5DXWA 3DX6B 5D1XD 3TYGH 4UQ2A 5JIIA 3BRDA 1M7XA 3MA9H 3W9DA 5JQ6L 5L88L 1MCPL 5EC2B 1EAPA 1MEXL 1LQSR 3RKDD 1HYSD 2PO6C 1ZA3A 1J8HE 2YD1A 3V6OA 5E6IB 4UILH 5IKCA 4DCQB 5D2LF 4ESKA 2VE6B 4OTXL 4LGRB 3HE6A 3OKMA 4WEUD 2QQLH 1C5CH 2ESVE 3L3DB 4HMCA 4QGYA 3S9DB 1DBKL 1TCRA 4G5ZH 4NQXA 4DTGH 4I77L 1CCZA 4JM2B 2YBRB 4KHXH 3RGVB 2E3VA 2DDQL 2XY2A 5E1AA 4BYHA 2O5ZH 5L0QC 3IDNB 5E5RB 1IAMA 1QVOA 2XZCH 1T66D 4NGHH 4NZDA 5J1AA 5MEPB 3MRHB 3CFJB 2HVKB 4Y2DA 4HUVA 1CDBA 2FYYB 5I71C 4X8JA 1MNUH 1FNEA 5IQ7L 2OK0H 4QEGA 4DUWA 1Z9SA 3M45A 5C07A 4MS8C 4K3EL 4LLYB 2VDKH 4JFED 4TSAH 5HYQA 4PLJC 2VDMH 1C5DB 1S5HA 5DJCB 1D5BB 4HGMA 4X6CF 3B9KD 3O4LA 3U0WL 2Z4QA 1OD7A 3O6LH 5EDXA 1KEGL 2ESVA 2FGWH 3HMXL 3T2OA 3JV0A 4YO0A 5FV2A 3VCLB 5BS0D 2F19H 3MQIA 4KUCF 4P5MB 2EKSB 1XF4A 4YHYC 5J12B 5FA4B 4WO4A 5CZXD 1NSNH 1DE4B 3QI9B 2F58L 4OZHB 3GJFH 1ED3A 2PTTB 4MMXC 3E3QE 5LBSL 4KDWA 4YDKH 1MFNA 1L9MA 2ZJSL 5HHOD 1Z9LA 1RZJC 1F4XH 2OP4L 3ZL4H 1IGYA 3MV7E 1JYVA 3K3QA 3HCVA 3WN5B 4LDOB 5GSVB 1MFAH 1GZQA 3HS0B 4CNIB 5DEFA 1L0XA 5TFSL 4ZPVB 5HDOA 2W60B 1LEKB 4RISH 2Y1VA 2VNCA 5IVNA 1KCSL 4OM0H 5D1ZD 3PIQA 4XVJL 4BH8B 3FQTA 4ACPA 1QFHA 3C08L 1EAJA 1YY9C 1CDCA 2W65B 3WN5A 1OAQL 1S9YA 4OFYD 1CD8A 3U46A 4HWNA 4MDJB 4HXAH 4HULB 4XGZA 4LU5L 4OZGB 4L8CA 5C09B 3DURB 4XPHH 5MEOA 2W07A 4PJCB 5B39G 1HQRB 4M8VA 4KTDH 3V4VH 5HBBA 1NMCB 3DWTA 4V1DB 4M6ML 1A2YB 4TOYL 1AE6H 1NUDA 5CSBA 4Z76B 1EEYA 4QLRA 5E2TH 2QSTA 5E5MA 4YFLF 2BY3A 4UV4L 1CL7L 2J5LC 4XNMB 2X9YA 3ULSB 1WT5A 4YO0B 3LN4A 1C08A 3UTZB 5KS9E 3CSYA 1YNTA 2CDEA 3KPOB 4RAVB 5A40E 3NN8A 3WDIA 2VL5B 2CO6B 3T0EC 3WNLA 2LE9A 2NX5D 1WWBX 4NFBA 5EBLA 5KSUA 1W0YT 3NZ8A 3Q3GA 4I3SH 4M5YH 1W72H 3WNPA 1P1ZA 1AQKL 2X41A 1TNMA 1FLRL 1G9EA 1P69B 1A3RH 2C1PB 4PRHB 3S3PA 3BEWA 2VDNH 1CFTB 4LVNC 1RJYA 1NBVL 3STLA 1LO3L 1PLGL 4TUOB 3GBNH 2VXTH 3ARRA 4PB9H 3MV7D 4HUMB 1GOGA 3RJQB 3D0VA 3WDHA 4DKDC 4MA8H 4PRDB 1Z0NA 4KI1A 4ZTOH 3TIDA 2QV2A 4ALAL 2Q20A 2CLVB 5C08D 1EEQA 3TJEL 2FGWL 3LQZA 3ZKXB 4M62L 5C6PB 3TF7C 2QQQA 2AS5M 1T83C 3I50H 2AK4D 1A1OA 3HPLA 4OGYH 3MZGB 4XBGA 2W0LA 3U4EA 1XGYL 4GRWF 2GT9A 1T0MB 5DVMA 5HGDB 4GS7B 1U8QB 5D8JL 4NDMB 3EYUL 3RY6A 2QHLA 5BVPL 3GSVA 2B4CC 5H8DA 3O81A 3GKZA 4L8SB 4M1CD 4CW1A 5EU6A 2EC8A 2YHGA 4OIIH 1BVKA 1A6WH 4M02A 3MRGB 1V7ML 5T1MB 3HG1A 3D3VB 2EO9A 2JE8A 5IG7A 3RTQA 5FF6B 4D9RE 4MWFA 3GRWA 4HHAB 5CGTA 5T1KD 1TPXB 4XNXH 3WS3A 3TEUA 3SGDH 5E94B 3QUYA 2EYTB 4YJZL 4MNGA 4XP6H 1WZMA 1MJUL 4HIXH 2YUZA 4Z18A 2X1PA 1CL7I 3H9HB 3PGDA 3RFZC 4I2XB 1JPGB 1KCSH 5I1IL 2PYEA 3ARGD 1KYOJ 1KB5H 5CEZE 1P4LA 5DD1H 5FM5O 4CU6A 1ZSDA 1KB9J 1UYWH 4UINH 4PJHB 4QT5A 4IBLT 1HWHB 1JNJA 1Z5LB 3VRLF 3VXOB 4RA3A 3VDCA 3GGWB 3U48A 3H0TA 3U1SL 4XB8A 3AREB 1MI5E 1R3JA 3C5ZC 2IC2A 4TUJA 3GSUA 3V4UH 4NJAH 5IB1A 4PJBE 1EO7A 3RTQB 3SDCA 3T77B 2D7OA 5AYUL 3GHBL 1BPVA 2P43B 3CZFA 5FYJL 3K80A 3H9ZA 3HLAA 2MQ3A 1AIFB 1XZ0A 5IK3A 2QHRL 2XN9A 3DMMC 5GGRY 3U7AA 4H0IA 1M6OA 3B2VL 3G5XB 1FYTE 5JTWA 4EJ1C 1OCWL 2AK4A 5F9WB 3PL6B 1FC2D 3GSWA 4JG0H 4NQED 3PWLB 4XPFL 3BYTA 1YEHL 5HHVL 5JIKA 4WEBL 1I9RL 1VDGA 3QWQB 4KV5F 1LO4L 3BRGC 4N8VB 3VWJC 2D7QA 2F53E 4N0CD 2LABA 3GO1L 3WIFA 1CD1B 3S98A 3PWNA 1KIPA 3SQOH 5F1IA 5ERWA 1N5AA 4KI5D 5DMKB 1TDQA 3GMPA 1WF5A 2NY5L 3SE3C 2IPTH 4LIQL 3WCYA 3C5ZD 5IM7B 4IIQB 3HZYA 3OB8A 5ICXA 5DRZA 1J12A 4XZUB 4X6DA 4NCC1 5HYEA 1BEYH 3LMJH 3ARBB 4L9LA 3UTPD 4W4NA 2DQFB 2X4SB 5GZOD 4KZEH 2R0WL 2P5EA 4WEMB 4S1SH 5KANG 1QKZL 4ISVA 1A1MA 1DANT 4NRXA 4OCRH 5F6HI 3WUWA 2R2HA 4L4TD 4LIQH 1CLZH 5CJ8A 1B4RA 1FLRH 5JW4M 1KACB 3KPTA 1R3HB 2NY3C 1NUFA 5DURB 1JZ5A 5E8NA 5IFJB 2PR4H 2D3VA 2A83B 2HMID 5I0DA 4PRBA 1JNHB 1M71B 3OZ9H 3F58L 4FABL 1F11A 1UWXK 1QHOA 5C2BL 1C5BL 2WBWB 3MLUL 4KVNL 5SWSD 3B3IA 3M1BB 2DD8L 3OSKA 4K7PH 1X5HA 3P0VL 1XEDA 5GHWL 5C0CD 1R3LA 5HHXL 4JFXA 5FO8B 1JUFA 3LKQA 4HJ0D 4KTDL 1HSAB 2VC2H 5KSVA 4PGCB 2FCBA 4KRPD 3FTGA 2BNQB 5FIEA 3QISA 5F9WC 2FDBP 5EFIB 3BAEL 4HBQA 4PLNC 4JFDB 3HZKA 5FA3B 4PRPB 1CI5A 3HE7C 4FA8A 2VITA 4XNZC 3T2NL 3IETB 3PDDA 1WK0A 2NXYD 4DN3L 3ARSA 3PHSA 3M17B 4O00A 1F8TH 2ZKHL 2FHBA 1KGCD 1J0ZA 1J0YA 1B4JL 3B9KA 3M8OH 3BRFA 1YJDC 4P5KB 3HE7B 5EG6C 2L7JA 3QSKB 1CLOH 3TCLB 5C9JB 5GXBB 3V0WH 4KKNA 3W5NA 1LK3H 1VFBA 5D6DC 4NWTH 2C5DC 2AJUL 3SE4A 4X6CE 5E03A 4P46C 1EFXB 1S7TA 3DIFB 2V9RA 3BOVA 3QQ3B 4Z7UF 1HKFA 2L0DA 3NCEB 3TVMD 5I16A 4F37F 2ARJB 2J8UB 3Q1SL 1ED3B 3BPLC 1MFAL 1ZS8B 5EUKA 4GOSA 4MNHA 3LN5A 4HDIB 1KJ2A 2WLZA 2R29L 3B5TA 3CCHB 4I13B 4NNXB 4UOW1 5MENA 3AU1A 2ZUUA 1RSFA 2BP3A 3IDJA 1G7MB 3VFVB 4JPWL 4DKAA 2ZUQC 3MJGX 4ORGB 3D5OF 4QXUH 4M3JA 1F4YL 2IANE 2R0LH 4WO4D 5DURD 1KTRL 5C92A 1F90H 5I1DB 4MB3A 5C0FA 1PYWB 3DVIA 4MA7L 3EO9L 3ELAT 4ZAKD 4MJ6A 5FHBH 4MNQD 3V0AC 1CQYA 3T09A 5DZNA 5HVHB 1DP0A 2XZQH 4OF0A 5F96L 3TNMB 4LSRH 1JF5A 4Y5YA 3JV4B 1BGXH 2P5WE 2ZG3A 3EDFA 1H8SA 3K1DA 2YPKB 5HHMB 4D0CB 1I7UB 4HCRA 3DUUB 4OCYL 3C5SB 3EW3B 4MZ3A 5DJYA 1T2JA 3BN9D 5AWNL 5I1EH 5I8OL 3MLRL 3QUYC 4XMLH 3S5LA 3KWWB 4JFFE 1NAKL 1KC5L 4Y4HA 1JPSH 1V3JA 3IT8D 1XF4B 1EHLH 3I6KA 3MV8B 2WBJB 5E9DA 1NLBL 4N0RA 5DHYB 2QSCH 2MMXA 3MRJA 3WFHB 2NYYC 4M93C 2LQRA 1F6LL 1R3IH 5GGVL 1B0GA 4J12A 5DJ6A 2IFGA 1A7QL 5DJYB 3KPLA 4GG6A 3LZFH 4K94L 4WW1A 5GRXG 2W1NA 3AY4C 5E6ID 5C08B 1KBGH 5GISL 4RGMC 3QBTB 5EN2A 2EDXA 2OTUA 3BKCL 1ZS8A 3QIUB 3TVMB 1ZE3C 4MJ5A 12E8L 2J8OA 1NLBH 1PKQA 4WHDA 2JB6B 3JWOL 1ODAA 4MDJA 3CVIH 2GJ6E 3ZKQD 4FN0A 4M62H 3MBED 3PF2A 1OF2A 5GS0L 5CCKL 1L6ZA 1MCPH 4OLUL 2AJYH 4NQSA 4NKDB 1XF1A 1A6TA 5FDWA 3FQXA 4FFYH 1NBQA 5I8CB 3BD5A 3BQUC 3RX8A 2E7HA 4X6BB 2CLVA 2K7QA 4LSUH 4LAQL 4MQSB 1GC1C 1IGFL 4ZYKA 3U1SH 3CVHH 4LSDA 5C6TH 4LBEB 4NM8H 4Z7WA 3MV9A 5F6IC 3UBXB 4XPAH 3U36B 4U6VL 2CK0L 3KPSB 3WHXA 4FQXC 1U8KB 2VDQL 4NOBA 4OKVA 5CSGA 4ODUA 4GW4B 2BSSA 2IGFH 1XGTB 3LKRA 1JZ3A 4V2BA 4I18B 1FGNH 1UVQA 1DTUA 2BY2A 2V9QA 1MFBH 4O4YH 1ZWIA 1MFEL 1DZBA 2VLRA 4XX1G 3WN5C 5F93C 3N50A 3W2DL 1MY7A 4MVBC 1F6FB 2FGZA 5HHXH 3BJLA 3IFPA 5I66A 1NANI 2C3HA 3IFLH 3NGBB 4JZJB 3TT1H 2UWEA 1U8JB 4P2QA 4IRSB 4PGJA 2EYRA 4JN2B 1K2DB 1U36A 3BKML 1OAZH 4ZPTB 5DUPL 4PJ7E 2OTWB 4CN1A 2MKLC 4L4VE 3TVMC 4HUXB 4LCUB 3OXSB 5FO9B 2H2SC 2DRUA 3SCMB 5D4QA 2IEPA 3P40A 5L2KE 1V8HA 3I3DA 1EJOH 4JREB 3ZKMD 3X13A 4DN4L 1JJUA 4G6AC 5JHLH 2XKNA 4GAJH 4DQOL 3LMJL 1BBDH 1FNFA 1L7IL 2QHRH 1K5NB 3U4BL 2IMMA 5DRNB 1ZLUH 4DGIH 1FSKC 4B5EA 4IMKA 4M93B 5EU4A 4GUPA 2IWGA 5DQ9B 3MREB 3SGEI 4L3CA 3RIAK 1G6VK 2E9BA 4GH7B 3CUPA 3C6SA 4F58L 5C0DB 5IGXH 5JHLL 2WP3T 4Q9RL 3HCVB 1B2WH 2M1KA 4PRIA 4RMRA 1CDJA 2GAZA 5JPMA 3MV11 4XHJD 2AAVA 1WC7A 5EZLB 2VZSA 2OI9B 4HIHB 4U1MA 2JJSC 1U2CA 4X5WB 1QA9B 2HT3D 2VLJE 5C70A 4Q97A 4QRTA 3F7PC 3Q5TA 3QNZB 4JDTL 1QBBA 3BWAA 1CT8A 1A6PA 4KTEL 3CPLB 4YAQA 1BOGA 5C0BA 3A6OA 3TZVB 2R9HD 3KXFE 1MNUL 2AXHA 3LPGA 2YSSA 3QFDB 1RK1A 4S0TD 4WWID 1AQDB 3DVNA 1EEUA 1ZA3B 1NCUA 1KLGA 4P3WA 4PJDB 5EZJA 2O61A 2FX8L 3SDXA 3IAQA 4LLAA 1MJ7H 4M03A 4NNYA 1X7QB 4NN6C 4J3XA 1L7TH 3FL7A 4U3XA 2IAND 3DBXA 1QA9A 1H0DA 4UQ3A 3RVUC 2W92A 5HJ3B 3RBSA 2XRAL 4FNLL 4ZS7L 4PS4H 2JJWA 4LSTH 1FYHB 2NXYB 2VQUA 2V5YA 1U92A 5FF6A 3HB3D 1BM3H 2Q3AA 4ONFH 1W72A 4GFTB 3QIUC 4ELKA 1R3IL 4JO4L 2OL3H 1J0IA 2DLEA 25C8L 3CC5A 3DI2B 3MJ8A 5IF0B 5IMKA 5J12C 1GIGH 5FCUH 1AXTH 2DIBA 3TA3B 1JV5B 4JHAL 4DK6A 5JZ7D 2Y36L 4N0UA 1JPTL 2ZCLH 4DEPB 1LNUA 1DBMH 2Z91B 5JW5B 1M1SA 2BY0A 1A7PH 4OD1H 1INQB 3JWNC 1NMAH 1NCCH 2V7HA 3TJHD 1CE1L 4G6MH 4LCCB 1BZ9B 2EDKA 4P48A 3ARGB 2ILLA 4JO3L 4U1HA 3FO2B 1MUJB 4LMQI 4PRIB 3IFOA 4GRWE 4ZXBC 4MD4A 2HJKA 2PYEE 3DOSA 4XH2B 3S4SB 2FECI 3G9AB 5E4IA 2HKHL 5LGJB 3O6FA 2DM7A 5ECJE 3QO1A 4RAUB 4MNGE 5HGDA 3VXQA 1FNGB 5EZOH 4OAWA 3H9SA 4KPHL 4R96B 2O5ZL 1E0OB 3QPQD 1JPGA 1QFUH 1HHHA 2J88H 4FS0A 4UB0H 2AKRB 4WY7L 5IV2B 4Y4FC 5J3HD 4PRNB 4QRTB 4XCNA 4NC1C 1B0RB 2H32H 5FDYA 1JWUA 4Z5RB 1CE6B 4K9EH 5IEKA 5F96H 1SM3L 5A16B 4U1NA 5BOPA 3RWEA 4ZNEE 1GH7A 4G8GB 1DVFB 5J9PA 2FBJH 4H25B 1HIMH 5L9DL 2EDEA 2OXGA 4IRJC 4NQDB 1JMZA 1KN2H 1DBJH 3HTLX 3NTCL 3R0NA 4DVRH 1GOHA 3NBNA 4FP8L 4O5LH 4EQ2A 1BJMA 3NAAH 5T33H 5TE4H 5J11B 2OR9H 4QXGL 1KB5B 3BGFB 3ZTJH 5I1HL 1GGUA 4XGZB 1YUHB 4TYUA 3HUJF 2DQFA 4RSVA 1NDMB 1WZKA 3UZQA 2IPKA 1YMME 1H3XA 1ZKAA 4YXKH 1F00I 2ZUQB 4LPTA 4OUUB 4Y4HD 1OAQH 3U83A 5HPMA 1PD6A 3MCKB 5C0AD 4YX2L 1CN4A 1EEYB 1S5IL 5EU7E 1CE6A 5CKGA 4XCCH 2DQIH 2ADFH 1RFDH 1G7JB 32C2A 4PY7A 1HOCA 1MY5A 1DCLA 1SMAA 1HN1A 1A8JH 5TF0A 2J8UA 3A6CH 1CD1A 2B4CH 3LV3B 3H7BA 3BEVB 3QG6B 3IJSB 4QXGH 3VXMB 4CJ1A 2AXFA 2WAHA 2AJ3A 3SJVE 2AV7A 2WQRA 4QTHA 1XCTA 3V8CA 1VEPA 3LD8B 4L5FL 1KG0A 2YRLA 4LHUD 1WBYB 3T0VA 5I1CL 2FEEL 1P5UA 1PBYA 3T4AA 2CIIB 3UBXG 4RX4A 4JGMA 3OGOE 4OV5B 4DUVA 1JHKH 1IZKA 4OIBA 1QBMH 2A77H 1F3JA 5F71A 3I6LD 1C16A 1C12A 1ZT1B 1BREA 3IDXH 4N0FA 4BJLA 1GJIA 3SY0A 2PYFA 1ZLWK 4X6DF 5LGJA 5J13C 3QWOA 1D9KD 2P7TA 2AI0H 1O5DT 4FQCH 4HH8A 1K4CB 1V5JA 3KR3H 4PRHE 3IJSA 1C5DA 3QZWA 4O2CA 4JZOA 4WU5B 2W38A 4KK6C 4HGWA 4CN4A 1ZT7B 4EI5A 4TSAL 5D7SH 3CXHJ 2H2PC 4ZYKB 3ECBB 5DUBA 4DVBA 4K2UL 4L8SC 3RDTC 4B41A 4H1LB 5BZWA 1DEDA 5DS8B 3F62A 2GY5A 4POZD 1KJ2L 4RFEA 3MFFB 1MHPH 4Z78B 5GGUB 3IJHA 4UIKH 4RZCB 1GHFH 4YHOL 4P4RB 1XH3A 5FB8B 5T3XE 2IQAA 4PBXA 1E4XH 1I1AC 2AXJA 1PKQB 5HPOA 2JCCB 3NA9L 1ITBB 4FQCL 2V17H 5IW6A 2RAMA 5FM4A 4ZS7H 2IGFL 5LBSH 4QKXB 4F57H 4Y5YC 1S7UA 4JO2H 2V2XA 4F7MB 1A6AB 5DFWH 5DD5H 1DBBL 25C8H 4C4KO 4QRRD 1HHJB 2Y5TA 1T4KA 1I4FB 2Y9RT 3W9DB 2ARWA 4Y2OA 1TQCB 3K8KA 5CBEA 1KTLB 4P4KB 4RRPG 1BF8A 1I7TA 5E8OB 3MLYH 4QGTA 4GQ9L 4A2MA 1UC6A 5C9JA 4HFWB 5DJDB 5DUPH 2AEQH 4JVUA 4PJFB 4ZS6C 5ENWB 5GSRB 2KKQA 3GMLB 3IJYA 3QEUB 4Z7WE 4IMLA 4MNQB 5D7LB 4ZFOA 1HHJA 3RWCB 2YMXH 2XXMB 4IRSD 1RUMH 2R1YA 4OIIL 3BP7B 4JAMA 5ADPL 4QHNB 2XZAL 4DCQA 3OKOB 4XWGL 3IKCB 1BF2A 4Z76A 5HYSG 2FJFA 3OR7B 4BFIB 2GI7A 3D69A 2BY1A 3S37H 4NYLA 1RZKH 4M7LL 2A9NH 2HN7B 5AYQA 2BVPB 4L4VD 4TQEL 3IS1X 5L2JB 1X5JA 3IDMA 3NN8B 4IOIB 3FO9B 3KYAA 4R3SB 4LLMA 4R6UA 5E00A 4RGNB 5C2UB 1KULA 2QADC 1KFAL 2A9MH 2KL6A 1KJVA 4LDEB 4XTRD 1RVFH 1XH3B 2DS4A 1VEOA 5FB8A 1F02I 1TCRB 1QSFB 1D5MB 3RA7L 3WS6A 1KPVB 2VKWA 1QNZH 1YECH 4PJIE 1FAKT 4EN3C 4X8XA 5SX5H 3BT2H 5GQBA 3GMRB 3OMZA 4MJIA 4PG9A 1I7ZB 3MXWL 1OQXA 5IW1A 5I75B 3KXFD 4M7JH 1KC5H 1PY9A 3QUZC 5D2NE 4JY4B 1S7RA 1FVEB 2F53B 4S10A 4E0RA 3CSGA 1B88A 1I8IB 4WDIB 5DLML 4WW2B 1T20A 1X5LA 4YHNA 5F88B 3ES6A 1ZHKA 3NPZB 3Q6FB 4JPVH 3WS6C 2ORBL 3BPOB 1BBJB 3C09B 1MLCA 3BKCH 2NY1D 2GSIB 3FO0H 3V5HA 1V7NH 4JVWA 3C6LC 1QD0A 4LF3A 1HCFX 3K74B 3RVTC 4G9FD 1OSZB 3MRCA 4BZ1L 3BZEA 2ADFL 2VISB 3HS0A 2H6PA 4I0PC 1WJ3A 3NZHH 3L3IA 3QXUA 1AXTL 3VI3E 1GGIH 1T20B 4GBXD 1AP2A 3B6SB 5CGMA 4G3YH 3ROLA 1RZ8A 4ZS6D 2HJFB 5D2NA 4WY7H 4KAQH 3PIQB 4BH8A 5J06A 4OT1H 1BM3L 4ONFL 1MRDH 3X17A 4BZ2H 1OSZA 4AENA 2C3VA 2NY4C 5D6CB 3ZDZE 1HWGB 2OJZL 3VG9B 2XN9E 1DQDH 3BZ4B 4AIXA 1RIVL 3BP6A 4CDGC 4LSQL 2QQNH 3MJ9L 5CZKA 4Y8AA 3WHXB 1CDGA 1Q1JL 4LSPH 4WCYH 5FGRA 1OOAA 3B9VA 2G9HB 4PJXA 4LASH 1R5IB 4PUBH 4CU7A 4M61A 1IAIM 4HJJL 4LEOA 3U6RB 1ITCA 4JFHE 4N90E 2X1OA 3QUYD 2HWZL 3ZE0F 5GGSY 1EO5A 3U7WL 3N1QC 4WU7A 2QQKL 4E42A 4C83B 1DQDL 3S8WA 2CDFA 5ANME 4OCMC 5K9QI 4PJAA 3HNSL 3MGOA 4Z0BH 1U8LA 1LEGB 4YDIL 2DWEB 3EYSL 4ODXB 1E28A 4OIAA 3EYOA 3DGCR 4MCZB 5C7XH 4YHML 5GS1A 3S37X 2HKHH 4U6YB 4H5SB 5C0EA 1QUNA 2ADIB 5EC2A 4DZBB 5B38A 4HKBB 4PJAF 4HS6B 1IQDA 3IRPX 4F8QA 4UIKL 4XRCA 1FV1A 3QDJB 1BGXL 3WHE0 3VFNA 4PRNA 4XCNB 3AS3A 5HI3C 2NY1B 3FB6B 3B5GA 3PV6B 1F42A 1UWEH 3ARXA 3T04D 1G0DA 5ESVB 4UIMB 2MQCA 4JY6B 4A2LA 4Q7DA 4KKCD 2X89A 1U6AL 3MX0A 1OB1B 3MRBB 1OM3H 2IG2L 3GK8H 5D93C 4Z7NF 2VO5A 1EEZA 1F90L 1KYOK 3OBAA 2X4PA 4Y5YB 4P3DB 4Q9CA 4IDJL 4X4XA 2UZYB 4G8EB 1G6RL 3G6JF 3MXVH 5JUEL 4GMTL 1RUPH 3ZHDA 1I8KA 1KIRB 4LCCA 3ZMRA 4OM1H 1B2WL 4ZUSB 3I75A 1WUNT 4NZUH 1RULL 5T3XD 4YLQT 5DJ2B 3PV7A 2B20A 2VZVA 5E2VL 5T1MA 3WXVL 1KPUA 5EZLA 1NAML 1J86A 2APBA 4P0DA 3MRRB 1N7ML 1J10A 4KWUA 1CICA 3OKLA 3WLWC 3AVEA 2A6KA 1NGXA 1ONQB 4X9FA 3AY4A 2Z9TA 1OHQA 3HE7D 1GGIL 2VIRB 2UYLA 4F15B 4Y4KC 3U4EB 4G6JL 5FKAB 1I9EA 2F54A 1RZIB 2EKSA 3TO4A 2YD4A 3CXDL 3P9MB 1FHGA 3ZT7A 3HPLB 3D48R 2ZCHL 5JQHC 4PJAE 3AS2A 1M7DB 2Y6SD 3KLAA 4MA8L 4NRZA 1G6RB 4XT1C 4M7LH 5EA0L 3TZVA 4XBGB 2Z0BA 1FL6B 1UXWB 5GGRA 1ZVSA 4AG4L 3R06A 4R26L 3TA3A 3GSXB 1KLGB 1WZLA 5D7IE 4X4ME 5EUKB 5INCB 4Z0XB 4LPYA 3SDXB 2OLDA 3IDJB 2DQDH 2DQUL 1P5VA 1RIUL 3IETA 3LD8C 4N1HB 5EIIB 5T5NG 3VH8B 4XP5L 1CFNB 1CU4L 3E2HC 4IOSD 4CKVX 3KJ4C 3BIKA 3MLYL 5DMIL 2NY7H 1ZA6A 4DWHA 4S1QL 4D3CL 1EJ6A 2ICEB 4XVUC 3MRLA 3TA3C 2FX8H 3AROA 1GPOH 1PG7H 1RVFL 2A74B 4F7TA 1A4KA 5D7KE 5FOBA 2BSRA 1NKRA 1X44A 1SVZA 3MO1B 4S1RH 2PW2B 5BJTA 3OXRA 3B9KB 4XP6L 2MTPA 5C6TL 4PTTA 4ONHB 4JHWH 2B1AL 2MHAB 1G0XA 3T4AB 1YPZF 1MRCL 1DBAL 3GFUA 2G2RA 1MHEA 3O11A 2XKUA 4KTEH 4PG2C 1XCTB 4Y5XA 5T1LA 3HPJA 3HMXA 3PL6D 1FE8L 1AGBA 4OZFB 5AG8A 1MIEH 3PDGA 1V7MH 4PREA 4ZOCA 1U8HA 2P8PB 2VLJD 4NWUL 4HWZA 3FO0L 2X4RA 3F7YA 1DVFC 2BX5A 2XFXB 3DMMD 3RWDA 43C9A 1MHHA 1DBBH 4GG6F 2HTLD 1AKJA 1DFBL 4EVNB 1QACA 4ZSOB 3LN9A 1BVLB 4D0BB 1CD9B 2OP4H 4LRIC 3H3PH 4ZUWB 5KW9H 2IPKB 4PREB 5ICZA 5LGHH 5IV2A 3WIFB 3VFRA 3QIBB 3OX8B 4O2FB 5IROC 2ERJB 2PETA 1WISA 1XGQA 3X3FH 3LPWA 3D2UB 4N8VG 4GUPB 3SE8H 1S9VB 3DRQB 1JTOA 3OKNB 3E2HB 1II4E 4MHHG 4OAWB 4R96A 3TJHC 4WVRA 1SJEA 3CLFL 1H8NA 3CLEH 2X4SA 2DL2A 4P4KD 1KCUL 7FABL 4QF1B 5C07E 4XMLL 5J1AB 5MEPA 4EXKA 4LCYB 4F7PA 1LILA 1T7YA 3K8LA 1W72L 4KQ4L 3K4DA 4HFUH 1QFPA 4OCYH 5MEQA 2ARJQ 1NC2D 3FMGH 5FOBB 5JW4R 1ZTXL 4ELMF 4CGTA 2HLFC 4LLDB 1B0RA 2NPLX 3RL1B 5E9DD 3QB7C 3DHMA 1INEL 2Q6WB 1CLYH 5IFJA 3Q6GL 4XXDA 2HFFB 4URTB 4ODHH 4EOWH 5BZDB 4NO2B 3QCUH 5F7NC 4DJMA 3ULVF 3Q48A 5EBMA 3VI3F 4PJBF 2OQJB 2FEEI 1PDKA 35C8L 5K9OA 3CFDA 3VFWA 3LKPB 5T1LD 3P0YL 2PCPB 4Q2ZA 1NL0L 1JYWA 2PXYA 4RFOL 4JDTH 4G7YH 4ZUTB 5ACMA 2NW3A 1FNHA 3AS1A 5SWZD 1T7WA 2VLJB 5K59F 1Z9MA 3QIWC 4X9IA 1U41A 5C0RL 3TNNA 3B4NA 4QRUB 4WTWA 3TBSA 4CADB 1RUQL 3E8UL 2E7CA 1JVKA 3MBEA 3INUH 1G7LA 2IAMA 3SDCC 1N64H 3RGVA 2YUXA 4ORGA 2AQ3A 2IH1A 5KTEL 3FQUB 5BQ7A 5I75C 4FQPA 3VWJB 1RHHB 4NJ9L 4MGXA 5HYJB 1YC7A 4ELMA 5CGYD 4EKXA 3EJYC 2P5EE 1DQJB 2HRPL 1T03L 1RIUH 5IR1A 2I24N 3BPOC 1TIUA 1G7IB 2X4UA 5F7EL 3WV0A 2BDNH 2GUOB 1G9MC 1QLRA 1AXSB 4XCFH 5F9DC 3P4OB 1I7RA 2N4IA 3RL2A 4UUJA 3RWGB 1CICD 3CNKA 2H3NA 4D2NA 5ISZE 1A1NB 3DX6A 2QADB 2FZ3B 1YQVL 3MROB 1ES0A 3GMQB 3QDAA 1MCJA 1I8LC 2J8HA 4PY8I 4WGVB 1TJHH 2J7LA 3HRZB 2GJZB 3V7AE 1LNUB 1NEUA 2BOCB 1CGVA 3TESA 4R26H 2L7UA 3MGAA 1I7TB 2WUCH 1L0QA 2VH5H 3FOLA 1H15B 5GRWA 2MPAL 4KY1L 1IEBB 4Z7UE 2H3NB 3GHEL 1GGCL 4U6HA 3V6FA 1PZ5A 1VB9A 2I60H 3LCYA 4QXWA 4Y0GA 4GG6E 1U8QA 4HKJA 3FAXA 4LSPL 4U1HB 3MRJB 3UO1H 1G7IA 1A6ZB 4WIQA 4DN3H 2CDGA 2R2BA 3KPMB 4MJ6B 3BN3B 3HZVA 3CMOL 1UJ3B 4K3EH 1NJ9B 3WO4B 3H6JA 2Q3ZA 5AD0A 5EBLB 4Z9KB 2WBJD 1NEZG 4MMZC 2F54E 3QCVH 1A7RL 3WXVH 2Y7QB 2NZIA 2V5MA 1J9CT 1N0LA 1OLZA 5JXEC 1FFOB 3LB6C 3NABH 1E28B 4U7KA 2AJUH 1T4KB 5HHME 3N85H 4P4RA 4NT6B 1H3PH 4GRLC 5GGVY 4H5SA 5C0EB 5JW4N 3VG9C 1YEFH 4ZUVA 2I5YL 1L7IH 2FRGP 1LO2L 4LPXA 4N68A 3EJZC 1SJVA 1DBAH 3UO1L 4OZIE 1CGWA 1MIMH 3PHQB 3AS0A 2UVEA 3X3GL 1FPTH 4IDJH 4KROC 3IXTA 4ODBD 4YDJB 2QR0B 5H2BA 5GS0C 2DWDA 4M61B 1QFWH 4IRSC 3V4PH 2XWJA 3JWOC 4Q6IC 1T3FB 1OW0A 4G6ML 4QRSA 4JCMA 3N0PB 3VXRE 1S9KC 1SBSL 1C1EL 1NL0H 3O9WA 4HV8B 5FO8A 2YRPA 1ZWIB 3FQTB 4JRYA 3P4MB 4ZFFB 1DN2A 1YY8A 5E5MB 5L88H 3JTSB 4WHTB 2QADD 3C5JB 3MMEB 3AMLA 1WCBA 2NY6C 2XNAA 3NAAL 3LRSA 4TSBH 4H88L 3O3DB 2VR4A 1A5FL 2BVEA 3Q6FA 3PE9A 2I9LA 4G42B 1IAOA 1NC4B 1OAYL 4ZPTA 4G6JH 2GJ6B 3B9EA 3KYMA 2AEWA 5ESQB 2B5IB 3JZ7A 5I1LA 3G6DL 4IS6B 1FO0H 1P4IL 3HC0A 4Y5VC 1MCNA 1MCSA 2DLIA 3PABB 2MKWA 4I77H 1RMFL 4LBEA 4XC3L 1G9ML 5C0AA 4OM0L 4X5XA 2YXMA 2FX9L 3F6IA 3VFPA 1KEML 4O2EB 5CGYC 4HCRH 4PJEF 3MLZL 4KMTH 3QDMB 5BV7H 3UC0L 1KJVB 1YYLH 4UTBH 4UDTB 1KSRA 1PZUB 3DUHA 3Q6GH 1IT9H 1JV5A 5C09A 3T65A 1KJ2H 3MV7B 3L95B 5FGBC 3C8HA 2CSPA 4H26B 2OBGA 4N0UE 4YK4C 1UH2A 3SO3B 4P4KC 3SPVB 1NDGB 1GVIA 3FMGL 5JORB 3LN4B 4N90D 3N06B 1PFCA 1G0YR 3EKCA 2RJMA 5EU7C 3EHBC 5DJXA 1DBML 2ESVB 3H42H 1ZT4A 4R0LA 1S7QB 3DXAD 4KH2A 4KMQA 1S7VA 1DN0B 4Z7VE 3SCMA 5E1AB 1YYML 4MWFB 1G7HB 4KUZL 3MTRA 4GW1B 4LCIL 4OF6A 3AM8A 2CR3A 1AXIB 2CKBB 4I48A 5SWQB 4J3TA 3TBVB 4LKCA 3O41A 2OZ4H 5CBAA 3DETC 3U2SB 2F5BH 3CLEL 1DSFH 3T1FA 3DO7A 4X99A 1C7TA 2R0LL 4KHXL 5DJZA 4XAWH 1CZ8L 1YJDL 3HN3A 3QQ4B 4U1JB 1E4JA 3HNVL 1I1FB 2I9TB 5B38G 3HMWH 4RBPH 3UTQB 4Q9QL 1DFBH 3WLBB 3KYKL 2DLTA 1QQDB 1UCTA 1CFSA 4JY6A 4HMDA 5DJ0A 3LSOB 4CMHC 3GI8H 1IGIL 3JTSA 4WHTA 4RDQF 4CVUA 2ICCA 5EZIH 4Y7MA 3RU8L 3KG5A 3NCYS 1JF1B 4WHCA 1AO7E 2EECA 1QEWB 4HEPG 5EWIH 4X7CC 1DUZA 3VXUD 3UDWA 3B2VH 2CKBL 1AGFB 1BQHG 2FB4L 3S37L 1PX4A 1WC7B 5FYLL 1OSPL 1Z5LA 1LE9B 4OLYL 3UTSD 5FYLD 3ZDZF 4KMLB 4LLQB 2AJYL 4F80A 1U3HA 1U91B 4RFOH 3G04B 1E27B 1KLUA 1R0AH 3NZ8B 3FB6A 4H8WH 5JO5B 4FP8H 4O5LL 1MCWW 3ME0A 3OB0H 3WBDA 1H3TA 3V4UL 1N4XH 5TPWH 4Z95L 1CLYL 2PYED 2QLVB 4EXPX 4JB9L 4P2RE 3O4LE 1S7VB 1MI5A 1WEJH 4DAGL 3O4OB 4GKNB 3MRNB 5LQBH 3DXAB 2H41A 4LFHG 4XNYL 4WRLA 2G60H 4EI5B 4OZHF 5HDBF 1U3HC 4YUEH 4KZDL 4JLRB 3BGAA 4YHZH 4DVBB 5DMYA 1F3RB 4UV4H 2MQ0A 5SWZB 3C60A 5HD8C 4GO6B 1MSPA 2NY5C 3V52L 1AHWA 1U93A 1IM3A 1AD9B 3JV4A 5J57B 3OG6B 5EOCL 5JHDE 1MIML 4YDVB 2BERA 4YZFF 1LE5A 3QXDA 4S0SD 1CTOA 3WKMH 2PO6B 1Q9LA 1X5FA 4XVUD 2DLFL 5DR5H 3HC4L 3IB4A 3C5ZB 4IRJA 2X44D 4P2RA 3UYRL 4CL7A 1WV7T 2X6MA 1NFDB 3MXVL 4ZUSA 4I4WA 1QNZL 5F7UA 5JUEH 3N85L 1EO8H 1G7HA 2DF3A 5E9DB 3BZFB 3VRIA 1QZ1A 4LLUA 3VFSA 4C56A 2DKMA 2J1KA 3LQZB 1MLBA 1S7SA 2YPLA 2BZDA 1QSEA 3FOMB 4HG4K 3I84A 5EUOF 3KLSA 2CDEB 3TCXA 1H3GA 3QHTC 4XCEB 5I74B 1TVBA 4Y4FD 1RK0B 5J3HC 1VEMA 4MAUL 4Y89A 2YRZA 1YMHB 4W81A 2A9NL 1ORSB 4TVPH 4FFVD 1J8HA 4RMUA 3NACH 3WIHH 4F9PC 3D1MC 1XIWB 5GZNC 3VFOA 2BXZA 2JB5L 3ZE1E 5KJRH 4Y16B 3S36X 5HI5D 2AXGB 3EDJA 2F74B 5HYFA 4KI5C 2WK2A 4HMEA 1WITA 5KANI 4OCWL 1HSBA 3AB0C 4WUKL 3G5YB 3EYVA 3QFJB 4JO1L 4X6DE 2DL9A 1X5GA 3D0LA 2DLGA 5K9KA 1X9QA 1BEYL 3SDDD 4P57A 1FAIL 3F7VB 4LCWA 2CK0H 1KTDB 2C9AA 1MREH 3W9EB 4JFFB 1QBLH 5TE6H 5HYJD 3ARGC 3CMGA 2AJSL 3VFUA 1NCWL 4Y5VA 5DK3A 4EIGB 1A4JA 5E2WL 3MC0A 4H0GA 5IT2H 2EDHA 2OSLA 3LEYL 4LSUL 4AH2B 2R9HC 4PGEA 4OFVA 1TJGH 1GGBH 5FYJU 1IGTA 5C6WH 3VFOB 4OQTL 1IM9A 4JFHD 2N7AA 3U82B 4LCWB 1KB5L 3VH8A 1XGRB 4BFBD 3E1F1 4X80H 3RKPA 5C09D 2JKXA 4L3EB 4XP9L 1KCRH 5IOPA 4YQXH 3EBAA 4HAFA 4HQQH 1DE4A 4JFZH 1OGAE 1OAYH 5ENWA 4ZUUA 3H7LA 4KUZH 4PLKD 2OL3L 1RIHH 3L3DA 2AQ2A 5GPRA 1GGYA 3D69B 2BNQA 3RIAF 1G1YA 1ZVHA 1T5XA 3D2UD 2C4FT 1MHEB 5HHPB 5D7JC 3GSWB 5KVDH 1IGYB 2R23B 3VE0B 5ID1B 4QRPD 1QO3A 1AI1H 5DFTA 3CFEA 5FOJA 3L3JB 1Q9KB 2YN3A 5FCSH 4FFWC 3SCMC 5JOEA 2HVJB 1NMCC 3C6LB 3C60C 2DJSA 4OZHE 3G6AA 1U92B 3RIFK 1CVSC 3EAKA 1FH5L 2J12B 2HT2D 4NKOA 1J7VR 3MOBL 3IDMB 1X6NA 5J1SC 3BPCA 1SYVB 3QPXH 5H37H 1YDPA 3NFNB 5AD0B 2Y07L 4HEME 1MHCB 1EPFA 4OLVH 2ZZUT 1NCBL 2NY1C 1XCQA 2B0SH 4ZNEA 2L4OA 3WJJA 5GIRA 4IOFD 3JV6B 2AK4B 4P5TC 4PP1C 4WW1B 4MVBD 5DHVA 3OR6A 1J0HA 5K33A 1QO3B 3PQYD 4OGXL 4X8JB 3BH9A 3K1KC 3P77B 3X14B 3TZVC 1XF5B 2Z93B 1Q38A 2C1OA 4XAKD 3UTSA 4X7DC 1FVCB 2DQGH 1NGWA 1VADB 3O3AB 2DQIL 2GKIA 5D7LA 4RIRA 2VDML 5FYKU 1NCBH 4CW1B 3MFFA 4K7FB 4PD4J 4QOKE 5D96C 2XA3A 3WJJC 2VQTA 4JHBA 3D3VA 5L7XL 1KGCE 1OGAD 5T1KB 3DUUA 1INDH 1OAKH 1ES0B 2H2SD 3GMQA 3ESUF 3QJHB 3CU1A 3GEWB 4U0QB 3RNQA 1JYNA 4NUGL 1B0GB 1QVOB 1B6DA 4N1CA 4LVHC 4WNQA 2RBLA 1LVEA 3WXWH 4PJ7A 1T2QL 3MLVH 3STZB 2CLRB 2YS4A 4LSTL 2XKSA 5CZVH 4KRNA 1R3KB 4ZOEA 4EI6B 1JF6A 1QSED 4NQCE 1A7NH 4X83A 1RHHA 2VOTA 3QUZD 5C9KA 3QNXB 4ZUUB 4HS3B 1S8DA 2XACC 2ED9A 3ARTA 1NGWB 1O7VA 4M5ZH 2E9IA 5BMFL 3QAZB 4PGDB 1C5CL 1WBXA 5TE4L 3T2NH 5K9JL 3D9AH 3D25A 3NIDE 4P2RD 3SKMB 4YFDB 5M94B 2Y5TB 1ZT4B 3LDBC 3S5LG 4JFZL 5KTEH 5E6YA 1M05B 4WI7A 1JZ7A 3R8QA 3V6ZA 2VL4A 2J6EH 4I48B 3FB5A 4Y4FA 2XTJD 4HXBL 1T22A 3MRQB 3NGBC 2EDNA 4OZGA 2VXQH 4OQTH 5FO7A 2NYYD 4YHMH 5C7XL 3GSOA 6CGTA 4NC0B 2Q8AH 1P53A 5JNYA 2NY0D 1SHMA 2MPAH 3GMMB 4KY1H 1VFOA 5JORA 3TCLA 3RZWA 3VRLE 3AB0B 1WSST 3BWUC 3FN0H 1FJ1B 1TXKA 3BXNA 2XOTA 3F65A 5HHOA 4NM8L 1RJZA 5A2IH 3RI5F 3UZVB 5C08E 1WBYA 5TF1L 3U46B 4V1DD 4OKVB 3O3EA 4WJ5A 3U0WH 1MWAH 5BXFB 4M7KL 4QRQB 3O6MH 5DJAB 3THMH 1BAFL 4HK3N 3RVXD 3RDTD 4KQ3L 1OWRM 4R97C 3SDCD 1S9YB 4EBQL 4UMGA 4X7SH 3HR5A 1JNNL 1VSCA 3EFFA 3K81A 1NC4A 1MH5A 3MR9A 4KPHH 4KK8D 1ZEAH 3B9KC 5D7IA 3WIIL 3QI9C 2X9WA 1TFHA 2NNAA 4QTIH 2ZCKH 1JWUB 3QZWG 5GGSA 4WFHD 3RA7H 5F88A 3VGGA 3X3FL 1P7HL 2BNUB 5DQJB 4UBDD 4G9FB 4J3WA 3MA7A 3U4BH 2CJUH 4ZFGH 4DGYH 4E0RB 3OF6D 4XPGH 3B6SA 1HKLH 2IBGA 4AY0A 2VH5L 4YHNB 2JB5H 4C57C 2CDFB 4IEFB 4X6CA 5F89A 1KXTB 1X5ZA 5BO1L 1IAII 3UYPA 3P9MA 1CIDA 5TGBA 4K23L 4L1HA 3TPKA 4W68A 5HVGB 2VXSL 4LF3B 5FGBA 1IQWH 3ULUL 1EHNA 1WWAX 2GTZA 3L7FA 4KJQC 2H26A 5IB2B 3RUGE 2OR7A 3DRTA 4OFPA 1CGUA 1KCLA 1T1YB 2PYEB 5C0AE 5F1NA 3CK0L 1Q0YH 3MLTA 2Q87A 2DQJL 4JFQA 4G6KH 4EOWL 4M5YL 3RGVC 1FL6A 3LQAH 5DRXA 3TZVD 5CUSH 2PW1A 2O5YL 1U8MB 4NQVB 3QXWA 4UZGA 1QRNB 4LLUB 3VFSB 4U1GB 4PP1D 3WFDL 4Y4HC 4NFDA 3A6CL 2WM0A 5I1LB 1NUNB 5FXCH 5JOPE 2EIEA 4HFUL 1T5WB 4FQQA 1FPTL 1YEKL 2VDQH 2R0KH 3GSVB 2NY2D 1FZKA 2O26U 2VLRB 1ZLVH 4G8GE 4U1NB 4TNVK 2GT9B 5IB5A 4X7FC 2HA1A 4RFNB 4LPUA 5CSZB 5EU6D 3CVHL 4ZNCD 2X9XA 4F57L 4KKLC 3BWAB 2JJVA 1CTNA 2HTLC 2C7UB 3DI3B 3SKJL 2ADGA 5TQ2H 1QLFA 2VLMD 3SHSA 5I1KL 1CGSL 5DGQA 3BKJL 3VG0L 3VGBA 1YA5A 4RQQA 1KJMA 5CJOL 1K4DB 2OJEB 3V4VL 1MCKA 3EYFB 1S7WA 3T4YA 1RAMA 4LHUG 1RJYB 4TTDC 4MD0A 4K55A 2VN4A 3OF6A 3MRDB 1TVBB 1NDGA 1S9XB 3VWKB 2YK1H 5MHSD 1P9MA 3MRFA 4O9HH 2OMNA 3MPCA 3KPSE 1QSFA 3PWJA 1MIEL 1F4XL 4QNPE 1LD9A 3MGTB 4NO0D 5B4MC 2HJLB 3QEHA 2IH3A 3SE3A 3VCLA 5F7LB 3BKJH 2YUVA 3WSQL 5ADOL 5FYJD 4MLSA 3D85A 1YC8A 1VACB 4Z7UB 2HMIC 3I75B 3MRFB 3QYCA 2W9EH 1BBDL 5KW9L 2Z31C 3OJVC 2VERN 4MD0B 4MNHB 5TF1H 1PSKL 3PGCA 4X4MA 1CXLA 3BO8B 5F7DA 4FZEL 4JPKL 4R8WH 4XXCC 1LDPH 1FZMB 3LIZH 3O45A 4LEXH 3A67L 1GCFA 2O5XH 5E70A 2DAVA 2IH3B 2VISA 3OAUL 3C8DA 4PY8J 3QIUD 1IRAY 4PJCE 1AE6L 1F3DH 1XR9A 1LEIA 1IARB 4WGWB 1U3YA 5I9QB 4JQXA 3UJIH 5E2VH 3G6AB 5ILTH 1MFDL 3B3IB 1QPPA 3M1BA 4JDVA 4ODWB 2EH8H 3I6GB 1U8PB 1RU9H 2PTUA 3O2WL 1FZKB 4YH6A 5ISZD 1R0AL 3PWUB 1R24B 1D5ZB 3BGMB 4UNTA 3BEVA 3IDGB 2VSCA 2ZOLB 1CWVA 1KLFA 4JJ5B 3KPQB 4RWYL 3MYJA 3QG7L 3ROOA 5D7KD 1BECA 1FVDA 1PEWA 4ZTPH 4Q9BA 2DB8A 2E8ZA 3EOAA 3HG1E 5E7BA 1DR9A 5JOFB 3IDYC 4LEOB 4XNUL 4FTVA 5ETUB 3V6OC 3KPOA 4GAFB 3KYOB 3MRIA 3QUXA 3QUMB 2RFXA 4XB7A 3WEXA 5DO2C 1YZZA 2DI7A 3LDBB 4JG0L 5DF0A 4J6RL 3U0PA 2ZPKH 3OKEA 3OHXA 4M7ZB 2Z8WC 2WANA 3TPUB 2BMKB 5B4MD 1DSFL 4EBQH 4JM4H 2XYCA 3PQYB 4XI5D 5FGCB 3RWJB 1FZOB 2OTUB 5GRVK 1SQ2N 4NPYA 4XHJC 1J5OH 3FRPA 5MP6L 2ZSVB 1T21B 4BZ1H 3SDAD 2C3XA 2J3SA 3DMMB 3OAZH 15C8L 4MD4B 2Z35B 3FN0L 1IEAB 1L6XA 4XZUA 3U7WH 2JJSA 4I1NB 4NQSB 2X42A 5TDNB 3IDNA 4L8DB 1XFPA 2D9QB 2CIIA 1HHHB 2XTJB 4YWGH 1M7IA 3L5JA 2YXFA 3WO4C 1UJ3C 4JZNB 5HDQH 5IBLC 2ZOKB 3PWVA 4KKLD 4G6AD 1TZHB 4Y19A 1EIBA 2AJ3B 4XH2A 5F3BA 3U36A 4J4PD 5CMAB 3EO1B 5C0BD 3ESVF 3MLZH 1U58B 1ZANL 3VXPB 1ZLUK 3VFUB 2UVFA 3FCTB 4RNRB 2JIXB 4UQ2B 5CKAA 1A7RH 1K6QL 4NZRL 2FO4A 4QHLA 3STZA 2QSQA 1SEBA 3EYVB 3QFJA 1MRCH 1TPXC 2WWKO 3T1WA 1MFCL 1Q9OA 1DBJL 3NTCH 3EJJX 2NY5H 4OSUH 3QO0A 2DWDB 1U95A 4HK3J 5F6IB 4R9HA 5ID0A 3MNVA 5BZWB 2VDRH 3NCYP 4XP5H 4FHBD 3VXOA 1CXHA 4KJQD 5EOTA 3LKPA 1MQKL 1A02N 5HDBE 3ARYA 1W0VB 1X4YA 3ZKSD 1FCCA 4N5EC 5HGGS 3DPBA 3QUKA 2ZP0T 3UPRB 1OCWH 5BQ7B 2W0FA 4U33A 4JR9H 2G5RA 5DMJB 2X05A 5HTSA 4QRSB 3NA4A 4X6EA 1H3VA 2EKJA 1IMHC 3ILPB 4JKKA 3EHBD 3BZDA 5FKPA 4GQ9H 3ZKXC 5E8OA 2IBZX 3TBTB 3JVGC 5AUMA 4HFWA 5DJDA 3UJIL 1GOFA 3DHJA 3T2QA 4LRNL 5KBNC 1I75A 2VLKB 1WFNA 4JDZB 2E27L 1CE1H 3NOIA 3IGAB 3KPRB 4HUUB 2R1YB 4EN3D 1AXSA 3JV5A 1X5KA 4YFLI 2QSCL 1HXYA 2F8OA 2JJUA 4FQXD 1J05A 2R1XB 4MSWA 3TBTA 3D85D 3IXAA 3ARDB 5MP6H 4K9EC 4XWGH 2AV1A 2GY7B 4P2OB 2AGJH 3T0XA 3WDJA 1IQWL 1RUML 4YNYB 5KAQG 1A1NA 3DGGB 2R2BB 3ZL4L 5D71H 4FG6C 1GC1L 4TRPL 3U79A 3TO2B 4DW2L 3X14A 1E6OL 4HLZH 5E6IA 1IC5H 1NGPL 1QYGL 2GJJA 4OQ1A 2CD0A 2YPKA 4G3YL 2B0SL 3EYOB 5DT1L 2D7NA 3EO1A 1JI2A 4G5ZL 4DTGL 4XXCA 5JHDB 3C08H 5DHXB 1R5VB 4GKZA 4D0DB 5IVOA 5J56B 2GJZA 3HZMA 1MHPL 3IU3B 3VXSD 1VERA 2DKUA 4GKSA 4G8FA 4Y16C 2EDWA 1DN0A 1J5OL 3IFLL 1JTPA 1TETL 3QA3B 1VADA 1F97A 4ODTH 5D2LA 3VMOA 1NGZA 4MD5A 1VFUA 2P45B 4CVXB 1FCGA 3DBXB 1AGEB 4CN6A 3UTSB 2HT4C 1JNLH 5SWSB 3PGFL 2A1WL 4J1UB 5KZCB 4OD2B 3VWKD 4R0LB 1WIOA 5MERA 1C12B 1UKQA 4K94C 5FEBA 2ZNXA 5F72S 5C0CE 1CD0A 4A6YB 1ZGLA 4P3DA 5MEOB 5EOTB 3O8XB 1DL7H 4X7TB 5F9OL 3T0EA 2NY2B 1P2CB 3QRGL 1NLDL 1TTUA 5EFIA 1T83A 5I66B 1QBML 1WFUA 2A77L 2YWZA 3SKNA 1K2DA 4J3SA