4F3FB

Crystal structure of msln7-64 morab-009 fab complex
Total Genus 42
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
42
sequence length
220
structure length
220
Chain Sequence
EVQLQQSGPELEKPGASVKISCKASGYSFTGYTMNWVKQSHGKSLEWIGLITPYNGASSYNQKFRGKATLTVDKSSSTAYMDLLSLTSEDSAVYFCARGGYDGRGFDYWGSGTPVTVSSASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVEPK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Immune system
molecule keywords MORAb-009 Fab light chain
publication title Recognition of mesothelin by the therapeutic antibody MORAb-009: structural and mechanistic insights.
pubmed doi rcsb
source organism Mus musculus
total genus 42
structure length 220
sequence length 220
ec nomenclature
pdb deposition date 2012-05-09
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4f3fB01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4f3fB02
1T5XA 5EZLA 3FAWA 4YZFF 3KJ6L 5D5MB 2IADB 2PXYD 2ZUQC 3P4MA 2IANA 3VXPA 3LRHA 1HWGB 3HE6B 1I9JL 4OM1H 4KDVA 4OZGA 3KLAB 4G6AC 3GI8H 3MO1A 1QD0A 3VWJC 3EYSL 2AVGA 4P2RE 4P5MB 3CXDL 4DWHA 4GG6E 1SYSA 3G9VA 2ESVD 4WGWB 2VLRD 2XWBA 3C08L 3CCHA 4HAGA 4M3JA 5KVEL 5ILTH 5ICYA 4NO0D 1U3ZA 3WKNA 4I9WD 2JB6B 1WFTA 3ZYJA 1UB5A 1EO5A 2DLFL 4Y5VA 4OB5H 3L3OA 4GKSB 5HTSA 4Y4HB 2VXVH 2BP3A 3TJHC 4L4JA 3STLB 1U8LA 1CR9H 2E7LC 5F6IB 5HHNA 5ANME 1IGYA 5I15H 3QCUL 5I73C 5IBTL 2HG5A 1HSAA 4LL9A 3RY4A 2J7LA 3D39D 4BZYA 12E8L 3O9WA 2NYYC 3ORJA 1F02I 4N0UE 1YN7A 4PJFB 1FC1A 2MOVA 3TJEL 3MV7A 1QLFA 3QHTC 2X89A 3E6FB 2OJEA 1XR9B 2FX9L 2VH5L 4RA0C 3P0YL 5ALBH 4RX4D 1NC4A 3SE3A 2ZPKH 2EIEA 3IFOB 5J6GB 4G8IA 3DBXA 5D2NA 3VXSA 3U83A 3TIEA 1UG9A 2FX8L 4AM0B 5BV7C 2ITCA 5JW4R 3PWNA 5DT1H 5GISL 1OM3H 5FECA 1AIFB 4XBGA 5T1DL 4TTGA 4PJHB 4AL8L 4ZTPH 4YEFA 1X9QA 3B2UD 3FKUS 2G60L 5JMRA 2VXQH 4LQFH 3IFPA 3K4ZA 5D1QD 1S9VA 4LLWB 5EBWA 3O8XC 4I2XB 3UTTE 4HHAB 4NFDA 4R4ND 1A5FH 2W0FB 2DQUH 1EGJL 5ISZD 3GSUA 3GIZL 4LRNH 5JORA 4PRPE 4GAGL 3CZFA 4NHCL 5MEOA 3FRPG 1DL7H 3IFNH 4O2CB 3OKOA 5KSBF 3ZTNL 2ICCA 3UTQB 2NY7H 2HKFL 1U8MA 2PYEA 4XVTL 5B3JE 2FX7L 4PGEA 3CMGA 1CICD 2OXGA 1EX0A 2Y5TA 4PRHD 3EJZD 3KPSA 1UJ3B 4BM7A 4ZFOL 3O3EA 4ELMB 3L7EA 1D5ZB 4F8TA 1KJMA 2UZXB 3ISWA 5F9WB 5CGYC 4ZSOB 3QZWB 3QJHA 2Z93A 4POUB 1JCKA 2GSIB 5J1SC 4XXDB 3CDGA 4XXCC 4JN2A 4PJBA 1IZKA 3L5WA 2ICWA 2JK5B 3EYOB 5I30L 5BO1H 4IM8A 1UB6A 5GGUB 1OAQL 2JKXA 3AM8C 1GGTA 1FAIL 4JRWA 5C7XL 1J10A 2F19L 4EDWH 5I1AA 2X2YA 2Y72A 5HSFA 3FQUA 4LNVA 2OTUB 3MLWH 1QEWB 2NLJB 3JSSA 4KVCH 2YK1L 5DD1H 2NY1D 4OFDA 4GRWF 3QUKB 2X9XA 4E5XA 5I19H 3TNNB 3IJSA 4HC1H 4KTDL 2E3VA 3TEUA 5ITBL 3TV3H 3WHE0 1P5UA 1CFSB 3BD3A 3MLRL 4R90H 2VKWA 2A74B 1U3HB 1PSKH 2CRMA 2UWEF 2NW2A 2N56A 4AG4H 4FFYH 4X6FA 2PCPB 5CSBA 3L3DB 4RGMB 1B88A 5E8NB 2AABH 4OFIA 3BUYB 4HZLA 2BVPA 4L4TD 4GS7C 4Y5VC 2HH0H 1OP9A 3U79A 4RAVB 2XQBL 1MJUH 2ATPB 1ZTXL 3LPWA 3HMXL 4Z7VE 3INUL 1Q9KB 3P30H 2QLVB 4XP6L 4LARL 1U91A 2ADIA 4JLRB 5CEZH 4JB9L 1CDUA 1RVFH 3H7BA 3A67H 3KPMA 1QBAA 2OXHA 1GGIL 3QIWD 4GXVL 3CFJB 1NAMH 5D96B 4YXLH 3O9WC 1JRHH 3UAJD 2CMRL 4JY4A 2QSCH 5SWZA 1P1ZB 2JLLA 2CR3A 2HA1A 3ARWA 4MDIA 5CD5C 4YWGL 5F9JB 2FL5B 1G9NH 5HVGB 4EUPG 3SE3C 2AJXH 4NKMB 5T1LB 3D85B 1FFNB 4IMKA 5D2NC 4YHMH 3PP4H 3O4LE 1T2QH 1VGEH 3F7RA 1QSEE 3HRZB 5E2TH 4U6XB 2FNBA 1N5AB 1WK0A 4U6YA 4P2OA 5IHLB 2N7AA 3LB6D 4CU7A 1JFQL 2F58H 5JTWA 5L2KE 1K5NB 1TZIB 3MC0A 1HSBB 4U1GB 4Q9QL 1R5WB 2OZ4L 1WCBB 3WD5L 1Z0NA 4Z7UB 4KI1A 4EI5A 4NRZA 3MV8B 5F7DB 1IGCL 3V5KA 1AO7B 1EEYA 3RHWF 2XTJD 5ADPH 1KIUA 5DD6A 2D03L 3CDCA 3PL6B 1QRKA 4OCMC 4KKCC 3QUZD 3EFDH 4CNIA 1XF3B 1JK8A 4OF5A 4BJLA 5T1KB 1OSPH 2G2RB 3NCYP 3WFDL 4M48H 1FZMA 1G7LB 3STZB 3C60B 2EKSA 1AGDB 4KJYA 3TZVB 3LH2L 2WP3T 4MA7H 5F3BB 3TC9A 2OP4L 5IW6B 1VEMA 4G8FB 4HIJA 1OY3B 4ONHA 2P8MA 3SDXB 4Q9BA 4TRPL 3GDBA 3S5LG 1G7QB 1EMTL 1P6AB 1TCRA 4QHMB 4KRPD 4P5KB 4UT9H 3V6FA 3LS4L 4NRXB 3TT1H 2EKJA 5BXFA 3B9EA 5J06A 3D25A 3L3KB 2DDQH 5E8PB 4HLZH 4QNPF 3QNYA 4JFFA 3MSPA 1OGAE 1MHCB 4J23A 3RA7H 2YUWA 3RZCD 2R8SH 1A3LH 3PWVA 4N5ED 4LSSL 3O4OC 1T1WA 1UM4L 5D7KE 2DQGH 3TP4A 3A6CL 2EXWC 1IFHH 2FO4B 1IGFL 1WC7B 4HFWA 2GCYB 4W6YB 3BKCL 3CFBA 3RAJH 3NVQA 3MXVL 5EB9A 1TZGL 1FZOB 4CL7A 2OJZH 3QQ9D 3BFOA 4Y5XC 3BW9B 3VRJB 2ADJB 1DBJH 2YD4A 1AQDA 3JXAA 2DQFA 1JNNL 1FGVL 4MNQB 3BZEA 2NY6D 4LP4A 3F62A 2QQKL 3MV9B 4UT7H 1UCBH 3ROOA 5EA0L 3FQXA 4R3SB 5HI5D 3MRLB 5D7JD 3PF2A 4X6CF 5KS9E 4X6EB 4K94L 3IGAA 3W0WB 1FSKB 4P9HC 4Z7NE 5JHDB 5DJAA 3SJVD 4G9DA 5FYKH 3QHFL 3QO0B 1UXWB 1HEZB 4L8SA 4EZMA 1QPXA 2FSEA 1YN6B 1IL1A 3VXME 4X9FA 3CUPB 1YNTB 2FJFB 1KEGH 2BNQD 2G5BA 2H32H 1NLDH 2B1HH 2XNAB 1JPST 5TDOA 3EOTL 3WN5B 3QIUB 4K7PY 4XMKH 5BRZE 3IAQA 4P46B 1BQHG 3MFFA 2C3HA 3KDMA 4MXVE 1KTRL 3LEXA 2ARJA 5ESAA 3RTQB 3ARGC 3O3DA 4CVWA 1KCRH 4OB5L 3GSXB 3QFDA 5EOCL 4PJ8B 1I75A 1FVDA 4QYOB 3MJ6A 1G0XA 3HCVA 4HWZB 1CXFA 1CGWA 5KVDH 5C9JA 1N7ML 3DGCR 5GGTH 1YMMB 5I76B 3U2SB 3SKOB 3NFPA 1CU4L 1DEDA 3TN0A 4N9GB 1RMFH 2E7CA 4TNVF 3QDMA 1JWUA 3OGCB 4NQXA 4IMKC 4LCYB 4S1RL 4HIHB 3ALWA 4J1UA 4YFEA 1ZLSH 1E4XH 3FB5A 1F2XK 4FQPA 2Q1EA 1TQCB 2ZPKL 1L6XA 4UOW1 1U8KB 3BP4B 3C09B 4NM4L 1DFBH 4QHNB 1OM3L 5F7LB 2R0LL 5E70A 3FONA 1KV3A 3MLUH 2IG2L 4EI5C 1CGSL 1CT8B 2SEBA 4JR9L 3DV6A 4FOMA 3NA9H 2VDKH 5FYLE 2VXQL 1QZ1A 3EYVA 3N06B 5FA3A 2P47B 4HG4J 1RUKH 2Q76A 2J8UA 5B39A 4D3CL 1KB5H 1MJJA 5GZNC 1B4JH 1MWAL 1A5FL 3C2SA 1S78D 2VN4A 1ZAGA 4ZUSA 2DQUL 1CZ8L 1J8HB 4XPFH 4RISH 5I9QC 2EC8A 4OGYL 4OUOA 3ILPB 3VFTB 4QCIA 1IGJB 1XR8B 2V2TB 4HXBH 3QT2A 3V6ZB 2R2EB 3IFNL 1MFBH 4D0DA 4U3CA 3X11A 3V5HB 5F7NC 5IOPA 4YR6A 4LOUC 1CDYA 1ZK9A 5GZOC 2F54A 2NXZD 3MLVL 4NKQB 4ZFFB 4DZ8B 2VDMH 2IH3B 3U9UA 3IXAA 4HBQA 2YD7A 1MF2L 3HR5B 2C9AA 3QULA 3L3GB 3FO1A 3HNTH 3KYKH 3DX9B 3TM6A 5IFJB 1VA9A 3NTCH 5D7KD 3RL1B 1F3JB 2DM7A 4LRIA 1NGYB 4KHXH 4G42B 1OTSD 4WO4C 5DK3A 3B9KA 3WFBL 1QBBA 2DLTA 2R1WA 1KLUB 2Z91A 1YJDC 4QOKE 1R24A 5BO1L 3U4BH 2OTWA 4WNQB 1M1SA 5AD0B 2APFA 1E28B 4EDWL 3PWPB 4EKXA 5D7IF 4IRJB 3VXUB 4J12A 3PGDA 2HN7A 1KB9J 1KIQA 1TJGH 5DD1L 2V17H 5FGSA 5I8OH 1SYVA 3EOYG 4YUEH 3KXFB 2NY5H 4PGBB 4FQQA 4OZ4A 4D9QD 1CFTB 1C7SA 4L8SC 4EXKA 1QSZA 3TV3L 4DVBB 3OX8B 4TTDD 2J88H 5D1XA 3CIQA 2O5ZH 4NNYA 1NDMB 3TJHD 3FQTA 3S97C 2EEAA 3G04A 1GOHA 3QUXA 4RGND 1UM5H 5FGCE 4M6OL 2P1YA 5DWUH 4ZDHB 1N0XH 5SWSB 4LPVA 5HHOB 5DS8A 3RGVA 3FOMA 4K7PL 3U7WL 3ZDXE 1N0LA 2HH0L 1KYOK 3C5SB 3EJJX 1VADB 4D0CB 3SQOL 1MNUL 1BQLL 4GAYB 2Y25A 1TENA 2F5AH 1JTOA 4OGAD 3FB7A 3IRPX 3X14A 3P0VL 4G8GD 1ZLVH 1MCIA 1EBAA 3B5HA 4OFKA 3HPJB 4YXLL 3MGTA 3TN0C 2IMNA 1KJVA 1VEPA 3MPCA 4HKJA 4BQ9A 3ES6A 3FFCE 1FFPB 3FB6B 1YNKL 3MRRB 5BS0B 1H3TA 5F7MC 4OLVL 5EBMA 3ZDYF 1T1ZB 4H8WC 1I1AB 1A4KB 5J3HC 1UZ8B 3VXRD 5IQ7L 3HE7A 4O00A 1T3FA 5IMKB 4OV5B 3CVHH 5JW4Q 3PP4L 5GS0D 3ULUH 1AXSB 1FDLL 1T2QL 5IV2B 4MJID 1WV7T 4P2QD 3GSRB 1F6AB 4V1DE 5EO1A 5C0CB 3NABL 1MVFA 1OF2A 3DOSA 2BSTB 2KQNA 4QRRD 3CK0L 5HGBB 3DUUB 1VGKB 4KTEL 3JV5A 2WWKT 3KYNA 4TQEH 3BSZH 5IB1A 2XY1A 4BH7A 1F8TL 1OW0A 3OAUH 1TETL 1FO0B 2VOTA 3QEGL 1VCAA 3EFDL 1X5LA 5IR1B 3FHAA 4RZCB 4OJFL 4X4ZA 5A3IC 2UWEB 4M48L 3EDKA 1AHWA 4NQDD 4AH2B 4OZHF 3F6IA 4M1GL 3OB0K 3L1OL 4NZTH 5D6DA 1FV1B 4G43B 3D69A 2Z0BA 3B6SB 1FVEB 3PGCB 3H8NA 5HYJA 1IEHA 1FJ1A 3UTPE 3ZDZE 4OLXH 2W91A 1I8KA 4L8CA 5EC2A 3LY6A 1G9EA 4G9FB 1IM9A 1IGTA 4H0IA 4M3KB 1KENL 1IQWH 5J12C 4CVUA 2B1AL 1W72L 3HAEA 2RB8A 4LRIC 4K7FB 5DFWH 3UBXI 1J1PH 3AB0B 1A6UH 4NUGL 2PTTA 3RA7L 1LE5B 2IQAA 2BFVH 2NY4B 3NFNA 2R8SL 4LCUA 1N8ZB 3HI5H 3B9KC 1BVZA 3RWHA 1MRCH 2EIDA 5F44A 1F42A 1ZGLM 3BI9X 3MJ7B 1A3RH 3T1WA 2I60L 5B4MC 1JPTL 4TPRL 3MXWH 1J0JA 1RZFH 1FNSL 4DCQA 1KPRA 1IC4L 5E8EB 3ZYOA 5DEFB 1LD9A 3WDJA 4QF1A 3VGEA 5AAMA 2FGWH 2FDBP 3R4DA 1KCUL 3QFJB 2CIKB 1BP3B 1S7TA 2AV1B 1OAUL 4G7VH 4HJJH 4DQOH 4JRXB 2H8PA 1ZT1B 3GMNB 5D1XC 4PGCA 1HXMA 2VC2L 1TZHA 3HFML 3OKKA 2Y6SC 1CLYH 3BWAB 3QUXC 3VGHA 3WHXB 3T04D 3IETA 4WW1B 5EUOB 5IBLC 1S8DB 4PRIE 1IEAB 1UC6A 3UBXA 5ALCL 4L4VB 3RGVC 5C6TL 1I3VA 2DMKA 1NMAL 2CK0L 4HK0B 2D7NA 1JMZA 4U2YA 4HZAA 4GAFB 3R06B 3F7YB 5IM7A 1T1YA 3OKDB 4XMKL 1N6QH 3M17B 4HT1H 4JFYA 3FOLA 3K74B 4U3HA 2HJLB 1S7XB 3MRHA 4IDJH 2O61B 4MWFB 4X6DF 5I1HH 4ZUTB 1G1YA 4XAWH 2ADFH 5F1OB 3WIFB 3TBSA 3VXSD 4M7LH 4YPJA 1MCWM 5C09B 5KVDL 2AJVL 4ZFOB 3MLZH 1UVQB 4WEBH 1CGTA 2WQ8A 3OV6A 4XTRD 4W81A 5CIPB 4NRYB 5FO9A 5IMOB 3VGAB 3HE7C 2A9NH 2W92A 2DKSA 3JWDL 3V0VB 2XT1B 3QUMB 4WUUA 1YPZB 5TFSL 5B38B 3CX5J 3CFDA 1QSFB 5KZCD 2HJFB 4ZS7L 3SO3C 4L3CA 1RUAH 4HGKC 3QNXB 4G6KH 5MERA 4MB5A 1ZLSL 2IQ9L 2HFGL 1E4XL 1A7QL 2HFEA 3L5JA 3GGWB 4J4PD 5DJ6A 2GTZA 1KFAL 1RJZA 2DD8H 4G6ML 3BT2L 1YY8A 2WLZA 4XNYL 2WUCL 5E2WH 2FWOA 3MODL 3RI5F 3IDJA 3UXFA 2J4WL 5E4EB 2E7HA 3NA9L 4P2RB 5DK0B 4U1JB 3GSVB 3LQAL 4GG8A 3X12A 2DQEL 1OW0C 2FR4A 4GG6B 4DAGL 5CGTA 1KB5L 2Y7QB 2CO7B 1RSFA 3VJ6A 1B4JL 1ZEAH 1MCRA 2GUOA 2VQUA 3SKNB 4ZNEE 2F53A 4UDTB 6CGTA 1I4FB 1AHWC 2ZP0T 4ZO6A 5GJTH 1ZS8B 1HYSC 4D8PA 5D6DC 2XWJA 1RK1A 3LPGA 3BZFA 3QO1B 2VLJA 4MQXC 3EYUH 1AR2A 4HUWA 4X7EC 4G3YL 1XF1A 4KY1L 4NJAH 4JFDA 3MLPA 5A2IH 1LEGA 1NC2B 1BREA 4OQTH 1Q9WA 5ANMB 5JQ6H 1IGIH 2J3SA 3QI9A 1BOGB 4ODHH 5DQ9A 4MSWA 2DKUA 2EICA 5GS2D 3QG7H 2VDML 5F8QC 2AKRB 4DFHA 3PXHA 4N0UB 5D4QA 1HHJA 3HZYB 2HT2C 3BP6B 2VWEE 1SQ2N 3QUMH 1WZMA 2W9DH 3HC0A 4RFEA 4DKAA 4PV9B 3MUY1 5I17A 1A6TB 3L3JA 4JFOA 1BZ7A 5ACZB 4BZ2H 1PLGH 1NDGB 2BMKA 1NGQH 2YBRA 4X83A 5T3XE 2FHBA 3G6DH 3JWNC 3SGKA 3FCTA 1A22B 4AMKH 2V2WA 1HH9A 2XN9A 1LHZA 2IF7A 3TLRA 4FXKA 1TJGL 3QEUB 1DUZB 3UTTB 3O3BB 4YUEL 2OR9H 1S9YB 1PD6A 2A6KB 4YHKL 3U6RB 3GIVB 5FOBA 2Y06L 2X9YA 1JNHB 2BSRA 3JZ7A 3MCKB 3QIBB 4R0LB 4PRPB 2XIDA 2O5ZL 5HDBF 4LK4A 4LF3B 1XF2A 1MREH 2FRGP 3K4AA 2AXFB 3UPRA 5KSBA 5T5FL 4LKXB 2P24A 3RVXC 3FRUA 4OKVA 5F8RC 4UQ3B 1XF5B 4PJIA 5ACLA 3GSWA 1HQ4A 5DMKB 2MHAB 3WO3B 4K9EH 4H5SA 2IH1A 4XP4H 1LE9A 4NO2A 3FMGH 4ODTL 1FYTA 4QLRA 5JA8B 4OI7A 5K9JH 4XNXH 5B39G 4K3DL 3REWB 2FHFA 1DQML 3W9EA 4LBEA 4PP1C 3ULSA 1L9MA 5DD5H 4ORZC 4RMUA 5GGRA 1UWEH 3PWUB 4PD4K 5L7XH 2RCSH 4GMTH 1MJ8H 3ARDB 4P2OD 1GGCH 1G7PB 4F7EB 4LEXH 5FYJE 5BOZG 4UTBL 3MR9A 4V2BA 2VLKD 2XY2A 2BY1A 4R96B 3IKCB 1G7HA 1JN6A 5D70L 3FO2B 4XT1C 2NY3C 1VACB 2HTKD 1EFXA 3IRZA 3MQIA 4EIZC 5ENWA 1IAMA 1FE8L 4HUXB 5C8JB 4YXKL 1N2RB 4Q6IB 4YK4C 3DLQR 4FQHB 1GHFH 3EYQC 4HCRH 2AK4A 5GZND 4P59L 4TVPD 4APQA 5I1JH 2CR6A 5J11B 4X7TA 4PREB 4WTXA 4L5FL 2AS5M 2A6JA 1MUJA 2Z92B 1F13A 3E8UL 5KTEH 5K9KB 3SCMA 3VFWA 1JGDA 3EYFA 4N0FA 1XGUB 2C1PA 2VB5A 1XFPA 3N9GH 2XYCA 4M62L 3BRGC 3QDAA 4JDVA 5SX4I 1TCMA 4X0KA 2AXGB 1FPTL 1I85A 3WE6A 3UTSD 3OAUL 1QA9A 3QHZL 4I0PB 1WSST 2N7BA 2R9HD 3P9MA 4AJ0A 4Y16B 3DO7B 1QO3A 1NGPL 3T0EB 4JFFD 2WZPD 1LO2L 3U30B 4PJGA 4FZEL 2UUDK 1DBBL 4Z7VB 3PNWB 4KKBC 4YBHA 1OTUD 4WW2A 4H88L 1YEGL 4JPIB 4NZTL 5C6PB 1XGTA 3DVGA 1N4XL 1KELH 4LGSB 3QI9C 5KSVA 4RFNB 3ZE0E 4X4MA 2FEEI 2CRIA 4NYLB 4I77H 1G1CA 5IKCB 3UZQA 2BVOB 1EEZA 3DVNB 3KLDA 2V2XB 1BD2D 5E9DA 3WNPA 2UZIL 4FQ1H 4XNUH 1MH5B 1J1PL 5DMGC 1T5WA 1GL4B 4M43H 3W39B 2Q86B 4C83A 1F3RB 2B8OT 2X44D 2FGZA 2ZZUT 1CE1L 2VIRB 1BVKA 1Q0YH 3HC4H 1GZQA 4PJCF 3O4LB 5EDXA 3UJTH 4S0TD 4GBXD 4LPTA 5T3XL 5CBEB 2P49B 1QSEB 1A3RL 4JFXA 2H9GA 4ZS6C 4ZAKB 1AGCB 2R2HA 5DRWB 5DURD 2FHCA 1U92B 1FBIH 4OF6A 1MHHB 3B5GA 4I4WB 4NKIH 5L2KB 1NFIB 3VG0H 5HD8C 2FGWL 1SJHA 2ERJB 3T77B 1A6WH 3I6GA 4U6HA 3DROA 3DX8B 4HJJL 4DQOL 4OCSL 1BLNB 3ARPA 5LGHH 5IB5A 4HG4K 4OCRL 3R8QA 4ZOEA 2QR0A 5A2FA 3T09A 1JHKL 4HH9B 4J7RA 2ITDB 1QG3A 4ZYKA 1IKFL 2CLRA 4P99A 4YBLB 5F1KC 4JANA 3RIFF 4GFTB 3TPUB 3ARBA 3BDXA 3RDTA 3RPIB 3IB4A 1MFEL 4JDZA 5EBGA 1W8NA 2XQYG 5HPOA 3QDMD 1HYRC 4HT1L 4MCZA 3O2DL 2EEBA 3FQRA 5INCA 4Q2ZA 2QADB 4HF5H 4MXWL 4OD3H 5D71H 3BPNC 3EOAB 1OT2A 1S9WB 2C4FU 3WL9A 5HVWA 3BHBA 3UYRL 5FYJL 1OGAB 4MA3B 3PQYE 1SEQL 2QV2A 2MSPA 3QDGE 4BKLB 1Q94B 2FEDC 4X7DC 2CDFB 1J0KA 3MLZL 4JREC 4TUJB 1Y18B 3BJ91 1JP5A 3SGEI 5BMFH 1T7VA 1RQ5A 3VI4E 2X4OB 4O9HH 4MD0B 5I6XC 3ZLQC 4PB9L 3FN9A 3IXTB 3ULUF 5IVXF 1WT5A 3V4UL 4PTUB 1EH9A 4BFBD 1FLTX 4LSPL 1WZKA 2GJ6A 4KZDH 2IBZX 4JG1H 3HAEG 4X6CA 3TGXA 3VXNB 3AC0A 1EV2E 4Q0XL 5KS9B 2ARWA 5ESVB 3I6KB 2CLVA 3SCMC 1FRGH 4UUJA 3F7VB 3LEYH 1ONQA 3MNWA 4X4XB 4UNVA 4WEMB 5E2WL 4QY8B 3N1MC 3N50A 3NGBB 1R3KA 4IOFD 4L3EA 2XPGA 3QQ3B 3VXMB 2VDLH 1I85C 4HKBB 4PJ5D 1AQKH 1A02N 1T83A 4OZFH 3FQWA 3QNZA 4IHOA 5E00A 2YRZA 3HB3C 2F54D 4Z5RA 5CBAA 3KHOA 2Z4QA 1ZEAL 1TTFA 3VFRB 5TDNB 2YKLH 3O6ML 3H9SB 2JB5H 5BRZB 3HR6A 3GMRA 1JWSB 4A6YH 1RULL 1X5XA 4I18A 4LKCB 4GSDL 5GS1A 2BNUA 2FIKB 1DR9A 2R0WL 4OF7A 2PETA 2O5XL 1Z9SA 3MACL 4NQED 2HKHH 3FTGB 1XCTB 4CVZB 4OQTL 2FYYB 2GW5A 5FCUL 3SGDH 1QLEL 3UBXG 1AD0B 1SJVA 1I8IA 2F74B 4NSKB 4L8BA 4NQUA 2X4SA 4FQIL 3PWLB 4F15C 1XF4A 4RSVA 2CPCA 1KN2H 4PB0L 5HDQL 3O6FA 3LCYA 4FP8L 3VD9A 4MD4A 4H20H 5DI8B 4PY8J 3HI1A 1F4WL 1JVKA 4PRAB 1LEIA 1ES0B 4ZPVA 3NIFE 4BZ2L 5HHMB 1HINH 5C0GA 5CJQL 3IDUA 4DZBA 3QXAA 4S1QL 1Y6NR 1WITA 1KPVA 1LO4L 5DO2C 2DMCA 2YWZA 3QXWA 3T3PF 4UNUA 4F7CA 4AMKL 3LSOA 5C0IA 1GZPB 3H2WA 1FZJA 5KVGL 1WBZB 3MJ9A 5IBUG 5I66A 3AMKA 2OR9L 5JDSB 5TH2A 1FN4B 2J1KA 1G7JA 4P3DB 3ECBB 5AZEL 1FGNH 1D5BB 5TGBB 3T65B 4ZO7A 3ARBC 5J4MA 4J3TA 3RDTC 3TNMB 3GRWA 4KROB 1EXUA 1YEEL 2DQHL 3MCLL 4Q7DA 3GJFA 5M94B 3V5DA 1CDHA 3JV6B 4P23D 3HZKA 4Y4KB 4JM2A 3KPRD 4CDHA 2D7MA 4TVSa 4XCNA 4AENB 4DK3A 2VQ1A 3PABA 1ZGLB 4K9EL 5CWSB 1J87A 3BPLC 3QG6B 1NFDE 3FMGL 3P40A 4XP1L 1EVTC 1KIPA 2QHRH 3U9PH 4QHLA 5K9JL 1TVHA 4X6BB 3K2UH 1HILB 4PV8B 3EW3B 5AUMB 1DQLL 1IC7L 2AEPH 3BN9D 5HHVH 1NBYA 4MYWB 1NAKH 5EOCJ 1S7RB 1WIOA 4NQVB 1FNEB 1W72B 3DI3B 5L7XL 1DVFB 4BYHA 2RCSL 5H37G 1R5IA 4M6ML 4HUVB 1GVIA 5DC9B 5TE4H 1KGCE 3UO1H 4QOKB 1H0DA 2VDRH 1WT5C 3Q5TA 1ORQA 2I9TA 5GS0H 5MEQB 4MJ6B 2NCMA 1ZHLB 2HYMA 1U8PA 7CGTA 3T1FB 1JZ2A 4RMTA 4KQ4L 5D1ZA 5D7IA 3OPZH 4KK5D 1DUYA 5LGJA 3A6BH 2AJZB 3QEQD 3QP3A 5FYLH 3LKOA 3QDJA 4PP2A 5C86A 3TA3A 4HCRL 2P5EE 5LXGH 3ZKND 2OMNA 5I1JL 3C6LD 1YNLH 5EZIH 3OAZK 2EC9U 1WVZA 1QFWL 3MA9H 3RNKB 5C9KA 3TVMD 1BBJA 1RHFA 4WU7B 1B3JA 1TQBB 4Y2DA 4Y5YC 2Y07H 5C0AE 3H0TA 1MEXH 1B0RB 4JZOB 1OP5H 3K1KC 1IM9D 2EXYC 4QHKI 5C0RH 3X3FL 3G6JF 5FGCB 1K4CA 2BSSB 4P9ML 4ETQA 3VH8B 1BJMA 4Y1AE 1N5YH 5IMMB 2VAAB 4I18C 1X6NA 5CJOL 4ACPA 5GS1C 1JHTA 3PJSA 3BH8B 1I7UA 3Q5YA 4FQXB 1JIBA 1SM3L 3GMQB 3MRJB 5MENE 3HHRB 1QRNA 2VDPH 1Z9MA 3BXNB 5SX5K 3S37X 3WLWC 3WYRA 5C08E 1FNGA 1CIUA 4QRQA 1I8MB 4HS8L 5ERWB 4GRMA 1RZIA 3D3VE 4Q97A 2WSKA 5C0BA 4QO1A 2PW2A 5CILH 2V7NB 3VXTB 1OQXA 4K8RC 4NN6B 2VXUL 5J89A 4XNQB 4QRTA 4P57A 5EWIL 2RIKA 3FFCB 3W81A 1EFQA 1T04A 3BKMH 4YXHL 3O6FC 1IBGH 2DJ4A 4LLUB 4M6NH 1MCDA 4U0QB 1S7QB 3CX5K 3HC4L 5ESQB 3MGAA 4G5ZH 4LFHG 3ILQC 3VFUB 4PJXE 1X5FA 5GGSY 5IG7A 3BYYA 3FQNB 4V1DB 1U8QB 1RU9L 2A1WH 4YHLL 5EZOH 3SDDB 3OKLB 4CJ1A 2R4SL 4NN5C 3VG0L 4LLYB 4M8QB 5IESL 4JZNB 4PJEE 4S1DD 3S96B 2WIIB 2BRRH 3KS0J 4YPGA 4WFEE 3MX0A 2E6PA 3Q3GA 2LABA 4M5YH 2EYSA 4Y19A 1U8OB 4B50A 4EVNA 5GRXG 3MGOA 2VL5B 5IB2B 1ADQH 1AY1H 2HFTA 4GKSA 4OZHA 2VE6B 2APTA 4Y4HA 5F1NB 4F7TA 1PEZA 1I1FB 3M8OH 5E8DL 1BZ9B 4YBQC 1TLKA 3QRGH 4M02A 5GGVL 2X40A 5HYQB 4M1DL 1FNLA 4GRLB 1YY9D 3SN6N 3L6FA 1U8IB 4X5XA 4Z9KB 4UQ2B 3CU1A 1BHGA 2NMSA 5HVHC 4ZO9A 4NQCB 2RFXA 4HF5L 5F96L 2FECL 3REVB 4TNWK 2YUXA 5HHPB 2NY0C 1B90A 5F1IA 3CDFA 1HHGA 2VO5A 2EH8L 4XP9L 4PJDE 5TQ0H 4OCLC 1UWGL 5CZXD 2HT3D 4U1NA 2C3VA 2R15A 2DYPD 3V7MA 1AE6L 3IAPA 2GFBA 3ZMRA 2F8XC 4EN3D 1HNFA 1MFDH 5FV2A 2EH7L 1FLRH 1KC5H 3DETD 5FAAA 1WICA 3N85H 2BJML 4U7KA 5D1ZC 1MRFL 1GPOH 1ZA6B 4DVRH 1JRHI 3TA3C 2Q8AL 3ARUA 3GB7A 3BQUA 2GI7A 4HC1A 4BA8A 5LQBL 2F53D 3W9DA 3BH9A 4KZDL 1P7HL 4JO2L 4XVUC 3V4VH 1GH7A 3FL7A 2D0FA 4JO1L 4S10A 1FRGL 4Y2DC 2CLZB 4PRBB 1Z9OA 4MXQC 1DDHA 4JFDD 1DN0A 3G5VA 2VDLL 2IAMD 1JTTA 1WAAF 1KJ2L 4PRIB 4L9LA 1C1EL 5IUSA 5I1EL 4M7JH 4OBSA 1D5XA 3V52L 1GRWA 4UB0H 1MI5D 1NGXA 4X99B 2JB5L 3BGAA 8CGTA 5E56A 3V0WL 4RAUB 4MAYD 5L0QC 4X6DA 1NAMA 5GS2H 2ZCHH 4E42B 1N26A 3ZT5A 2HKHL 3DSFL 4KMTL 4ZMAT 3RGHA 5JR1L 3H42L 5GHWH 3ARFD 4NHUB 2JK5A 1XIWA 4X80H 1RUQH 3MBEB 5D7SH 5I1IH 1ACZA 5T1MB 1D6VL 4YHOH 2HRPH 2NTFB 5HD8D 5JW5B 4OCXH 4FTVE 2QSTA 4FQ2H 2IANE 2VL4A 2JJTA 1A7PL 4MA8L 3WMSA 3BP5A 3NACL 4CU6A 5HHQB 3K8MA 3AROA 4XZUB 1FQ9C 4LHUA 3C2AH 5F93C 3SKJL 1XGQA 1C12A 4BFIB 1KJ3H 5EZJB 1M4KA 4QTIL 3O45B 1BBDH 4ORGB 1UKTA 5JHLH 2WLYA 3MRCB 4KKLD 4BSVB 1A0QL 1UADC 5KN5B 4WTWA 2EYTB 4X8JA 4NO3A 1C08A 3GI9H 5DHYA 5CZVH 2CUIA 2PTUA 2Z35B 4WCYH 4YDLC 1FYTD 4OLUH 1CVSC 4LDLB 5F9DC 4LFHD 4OD1H 1A1OB 1FGNL 4RAVA 1PZ5A 4O58L 3NOIA 4HGWA 4LCCA 1MCPL 3MRFB 4WFHD 3WFHA 3QPXH 4YGVB 2DICA 3GSNL 4TSAH 3HTLX 1GCFA 3F7PC 1AD9B 4JFHE 1ZLUH 3S3SA 2VQTA 2D7TL 3I3BA 1J8KA 3GBNL 1OSZA 1N3NB 4S11A 3DRTA 4KJQD 3MV7E 5I1KH 4HPYH 1JYWA 2YA1A 1QHPA 43CAA 2G9HB 3U9PL 4Y4FD 1JF1A 1ZWIB 4OCWH 2AK4D 4NBXB 2AEPL 2ZUUA 3RKDC 4APQD 3D85A 1FFNA 1NAKL 5DFVD 3SE8L 3CDYA 3O2VH 5DJYA 1XMWA 4LSUH 4ZD3L 1N5AA 1NLBL 4GW1B 3CFCH 3NCEB 1Q9LB 4LIQE 2VDRL 5GS0L 4DN4L 4TVPH 1ERNA 1WCBA 3BQUC 3E2HB 4YDKH 3VDAA 3S6CA 5ETUA 3MV8A 5C0DB 3KR3L 3TYGH 5IB4B 2BERA 4LVEA 4WI2A 2CQVA 5LXGL 1K4DA 2W0KA 1IAIM 2PXYB 4N0RA 5F3HA 5E6IA 4U1LB 1YNLL 1XF3A 2EE6A 5EZIL 1DSFL 3GUTB 3Q6GH 2H32A 2J6EH 4L9LC 3VFVB 1C5BL 5T3ZE 5SV3A 2PYEE 3L95A 1CDIA 5EN2B 5IW6A 3HG1D 3TWCL 4J3VA 2PUQT 4NM8H 1N5YL 4EQ2A 3KPSE 3VGGA 4QHMA 3NIGE 1IT9H 3LD8C 2C3WA 1NBZA 4G80B 1KT2B 1FORL 4HFUL 4P5TB 1G7IB 3RY5A 2VDPL 3OXSA 3RWIB 4NNXA 4ZXBA 5EU6A 4PJBE 3WIIH 2V7HB 4XC3H 1RZJH 5GGTA 1RK0A 3JTSA 3BVNA 2AEQH 1G6RB 5SV4A 3BDBA 1XIWC 1EVUA 5FV1L 5FO7B 1CG9A 4MVBC 4G6JH 1G0DA 2WV3A 1EIBA 1EERB 5TJWK 1FZOA 3MROB 1A21A 4LLVB 3BW9A 2VXSH 2FIRT 4IRSB 1JGUH 3MLTB 3BUTA 3S37H 1IBGL 3VD3A 3QAZC 2JJTC 1GC1H 4ZPTA 1M7DA 4R2GC 4F2MB 1KXQE 3BRFA 4NZRH 4R3SA 2GY5A 5D7LA 2MKWA 3VFNB 1QQDB 3D18B 5JHDA 1X5ZA 4XNMB 1S5IL 5JXAL 4MLSA 4FN0A 3SOBH 4WI6A 5EZOL 2RHEA 4IIQA 4BSWA 4TSCL 1IE5A 5E1AB 4DN3L 2LU7A 1A1NA 5GRJH 5AYQA 3DMMB 1FP5A 2W9EL 1SVZA 4K3EL 4QRPD 4WFFE 2BRRL 2J8HA 4CN6A 5DJZB 4H0HB 2PO6B 3VD4A 4LCCC 4C56A 1S9KC 4YHIB 5CLWA 4HWEL 3OF6A 5E5MA 1AY1L 4LVHB 1NGZB 2GITA 4OAWA 3ZKXC 2HVKB 3AXLA 5ICZA 4NPYA 5SWZE 4LSTL 1CBVH 3M8OL 2B4CH 2R69H 1YMHB 3S36L 4BQBA 5KSUB 4RDQF 2QQNH 3LN5B 1D9KB 1D5MB 3KYOA 2NZ9C 4OZIF 3U2SA 4HMCA 4E41D 1MHPH 3QQ4A 2A0LD 3TCLA 2WAHA 3EGSA 4KKAD 1KTLA 4JKPH 4Q9CA 5J13C 1U8JA 3LAFA 4HIHA 3ZKMD 4PJ9B 1OLLA 3RL2A 4F7PB 2X4RA 1E6JL 4LIQL 3U7YL 1PBYA 2YPLD 2Z31D 4OBRA 3S4SB 2W65B 2GK0B 4Z7OF 1H3XA 4M7ZB 5HI4C 1MFDL 2NNAA 4ZTOH 4UILH 5J57B 1BIIA 4RNRA 1UM6L 1FFOB 1MHEA 2VSCA 4JPVH 5DJXB 3GK8L 5EUKA 3Q1SL 4F58L 1KTDA 4FFWC 4PIRF 3MRIA 3LRSB 3E1F1 2CDGB 4QGTA 5E6IC 1BFSA 5T5NF 4U0RB 4HDIB 2A6IB 4F9LA 4HKXB 3NCMA 3NZHH 4M61A 5DUBA 5DJ8B 5BQ7B 5T3ZL 4ZUWB 3ZKSD 4HIEB 4FABH 1R0AH 1IKNA 5E5UB 3V4PH 3CH1A 1BFOB 1T4KB 2IFGA 2YEZB 3MRMB 1ACYL 2W1NA 2R2EA 5DR5H 1YDPB 2FJGB 5DA0B 5D6CB 3WKML 1ZANH 1M05B 5D2LF 1P9MA 2JTDA 4K2UH 3V5HA 4DTGL 5FF6A 3D0VA 4M7JL 3PV6A 5HYEA 2LTQB 3J8F7 4N0YL 4UB0L 3VFMA 3D9AL 1T7YA 5EPMA 1IQDA 4ZFFA 4DZ8A 5FKPB 4ZXBC 2LE9A 3T4AA 1JUFA 3QA3B 4UIKH 4O51B 1S7VB 3MRKA 5K59F 3L3GA 4Y2OA 4DKFL 5BCAA 1T2XA 2JELL 3G5XB 3PQYB 4WEUD 1NKRA 3QDGB 3DXAE 43C9A 3O6LH 3B2VH 5D5ME 5CZKA 4BH8A 2HLAB 1X5AA 3OBAA 4FNLL 4LASL 3JV4A 5GHWL 4FHBD 5DJ0B 1JGVL 1FL6A 2BCKA 4OZGF 2P48B 5CEYA 1RUQL 4WNQA 2OR7A 4PLKD 4E0RA 3CVHA 3PWPA 3QWOA 5E99L 5IVXA 2VZ1A 4OCXL 3UP1A 3ZTJH 3DGGB 4Z95H 4PTTA 2A6DA 4K71B 1JPFA 4MNHB 4IJ3C 4YE4H 5HYSB 4IIQC 5EFIB 5BVJA 3G5YA 3N1GC 1FCCA 3RWCA 2YSSA 4F33B 5KJRH 2V5RA 2WBJD 3UJJH 3P11H 5JHLL 2D9CA 4JM2D 5DQDL 1RZ7H 2WW8A 3GI9L 2GJZB 1IGMH 4ZDHA 1DEEB 3L7FB 1ZVYA 3C9NA 4H1LH 1L0XA 4X5LA 4OF0A 3W11C 4WU5B 5C0NC 4PG9B 1KBGH 2FJHB 3KNBA 1BAFH 5K33A 4JRYD 2AW2A 1CCZA 2D31A 3I75A 2X4TA 1T0NB 2EYRB 4TSAL 1TITA 1CE6B 4FMFA 4TULH 3HNVL 2DWEB 3M1BA 4FFZH 5AYUH 3BD4A 4BK4A 1QHOA 1H9VA 5JO5A 4GW4B 1CD9B 4HPYL 3FB6A 2XKUA 3MRRA 1I7TA 5L2JB 4M7LT 3DUSB 4C4KT 1AKJB 1A4KA 1YEHL 1JHLH 3CVIL 4N1HB 1P4BH 3QDJD 2PKDA 4I5BA 3MREB 4FQCH 1U2HA 4AQ1B 3WNMA 3I6LE 3O2VL 3AAZA 3GSRA 1F6AA 2A2QT 4LSUL 3IJHB 5FB8A 3ARED 4U31A 3QZWG 4Y2DD 4XCCH 3OKMB 3UZEA 3GMPB 2J8UE 3CSBA 4O2EA 4JQIL 4TVPL 3MUJA 2YOCA 5HGBA 2JIXB 3VGBA 3V6OE 4R26H 3QRFM 3QEHB 2P5WD 1OB1A 4F9LC 3VRIA 3CD4A 3GKWH 3UDWA 4Q9RH 4NN7C 4LCWD 2C7UA 1RUPH 4GUPA 4XI5C 2ESVA 2VLRA 1TJIL 4F3FA 4TUOB 1IKNC 5KSAB 3SJVB 3BYTA 2FD6H 3I9GL 2FLBT 1MAMH 2X4UB 4LSDA 4WV1A 4NO0A 4KHTH 5F7HA 1P9MC 2YPKA 2VERN 5DLML 5C0BD 3IJYB 4GJTB 4PPTA 4LNRB 1NMBH 2XZQL 1FV1A 3RWFB 3B6SA 2BK8A 3EO9H 4LHUG 5F7EL 1HHHB 2X41A 4GT7A 3IDMB 4LLMB 4WWKC 3S35X 4NM8L 3RVUC 4JFEA 2ATKA 1XGRA 4FXGA 3MOAH 3SDAB 2VR9A 1INQB 1NFDB 3HC3L 3KYMB 5HHXH 3D39A 3BIKA 3FT2A 4OSUL 4NFBA 2VISA 4RMVA 4JZJB 1JNLL 1O0VA 1YJDL 1RZJL 1UEMA 3PHQB 2Y5EA 1I3RB 2Y36L 3HE6D 5C2BL 4D9LL 1VESA 4FZ8L 3EFFB 4XRCB 2E27L 3GBMH 1RZGA 5I71C 4RX4A 2YD8A 2DL9A 3I85A 2WNGA 5JNYA 1G7MA 4P3CL 1R3JB 3ULUC 4NWUH 3BE1H 2VXSL 3MRBA 1NCBH 1JGUL 3IS1X 3VFSB 4HLZG 1EAPA 2AV1A 4Y19D 4N8CH 3MUGA 4GW5B 4J8RB 5IHUL 4X7CC 1CK0H 3K80A 2N4IA 1FFQA 2P5EB 5FA4A 2BVEA 3ZYIA 2MTPA 4G7YH 4RIRB 4U1MB 2CDEB 3HKFA 4Y4HD 4ZQKB 1R3HB 2K1MA 2M26A 3TYFA 1XH3A 5KG9A 5ISZA 3BWAA 3DHMA 5D72H 3WHXA 4DK6A 3O11B 1UXSA 1Y0LB 4HEPG 1S5HA 5EUOA 5C0AB 4NUJA 5GRJL 3B4NA 4MA1C 4J2XA 4XPGL 1H15B 5CD3B 4EUPB 4Z7WE 3KPOB 4KC3B 3G6JA 3T2NL 1CLOL 4K3JH 3R06A 4Y1AB 1KJ2B 4YDIL 1UEYA 2XG4A 1F2QA 2PYFA 1S7XA 3RI5K 2AXHA 1FNFA 3EOBB 1TPXB 1F00I 2CGRL 5MENB 2MCPL 4MWFA 2ZSWA 3U4EB 4DGYL 4JFQA 3NZ8A 5C08B 4M5ZH 4OQTA 5FOJA 3DVFA 2AGJH 3U0TB 5FIEA 4TOYL 2YN3A 5LBSH 1SMOA 1GIGL 5IK3A 5CIPA 2C26A 1T2JA 3BN3B 2FATL 3VDBA 1GAFL 3E6HB 3QUMA 1YPZA 3C5ZB 4Z7UE 4JKPL 3BO8A 3IVKB 1A7BA 2E9IA 4OIIH 4MJ5B 5CHNA 5HJ3A 3QNXA 5DHVH 4PJAF 1YYLH 1P2CB 2ZUQB 1CL7H 3MUHL 3VWKA 3V95A 4PJXB 3S5LB 3DHJA 4YO0B 4XBEH 1NJ9B 1WWBX 2YXFA 3OR7B 3MRNB 1JPSL 4N90E 4HUUB 3EO0A 4ODSH 4UINL 3CFKB 3VWJB 8FABA 4N5UA 1MCNA 1C5CL 1NH6A 3IDGB 5H37H 3UDWC 4U1JA 1K2DA 4UV4H 1IJ9A 3SPVA 4CN1A 1GSMA 3MA7B 1AGFA 3SE4A 3V0AC 5F7YC 1AXTL 3EAKA 5BW7A 2MPAL 2F5BH 3KG5A 3NZHL 3FO9A 4WV1C 1ETZA 5CEZD 3TIDB 1NEUA 3NCFB 1ZS8A 5HYJE 4HQQL 2PR4L 3HI6H 2I26N 4L4TA 5EIQA 2LU4A 3QO1A 1ORSA 3R1GL 4L29A 5MHSE 2XWTA 5DR5L 2XICA 4LVNC 1DE4B 2E7MA 4IS6B 1NBVL 5ABDE 3K1DA 4PBWD 5FUCC 1MCWW 3AVEA 4WHYH 5ANMA 1LEKA 2R2CA 3H9YA 4AIZB 1MCFA 5I73B 4XAKD 3B3IA 5JPMA 1Z5LA 4X7SH 2BC4B 4XVJH 3MOBL 1VFAB 2HTLD 4JHAH 1Q9OB 2H2SD 1IAOB 4I3GA 1J0ZA 1UFUA 1EA9C 5I2IA 4OUUB 4PV9A 1KF9B 1ZT7A 2EDRA 4XGZB 5ADOH 1MJ7L 3P73B 4OCYL 3W0WE 2VZOA 5ACZA 5BV7B 1U3HD 4UU9B 3NIDF 2XFXB 3WXVH 5SWQB 3C5JB 3K46A 5H2BB 4ELKB 3D2UB 4MMXC 3B2UC 5JW4M 1LO5A 1U0QA 1FG9C 1MRDH 5CP7B 5KOMC 2Q6WB 5D1QC 3O8XB 2MCG1 1AP2B 3K2MC 5KW9H 2IPKB 1J1XH 3EO1A 1M7IA 1DUZA 3VFOB 4R4NC 1B0GA 4PY8I 1MQ8A 5IFHL 4PRDB 3U0WH 4YE4L 1S3KH 3KPNB 3QUZA 3MCKA 5KJRL 3ROLB 4B53A 3UJJL 4CVXB 3VI3F 4PS4L 2GSGB 1WAAA 1HXYB 1RZ7L 3L3IB 1YYML 1BOYA 3SQBA 1ND0A 2BHYA 4UQ3A 1UACH 4G8EA 3TFKD 1DBML 5EORH 1S7SA 4FFVD 2X4NB 5I1CL 1CICC 1FH5L 3MNZB 4NZUH 3OXRA 1IILE 3REWA 2XKSA 3EJZC 5T1LD 1BAFL 3D85D 4HUKB 5AZ2H 1MAJA 4JJ5A 4MLIA 3WEXA 4RMRA 1T21B 2CIIA 1J18A 3LEVH 3WS3B 5L9DH 1RZ8B 2WUBH 4TULL 4XP5H 3ARDA 4F7EA 4QHUB 4WUUE 1HZHH 4R7NB 2O5YH 4U1KA 3H3KA 3QR2A 3MV8D 1IAIH 1OHQA 1QFUL 3AUVA 3FZUD 2Q3ZA 1AO7D 1T5XB 4NO5A 2DAVA 3MLXH 5EZLB 1AFVL 1P4BL 3FFDB 4YZFE 1N2RA 1U8NA 3PL6D 4NFCA 4FQCL 4OLWH 5FYKD 2EDFA 3P4MB 3VWKC 2IANB 2WIMA 3P9LA 3VXPB 5LWYH 2NY1C 4K3HA 4AK1A 2NX5E 2VABA 3QXDA 2ZWLT 5T1KD 4OZGB 2YD5A 1OARH 1VFBA 2FB4H 3C60D 3MLYH 5D7JA 1SVCP 7FABL 3TZVD 4XCCL 2QQQA 4L1HA 4UV7H 4JFZL 1MCOH 4RMWA 2XWBB 3RKPA 1Q0XH 3SE4C 3T3MF 3CH8A 3SGJC 4JHWL 5C0JA 2AXGA 4J6RL 4EBQH 2EDNA 5H94A 4X9IA 2BNQA 4Q9RL 1UB5B 3DX7B 4Y16A 4L1DA 3QH3A 3WSQL 4QXTA 2EIZA 4JM4L 4Y5VB 4GS7B 2VLJE 3L3OB 3DI2B 2FD6L 3OGOE 5L88H 1U8LB 1X5YA 4ODVL 4LU5H 3BPCA 1WF5A 4K9EC 1IGYB 5HHNB 4ODUA 4WWID 1HKLL 1KULA 2I5YH 2HG5B 1HSAB 4DKDC 3EO9L 1K8IA 3QIWC 4DUWA 1NPUA 3O9WB 4NYLA 5C92A 3UAJC 5IKCA 1YN7B 2BVOA 5J56B 3DVNA 5SX4H 3MOAL 3MV7B 1CVRA 5DXWA 1QLFB 2GAZA 2A9MH 2OJEB 4MNQD 1OPGH 3ZL4H 4AQOA 3ZT7A 5D93C 3MV9D 2VJXA 3VXUE 1NC4B 1R6VA 5BZWA 4NP4L 5D7LD 4G8IB 5H8DA 3DBXB 5D2NB 4NKOA 3TIEB 2ITCB 2UV3A 3PWNB 5FECB 5JHDD 3S35H 4XPTL 4XBGB 3D6GA 3F5WA 3GMLA 4HIXH 2ZKHH 2CJUH 2I9LA 3UMTA 2ZUYA 4ZAKA 1AGCA 5GJSH 4H26A 3IFPB 3TT3L 3LB6C 1OGTA 3BE1L 1OTTD 5EBWB 2OL3B 4ONOA 3EHBD 1JWMB 4OT1L 3VW3L 1RURH 2LU3A 3BDYH 3PIQA 2OI9C 3L3HA 3QUYA 2YZ8A 1JYNA 1DLFH 5SWSE 2XTJC 3V7AG 4KI5D 1WTGT 4N8CL 5DVMA 3GSUB 2VDQL 4P46D 5JORB 1CK0L 2DWDB 4CADA 3QUZC 3CZFB 3BWUC 1YEIH 4G7YL 4W4NA 1F3DH 3LN4A 5MEOB 2CKNA 4PJ8D 4QRUA 1L7IL 4OLZH 3OKOB 5KSBE 3WXWH 1MFAH 5DHXB 1AR1D 1WBXB 3TBYA 4OZFA 2VLMD 3WO4C 2UY6A 35C8L 2ZOKB 1U8MB 4DEPC 2PYEB 3TPUA 5EU7C 2YHGA 1YMMD 2QSVA 1W2KT 3FAXA 1M7XA 4R97C 1N64H 4ZNCD 1J7VR 1ZT4A 2Y5TB 5GGRY 4A6YA 4S1SH 5C71A 4KRPC 4GAJH 3KPSB 1LP9F 3L7EB 1KJMB 1TVBB 5FM4A 3VFGL 4NWTH 5F7UA 2EDKA 3QJHB 1RIUH 3WS6C 1S9WA 4NCC2 1P69B 2Z93B 1WFOA 4R4FL 4M5ZL 3RZCC 4PJBB 1VPOH 4N5EC 3NPZB 4BKLA 5IMLA 4HWUA 3L5WB 2ICWB 3O4OB 3HMWL 3F7QA 1DLHA 5C0CE 1E6OH 1CD1A 5LBSL 2XI9A 5EH1A 1WEJL 2Q7YA 5I1AB 3GSOA 4XCFL 5I74C 2X4OA 4Y5XB 3FQUB 1YEFL 2E6QA 3RWJA 1HI6A 3OB0H 4GRWE 2NY6C 4E5XB 4YDVA 1BVLA 1BM3H 5HI5C 5D7JC 1YEDB 5IGXH 1J8HD 1T6VN 2DI9A 4U05A 4S2SB 4X98B 5IVZA 4XI5D 5JW3H 1N6UA 4XBEL 1JZ7A 2UWEE 4L8DA 2BNRE 2NW2B 3Q2CA 4W4OA 3EDJA 4X6FB 3RBGA 4K23H 4KPHL 3QQ3A 3K3QA 2DQCL 3O3AA 4HKBA 4UV4L 1YEKL 2AJUL 1JYVA 4FQLL 2YXMA 4HH8A 4HZLB 2BVPB 2CRZA 3LQMA 1IARB 1LK3L 1MELA 3RVUD 4BZ1H 1J5OH 3C8KA 4YQXH 2WBWB 5I1GL 1U91B 3IFLH 3ARGB 3HI6L 3H7BB 5E8OB 3KPMB 4X4ME 3UC0H 4YIQB 1RAMA 3C87A 3LDBC 4KDTC 4JY4B 1Q1JH 5SWZB 1XCTA 4ALAH 3ZE1F 5IVOA 3IT8D 5MP6L 1TJHL 4MDIB 5E9DE 4G8GA 5E08H 4PJ7F 1U6AH 4KK9D 1I9IH 4OZIA 4GOSA 1I3GH 3PWPD 4XVJL 4IRJD 2F74A 1R3IH 4HJ0D 1CLZL 5F7KC 1BQHA 3KXFD 1PAMA 4GQPH 1FZKA 4N0CD 4U6YB 5DI8A 4HKZA 5IEHA 3BIBX 4HLJA 4MMZC 5DEGA 3MJ9H 1X6LA 2IWGA 4MJIA 2UYLA 4PGDA 4EI5B 4NRZB 2J2ZA 2EEDA 2F8OA 4LMQE 3V5KB 2FCBA 1EEYB 3QUYC 3ULVD 4IRZH 2DBJA 1NCDL 5DD6B 4QRRA 1MRDL 1RUMH 1GZPA 4HJGA 5HHOD 4WY7H 4CNIB 1JK8B 4P2CG 1KYOJ 1NL0H 1C16A 1KLGA 1FZMB 1FN4A 1S78C 3NFSH 3U0WL 2ZNXA 1WBYB 3ECBA 3GNMH 4KJYB 3QCVH 5I9QB 5CCKH 3WIHH 4HULB 1RI8A 1P84J 2A77H 2NR6D 4HIJB 4ONHB 2P8MB 2WM0A 4OIAA 2R0ZH 4NQDA 2ZSVA 2DIAA 3DPBA 3GM0A 5D2LA 1TCRB 2AERT 3JV6A 1R5VA 5J6HB 3LS5H 4Y4KA 1ZMYA 3V6FB 5BXFB 4EIGB 4XPAH 3I2CL 3D25B 4AENA 5BS0D 3BGFC 3RWEA 1J88A 2NXZC 2WP3O 1I1AD 4QNPE 3QNYB 1A4JB 1IM3A 1HHKA 4X4YB 3QSKB 5E6ZA 1KCVH 1EJOL 3PWVB 4RBPH 2VXTH 1T1WB 2YD2A 5DQJB 1ZV5A 3W5MA 5C0CD 4FA8A 3LEVL 5L9DL 4HFWB 1DVFA 2WUBL 3CFBB 3DXAB 1UCTA 3T8XA 4WO4B 1OTSC 1DANU 3AU1A 1NCTA 5J0BA 3LOWA 1KPUA 5JMOC 1LK2B 5EU4A 4DGIH 2ICEB 4TYUA 2O5YL 1I9RH 1AQDB 2AI0H 2DQFB 4QOKA 4NT6A 4ZFZA 1CFQA 4MJ6A 2GJ6E 1EUUA 3FQXB 4YAQA 5T33H 4X6CE 3IU4L 3DRQB 5E03A 4OLWL 5IEKA 3IGAB 4DGVH 1P4LA 5LWYL 2AEWA 5DJAB 4G9DB 1J9CT 2OQJA 4L8SB 1OARL 2FSEB 4W4OC 4L3EE 3MLYL 1IL1B 4TTDC 4LVOC 4WU7A 3Q6FB 2G5BB 1B2WH 4P49A 1V5JA 5LCVH 1U58A 3ELAT 2YA2A 5TDOB 4RGNC 2RBLA 2HMID 1ED3B 4G9FD 5EO9A 5IW1A 5TQ2H 1CGUA 4JFED 2L4OA 4Z6AT 1QPPA 4LSRH 3MFFB 4OLEA 3RU8L 1BX2A 3T0WA 3KDMB 2VAAA 3LEXB 2ARJB 3KJ4C 3O3DB 4HK3N 1UH2A 1ADQA 4TSBL 3QFDB 1FVDB 3BEWB 3S88H 4BK5A 3PDOA 3HCVB 2IGFH 2NY4D 3B43A 3SE9H 5CUSH 3WNKA 1UA6L 5C9JB 4OGAC 1U93A 5DD0H 2E5EA 2I5YL 2NY2C 1UYWH 5L6YH 3NFPB 1QYGL 5DMIH 4JKWA 3TN0B 4DKEH 2ZCKL 3EZ8A 5HVFB 4R4BA 1DCLA 3P2TA 4FMKA 5I18L 5I8KH 1INDL 4XNQA 5GRVL 2A9ML 1F90H 4Z76A 4JG0L 5KVMC 4J1UB 1HKFA 2HVJA 3QFJD 3FB5B 1K9TA 3KPTA 2ICWJ 4LLUA 4JRXD 2GHWB 1NSNH 1QFHA 5GS0C 2CKBB 1F4YH 3FONB 1KCSH 3VFUA 4XWGL 5AWNH 2SEBB 3FQNA 4V1DA 1U8QA 5DSCA 4EJ1C 3EYVB 5GJSL 1PG7H 4J4PA 5FA3B 2FEEL 4U49A 3OKLA 4L4VD 2J8UB 5B39B 3EDDA 2R0KH 2IPTL 1MJJB 1A1MA 2HLFD 4Q6YA 3NCJL 3HN3A 1F4HA 1DLFL 4HWBH 4ZUSB 1BIHA 4PJIF 5IHZA 3OB8A 4LCIH 2C1OA 4H25A 1EEUA 1OAZL 4MQ7A 4QCIB 3SDCA 4BQCA 2FH6A 4D0DB 3WUZA 5IB2A 5CINL 1MCCA 3X11B 4HXAH 2V5TA 4KQ3L 2CUMA 5C09D 1BGXL 5IOPB 4YR6B 3Q5OA 15C8L 4YX2H 1I1FA 3GJEB 3WV0A 2B2XL 4Z77A 3U36A 2OTPA 3FN0L 3U9UB 3IXAB 1TNMA 2GK2A 4GAJL 1X4YA 4UQ2A 3QULB 3BJLA 5I8EA 5J12B 4MDJA 1QSFD 2H2PC 4JCLA 1KG0A 4JO3H 1RIUL 2DTSA 1BJ1J 5A1AA 3TH4T 4YDJA 1A7OL 2IJ0C 3B9KB 3VWKD 2IALA 1HQRB 3IF1A 2R1WB 2Z91B 4JGMA 2OTWB 1DBKH 5C0EA 4TUKH 3LKRA 4LSQH 2XZAH 2CKBH 1NCAL 4P2RD 5D7IE 5TE7H 2P45B 4WIQA 2HN7B 1KIQB 4QGYA 1NCUA 1OOAA 1RHHB 3CFIC 1SYVB 1FL3B 4FQQB 2DIJA 4OZ4B 3OSKA 1A6AA 1NCCL 5D1XB 5GSRA 3T0EE 4PJGF 5F89A 4JDTH 2CLZA 3FQTB 4PRBA 3G04B 3QUXB 4NCDA 4XB7A 3P9WB 4WW2F 5HYIA 1F58H 1CQYA 3QDHA 1NC2D 4P3WA 2DQIL 1WQVT 3CSPA 5DS8B 3RGVB 3FOMB 4JEGB 1JBJA 4B5EA 4Z7WB 1I7RA 1MIML 1V7MH 2OK0H 1W0WA 2BSED 1CF8H 1QRNE 1J5OL 3FN3A 1J1OH 2VKXA 4AEIL 3FB7B 3IFLL 4WFGE 1T03H 3X14B 2GTWA 1H8NA 5F6HI 5JPNA 5DDHA 2UY7A 2DBLL 2R39A 4K8RL 3UC0L 4WI8A 1D5IL 1LQSR 3MGTB 4FRWA 1DANT 2OSLB 2ZOLA 4NZDA 1KJVB 4HKJB 2I07A 2EDLA 3ES6B 5F70A 2E9WA 3BKYL 4XTRC 4OZFG 5EBMB 3ZDYE 4ZFGH 4PUBL 1I9IL 3HE7B 4I0KA 1T3FB 3LMJL 2KZ1B 1T66D 4LGPB 5T1MA 2VLKA 3OG4B 1OP3K 3UTTD 3SO3B 5EO1B 5FDWA 4F37K 1OF2B 4PJAA 6FABH 3HRPA 3VD5A 4J4PC 4HV8A 5HHQA 3MJ9L 3QIBD 1H3PH 4PRPD 4XZUA 2EDOA 2L7UA 1QBML 5FGRA 1OAXH 3QXVA 1MCHA 4PLJD 5E5RB 5CP3H 5EZJA 2P8LA 3MRPB 3KYNB 4ORGA 5IB1B 1HOCA 1YA5A 4BH7B 4WHTA 3MMEA 1M71A 3H9HA 2X4PA 1NCWH 4XBPA 5J1AB 4WY7L 3GRWL 3ESVF 5GGQH 3SKUD 2JCCF 1OQOA 4ESKA 1NL0L 4NKDA 3SDCC 2QKIA 4PY7A 1AHWB 5JUEL 3UTSA 4ZNEA 3MRGA 4OZHE 2J6EA 3QCVL 2NXYC 1RIHL 2WWKO 4POZD 3STBA 4PR5A 4DW2L 4PD4J 5HYJB 4IOIA 5A40E 1GYAA 1P53A 1FJ1B 3OL2A 4WUKH 2Z8SA 2ZCLL 1I8KB 5EC2B 4XX1G 3HPLA 4HBCH 3ARDD 1IM9B 1IGTB 5TDPA 1CFVH 4O4YH 3BZ4A 2DL2A 4RMQA 3J7HA 3LHPH 3FO0L 3P4NA 1BZQK 5I16A 1H3UA 2H3NA 4AEHH 1MY7A 5DRNB 1KCVL 2IQAB 4YNYA 1RY7B 3MUZ1 1A14L 1DQQA 1BD2A 3RWHB 1HH6A 4D0BB 4KUZL 1JMXA 3IDNA 2E8ZA 3AY4A 3AFLA 4JKLA 4DCQB 1KPRB 2X1QA 2NTSP 3UYPA 1YUHA 3P4OB 4OM1L 4GBXA 2I25N 1ZA3A 2VRAA 3GI8L 5FGBA 5IFAH 4CMHC 25C8H 3WLBA 1KNOA 2QHLA 3TBVA 1S7TB 4LQ1A 4RDQG 1VFUA 4OD2A 2H8PB 4I0PD 4XCEA 4Y16D 4ERSH 4PGCB 2X70A 5HGAA 1HXMB 3DSNA 5I1DB 1TZHB 3T0ED 1HIMH 1YECH 3OKKB 4D9RE 5ILTL 3BEVB 3H9SE 4PBVC 2DM3A 3VMNA 5EULV 1B6DA 3VFVA 3UTZB 2VXVL 3AS3A 3DO3A 2UZYB 1CR9L 2R1YA 3NH7H 3V79C 5EN2A 2DN7A 1T1XA 1T1YB 1CXLA 4XCYA 2YRPA 5I15L 1ZXQA 4X5WA 3MRHB 4IDLA 1JZ6A 4BFEA 4ODXA 3BAEH 1TNNA 4KZEH 4X6DE 4XNZC 3I50H 3S88L 1DBAH 1LO0H 3SBWA 4XPBH 5T5NG 2IGFL 3TBSB 2B0SH 3SE9L 1CGXA 3HUJF 3RWIA 2L0DA 3O4LD 5DD0L 1K6QH 4I3RH 2DB8A 1QSED 4RRPA 1G6RA 4M00A 5ALBL 1AJ7H 5GRWA 4ZAKD 5L6YL 5DMIL 5EOQH 1ZKAA 4P2OC 5IBUB 4DKEL 5HHME 3SDYH 1A6VH 4WUUB 5DT1L 5L2KD 3CFDB 3BGMA 3MNVA 4ZTPL 2NY3B 4L3CB 4IRSA 3QUYD 1CFNA 5MERB 2HTKC 3C6SA 1K8DA 4LQFL 4OF8A 3KPPA 2HFEB 1NBQA 4Z7QE 4YK4B 5DZLA 3OQ3B 4L9DA 1GXEA 2GTZB 1RJZB 4H0GA 4MS8D 4QEGA 1NSNL 1YY8B 2NX5B 3QJFA 4MAUH 2FWOB 1NFKA 4N1EA 1DQJB 1OAYH 5DRZA 1HN1A 4LRNL 2DS4A 5IB3B 4QRSA 4GG8B 3X12B 1A8JH 4UMGA 4AIXA 3VXQA 2FR4B 2CXGA 2YRLA 3DURB 1OAKH 4OFYA 2AJYH 1DL7L 4YC2C 3VJ6B 4ZO8A 2GUOB 1PKQA 1X5JA 3QQNA 1MLBA 2F53B 4JM2F 2X7LA 2DRUA 4PJ5A 2NY7L 4LCIL 1G9MH 1I7ZA 5AG8A 1HDMA 2R9HC 2AQ2A 2ZG2A 4D8PB 2FH8A 2QADD 1RK1B 2XWJB 3FT3A 3BZFB 1LO3H 2VLJB 2ARJQ 4HUWB 1E4JA 1RJCA 1OGAD 2AV7A 5FUOH 3W82A 4JFDB 4HXAL 1OTUC 1HWHB 2OM5A 3HLAA 1Q9WB 3RWDA 3E3QC 3QI9B 1EO8H 4MSWB 1EHNA 1MCSA 5KSUA 1EK3A 1QNZH 4NQEA 4M9OA 1ZHNA 1HHJB 5MI0C 5ICXA 1RZJC 3OAZH 1HNGA 1LWRA 4TN9A 1P7KA 4JN1H 4U6VH 2BOBA 3HC0B 4RFEB 3RX8A 4YJZL 1WLHA 2R29H 3TO4A 5I17B 3AY4C 5DJCA 3L3JB 2BDNH 3G5ZA 4JFOB 3MLWL 2FBJH 4KGLA 1BZ7B 4KVCL 3GHBH 5C3TA 4GBXC 2BMKB 5I19L 3M07A 4GXUN 5EOTA 4HC1L 2YBRB 4TUKL 5FGBC 3RQ3A 1DN2A 4NNPH 1GC1C 4R90L 1A9BA 1FFOA 1HH9B 3VXMD 2XN9B 4FXKB 4KAQH 4MNGA 1PSKL 2XZCH 3RUGF 3KWWA 5ID1A 1L7TH 2AK1H 3N0PB 3NMEA 2MWCA 1S9XA 2ZJSH 5C0FB 2HWZH 3LRSA 5DRXB 4AG4L 4FFYL 5GIRA 3T0DA 5FOBB 4XHQA 5BRZD 1YC7A 2WWMD 1WZLA 2BSRB 1IRAY 2GT9A 2AABL 3MJ8A 5DJ8A 3U46A 5HDBE 3F58H 5I75C 5C6WH 3S7GA 1XF2B 1MJUL 4JDTL 1KN4H 4ODWA 1UWXK 3UPRB 1XZ0A 1RZKH 5KSBB 3P30L 3OHXA 2P24B 4AEEA 2X09A 4OKVB 1I9EA 1QR1A 1YDPA 4I48A 5CEZL 5D6CA 3GSWB 5F9AC 1HQ4B 1RVFL 2BHZA 3A67L 4H1LA 1P84K 2NY2D 3F12A 3X13A 1NAML 4GXUM 4NO2B 1LE9B 1JRHL 2QSCL 4P23A 5LAXA 2DQDH 3SBWC 3W9EB 3KPRA 1LP9A 3ARRA 5EU6E 5FKPA 3ULSB 2DQJH 2B4CC 5JIPA 1S7VA 3BPNB 5GGRB 5FXCH 2ADGA 1G9NL 4HS3A 3VFPA 3WDHA 1OT1A 5JQHC 4KJWD 4JO4H 2AJXL 4YHML 5EIIA 1A7RH 1VGEL 3RY6A 1G7HB 1JN6B 4JREB 4XMLH 3UTOA 5E2TL 4EXPX 5JIIA 5K9QI 5EBLA 2IPUG 4JPWH 1EFXB 4HIIA 5ENWB 5FYLD 5I6XB 2F58L 2ZG3A 2W9LA 4KVNH 1INEH 4GRWB 2J5LC 3DUHA 4X7TB 2XOTA 3O41A 5ADPL 2A6JB 2DKMA 3ULVH 3ZT6A 3QEQA 3SCMB 3VFWB 1JGDB 3EYFB 4N0FB 2C1PB 3C6LA 1OSPL 2P43B 1IAKA 4B0MM 3SKMA 1OAXL 3DX6A 1BECA 2BNRB 4KROD 3BP7A 4KK8D 4IOFC 4X0KB 3TVMA 4LSVH 3WE6B 4Y4KD 1AH1A 4MA7L 1QA9B 5EU5B 4C56E 1V8HA 3LRGA 1QO3B 1FIGH 1RFDH 1SEBA 3BMWA 4PJGB 5DTFA 3VMOA 4U1SA 4HX1A 1BWMA 2JJWA 4UT9L 3TF7C 1QFPA 3TT1L 4NQCE 4NDMB 4PJFF 5GRUH 5KVFH 1XGTB 2DDQL 1Q72H 2H2PD 3DVGB 4YHYC 4X8XA 3ZO0A 5KSVB 3CLEH 1DVFD 4HBCL 1A3LL 3OTTA 4LPUA 1M6OB 3GSQA 1EEZB 2G75A 1CE6A 2DQGL 2DWEA 3WFCH 4QOKD 5E9DB 4XVSH 3A0OA 4PJ7A 1IFHL 3LHPL 3RVVD 1U36A 1ZHKA 3CZJA 3F8UB 3RAJL 3JVGA 3TO4C 1T5WB 4PJHF 2OJZL 4C83B 3NA4A 4U1IA 1HKLH 4JGUA 3F65A 1DBJL 2IPUK 4F15B 2XKNB 1MSPA 4ZUUA 1BVKB 1GZQB 1JPGA 4PJCE 1JE6A 2HAZA 3GMOA 3MREA 3QISA 4UT7L 4JFXB 1UCBL 2H9GB 1G6VK 2R23B 3T0BA 1P7QB 1ZVHA 2EDEA 3ARQA 3L9RA 5IHBA 3WNLA 1PGRB 1NEZB 2D4DA 3NN8A 2PW1A 1FO0H 5F97E 3CXDH 5FYKL 1F6LL 1UZ6F 2LFGA 3OJVC 2ICES 4PYHA 4WJ5A 1WISA 5CAYB 3C08H 5EO0A 4U6HB 3H3PH 2YD1A 1KEGL 5KVEH 2CH8A 5IB5B 1NLDL 5E2JA 2B1HL 3QPQD 2X5PA 1IMHC 1GOGA 4D2NA 1MCJA 4ISVA 2QR0B 2AJ3B 5FM8A 2ED9A 1REIA 5JOFB 4FQXD 2DLFH 4ZYKB 3U7AA 4UIMA 3WDIA 2CLRB 4JANB 1DP0A 3KPQA 5JOPE 3ARBB 4ELMF 3RDTB 1KCRL 4KRNA 4EQ3A 1CL7I 3IJYA 4JDZB 4UAOC 3QCUH 4LNRA 3NBNA 4K55A 5IBTH 1FVCB 3PGFH 4P23C 1J12A 12E8H 4MCZB 3FFCD 5GGTL 3FQRB 5INCB 4Q2ZB 3BPLB 3BAEL 3TJEH 4U1HB 3EJYC 1ODAA 1NFDA 1RMFL 1YQ2A 3I50L 4GKNB 2FX9H 1LO0L 5CKAA 4XPBL 1KIRA 4QXUH 3IAGC 3BN9C 3QYCA 1ITBB 4V1DD 5GISH 1URLA 2B7DT 4Z7QF 5A16B 4A2MA 3SY0B 5T1DH 1VKXA 4AL8H 2HT4D 3SDYL 1DFBL 4M93C 3SDDD 2DJSA 2DYPA 4EDXA 3ULUE 5IVXE 3ARZA 3MLUL 5DUMH 4EN3A 2EDXA 2LAGB 1T7ZA 2X1XR 1I1YA 1KEMH 4GKZB 2VDKL 3ALXA 1T89A 5DHVA 2GJ6B 5B8CA 3R0MA 4KK5C 4X6CB 1RUKL 1EGJH 3TBWA 2CLVB 4UUJB 1DQTA 2DM4A 3GIZH 1ONQB 3MNWB 4R7DA 3UROR 3C6LC 1Z9LA 4MAUL 3MRQA 3ZKNC 3T0AA 3SDCD 4GAGH 1R3KB 4NHCH 3EIFA 4L3EB 2XPGB 4XPFL 3TVMC 2NXYD 4RISL 3BMVA 2K7PA 5MEPA 3ZTNH 3FQWB 3QNZB 5E00B 5DYOA 3O11A 4Y5YB 4HXBL 3UTPD 5CBAB 2HKFH 1MFBL 2Z4QB 3T4YA 4XVTH 5CD3A 4GRLD 1S7WA 3HS0A 2VLLA 2IAMA 3GMRB 1TTGA 3JWOH 4LPWA 4Y1AA 2A83B 4I18B 3VG9C 5IJVA 5GS1B 2BNUB 2DLEA 1MQKH 4P2YA 1MI5A 5CIPH 2RAMA 5FUOL 3HNTL 3KYKL 2D4FA 3NTCL 5C08A 4MAYA 1VFOA 1JI1A 4Q74A 4I3SH 3D3VA 5I30H 4KHXL 2AAVA 3JVGC 1EHLH 2B5IC 3BRDA 1I8IB 1QNZL 1C5DA 1OAQH 4L8BB 4MCYA 2X4SB 3TH2T 3DYMA 5C7XH 2F19H 3B9DA 4YHPA 5DVNA 1XF4B 3U4BL 3ARFA 4JN1L 3O6FB 4MD4B 5C07E 1HCVA 3CNKA 1LEIB 4QT5B 2FBJL 4ZPVB 2K9UA 4KTDH 4K7PX 2EO1A 5ITBH 3IU3A 2V17L 1T22A 5I8OL 4HS6B 5C0GB 3MLRH 4DZBB 2NY5L 2AQ1A 3H9ZA 5HI3D 1RV6X 4PJXA 1KPVB 5DK2A 4YO0A 4WDIA 1F11A 3DTXA 3M45A 4LPYA 3T3PE 4F7CB 3CGTA 2BZDA 2J88L 4PRID 3LSOB 5C0IB 4RRPG 2XXMB 4N8VA 3P77A 4NN5B 1FZJB 1FG2A 1L7TL 1KCKA 5I66B 3S98A 1QLRA 5HGHA 4I1NB 2ESVE 4LGRB 2VLRE 2F9BT 4S1DC 1UM5L 4PJEA 3LV3A 3SDXF 1I8LA 1G7JB 5DWUL 1N0XL 1IAII 1PG7W 4LAQH 2XQBH 1ZTXH 2B20A 3HMXH 4I9WE 3INUH 4AT6A 2XG5A 4LARH 3F58L 3OKEA 1T7XA 4JB9H 1U3JA 1EXUB 3GJFB 1AGEA 3V5DB 3HZKB 2F5AL 4ENED 4XCNB 2CMRH 2VQ1B 5FUCE 2E7LA 3PABB 2JJUA 4MGXA 3PDDA 4YWGH 2Q8BH 1OWRM 1KIPB 1YY9C 3MBED 5BJTB 4QHLB 3D39E 3VMPA 1TVHB 3OJDB 4LDEB 3OMZA 5HVHB 4MX7A 5A2LH 1NBYB 2D0GA 5CEXA 2NY0B 2KBGA 1GGBH 5FEBA 2CUHA 1R5IB 4Y4FA 4QTHB 5IF0A 4PJDA 3CVHL 5CZXC 3ULUL 5HGDA 3MRDA 1A7RL 2HT3C 2E7BA 5TPWH 3ZSSA 1H0DB 1JFQH 1ORQB 2I9TB 1U95A 4EN3C 5CS7A 4EI6A 2OZ4H 5IIEB 2BX5A 3WD5H 3DETC 5SWQA 5CJBA 5H2BA 5B8CC 5D1ZB 5D7IB 3U82B 3D2UA 1DUYB 1SBBA 3RNQB 4PP2B 3TA3B 2D03H 1UKSA 1JNJA 4LLQA 4KWUA 5EU3B 4TQEL 2EDBA 3BSZL 1MLCA 3WFDH 1BBJB 2VYRE 4KI5F 5ISZE 4OV6F 4NJ9H 4MQTB 3LKQA 4HUMB 5FDYA 3T08A 4Y2DB 3KPNA 3H0TB 2KDGA 1W8OA 3U0PA 1UH3A 2W60A 2OP4H 4CVXA 3G6JE 2W0LA 2VZ3A 1K4CB 4TRPH 3KLHD 1A9EB 2IAMC 4ETQB 4OLXL 1H5BA 5M7QA 1FIGL 1JHTB 3PJSB 1I7UB 3ZTJG 3HG1A 4YLQT 4DOHE 1GJIA 1QRNB 1IQWL 4PRHE 4CW1A 3OJ2C 5M95B 1FNGB 4QRQB 4GRMB 4MAYC 1RZIB 5L0QB 4LSSH 3RVWD 4U7SA 3H7LA 4Z0XA 5C0BB 1UM4H 1FIEA 1A6UL 3IDYC 9CGTA 2PW2B 1QR4A 3DIFA 2BFVL 1SJEA 3HI5L 3WS3A 1AC6A 1V05A 3BKCH 1ZGLP 4QRTB 1CDCA 1MRCL 3MXVH 1OLZA 5GSVA 1UQSA 1T04B 3ARFC 3MXWL 5T3XD 1RZFL 3SGKC 1JNNH 1FGVH 3ZZ1A 2YC1A 4H1LG 1QVOA 2NW3B 3AM8A 2PN5A 2QQKH 2P8PA 5EA0H 3DYPA 1CFBA 3FFDA 1WFUA 4FTVA 4F57H 4K94H 5IG7B 4G7VL 1ZVSA 4P4KA 3QHFH 2MNUA 2BVQA 4MB4A 1MVUB 5HY9A 1IEBA 1X4ZA 1FO0L 4HGMA 3HZMA 1MWAB 2R1XA 1CLYL 4JPKH 2EZ0D 5E94A 1AXIB 1WIPA 1I8LC 1D6EA 1NGWA 4YPGB 3H3PL 4KKLC 3EOTH 3Q3GB 1J0YA 2EYSB 4Y19B 4XMPH 4EVNB 3K81A 5B22A 2JCCA 4YDLB 3MGOB 3DX7A 3RRQA 4QRPA 4XH2A 4L4TE 1X5GA 3VGFA 5DJ2A 4P5TD 1N6QL 2QQLH 1V3JA 5EOCH 4OZHB 5K93A 4F7TB 4IDJL 1EAJA 3TO2B 2VAJA 1CI5A 5I1HL 3EZJB 1N7MH 4XAWL 2ADFL 5HYSG 5CKGA 5E0QA 3VRLF 3L6FB 4X5XB 5FYJD 3PGFL 4M7LL 1CU4H 4WEBL 1B0WA 4M1CD 2RFXB 4KJQC 3DV4B 5E7FA 2VZTA 4IRSD 1XGPA 4QXGH 5F21B 5F1IB 2A9NL 4S1RH 1HHGB 5FK9A 4E41A 1KLFA 4Y4FC 3F6LA 2HRLA 4U1NB 4MQSB 3VE0A 2C3VB 4QXUL 4Z0BH 4APQC 1EUTA 3BKJH 1K85A 1T0MA 1RUAL 2GFBB 4G6KL 5DFVC 4NM4H 4CU8A 3VXOB 5K9QG 2R0LH 1J05B 4NOBA 4OGXH 2IG2H 4O2FA 1CGSH 2DD8L 4JR9H 1VFMA 2YPLA 4OFYD 3N1PC 4OI8A 2Z31A 4LDOB 1TDQA 5DUML 2A73B 3DMMD 3GB7B 4P4RA 3BQUB 1KEML 4D3CH 2OL3A 4Q58C 3W9DB 1JWMA 3BH9B 2ICWI 4JAMA 1MWAH 3ULVF 2XTJE 3OR6A 1QUNA 3BX7C 3ESUF 4LAJH 4GLRH 1CZ8H 2YWYA 2PO6D 3CC5A 4K3GA 2WBKA 2DWDA 5INDA 5H35A 4OGYH 1DDHB 2C3GA 4TNWF 1DN0B 5DJDB 3G5VB 4WW2C 5GJTL 1WAAE 5J9PA 2XQYK 1WBXA 3LQZA 4L9LB 1WUNT 1E27A 3EYUL 4FG6D 1H5BC 1AGBA 5EU7E 2ZUXA 2ZOKA 3SEPA 1N59A 1D5XB 4KV5F 1D9KD 4NJAL 3S3JA 4ZUVA 3MLVH 1NGXB 4IMLA 2EDYA 3UYOD 2IMMA 5FO8B 3TBTA 5JQ6L 1IGIL 3JWOL 3W2DH 1MIEH 4ODHL 1MF2H 3LD8B 3PHOA 3TO4D 3QG7L 4X6DB 1TVBA 1NAMB 1MQKL 3G08A 1B6UA 1X7QB 4PJ9D 3HUJA 4CMMA 3QUML 2W9DL 4KMLB 3WFBH 1T20A 2PF6A 4I3SL 3W5NA 1XIWB 3MYJA 1EHLL 1PLGL 1NGQL 3KS0H 1FL5A 4Y5XA 2L7JA 4YHZH 3N1QC 3G6DL 3LPFA 3QAZB 2JE8A 3BP5B 4P4KC 2QTEA 5HPMA 1VB9A 4R2GB 1N6VA 2H26A 1YEDA 4LHUB 4XWOD 3MCG1 4S2SA 4X98A 2CK2A 1XGQB 1C12B 3LKNA 4M03A 3SJVE 5JLZB 3HNSH 2P46B 5E6YA 1CGYA 4X8JB 4M6OH 4NO3B 4BUHA 1C08B 5DHYB 1IC1A 1MREL 3ZHLA 2BNQE 2WBJA 3CSYA 1C7TA 3CPLA 4K7PH 5KAQG 3D0LB 3OWEA 5CSZB 3U7WH 1WWAX 4I13B 5I8CA 1CXHA 4LAQL 5GGVY 1PZ5B 4NCC1 4RA3A 3WIHA 2F15A 4HGWB 4LCCB 4C57C 3SQOH 4Z78A 1MNUH 1BQLH 3ARVA 4XP4L 3EJYD 2KPNA 3T2PA 3WFHB 4XNXL 3FT4A 3RWGA 3ARGA 3P0VH 3PQYD 5E8OA 3QDGD 4OF3A 3ZKXB 4YIQA 2W59A 4CKVX 4WI4A 1FHGA 5DD5L 1UWEL 1OSZB 2XRAH 4PBXA 3DRTB 4CN4A 4JRYA 3LKPB 2GKIA 4GMTL 1MJ8L 4LLDA 3ZE2F 1YNKH 43CAB 2Q8BL 1GGCL 4ODBD 4YHNA 4LEXL 4OLVH 4PGJA 1JF1B 2HFFA 5ITFA 5IQ7H 2A0LC 2X4QA 3S9DB 4IEFB 5D9SA 5EC1A 4KKAC 2Q7NA 5J13B 3MTRA 1GGBL 1FDLH 2FZ3A 4JY6A 5DJYB 3ZKMC 3NABH 1GHFL 5TPWL 2MJWA 2Z31C 3UZVB 2BY3A 3CK0H 4WHYG 4BUGA 5ETUB 2CRYA 1R3LA 4KTEH 4UDUA 5KTEL 1T83C 3RUGA 3AREA 4QHKJ 5EUOF 4AEFA 3U48A 1QTYT 3N9GL 2D9QB 1F8TH 5FM5O 4G6FB 1TETH 1K4DB 2W38A 5F3HB 4OIBA 3QEGH 3QXTA 5E6IB 5IWLA 4OJFH 3RJDA 2P5WA 3UCRA 5KANI 1QOKA 5FYKU 4NJ9L 5F7WC 1WBYA 2H32B 3G9AB 4M1GH 4LCWA 3WUWB 3L1OH 1L6ZA 3L95B 5CMAA 1W0VA 1QFWM 2H6PA 1KELL 3AS1A 1RPQA 1U2CA 3VD7A 1KENH 5J6HA 3BOVA 2HJKA 1NBZB 2BOCA 4I77L 1VDGA 3OKNA 4N8VG 2B1AH 1W72H 3V2AR 1FNHA 1X5IA 4UT6H 1AKJD 1A4JA 1LGVA 3OXSB 4NNXB 4ZXBB 2VITB 4NUGH 4X4YA 5EU6B 2Y23A 3I02B 5IQ9A 1YPZF 4FQ1L 4LLAA 4O02H 1RK0B 4LEOA 4XNUL 3JTSB 4ONFH 1NMCC 3BVNB 5DQJA 4M43L 3V8OA 5GRZA 2I60H 1CG9B 1JPTH 4TPRH 4PFEA 1Q0YL 3DXAA 3UJTL 1FNSH 4WO4A 5D5MA 2IADA 1LDPH 1IC4H 1LK2A 2E8YA 2ICEA 3HE6A 3O3UN 4WI5A 1FBIL 3NPSC 3KLAA 4X9GA 2JIXD 1KCUH 1SMAA 4PLKC 4ZPTB 4NKIL 1M7DB 4P5MA 1OAUH 1H8SA 2D7QA 5BZDB 4GG6F 5D7LB 4XX1E 3DRQA 4F57L 1A6WL 1GGUA 2VC2H 5KSAD 3JTTB 4CRPA 3HFMH 4D9QE 4IJ3B 5LGHL 1NUGA 2K3TA 3AS0A 4IIQB 4BSWB 1KACB 2JB6A 1A1NB 1KB5B 4MJ2A 3Q6FA 5ALCH 2WBJC 5C6TH 4JPKL 3BIAX 2A38A 4HWBA 1NMAH 2CK0H 4RGNE 4JM2C 3STLA 4LP5A 1MY5A 1ED3A 2YD9A 4XMPL 4C56B 3SDAD 1BEYH 5CJXA 2LV4A 3PHSA 5E5MB 2QQLL 2GITB 2QBWA 4OAWB 3BPOC 5IW3A 4PJFA 3BEWA 4OD3L 3AXLB 5ICZB 5D71L 4NPYB 4K07A 3E6FA 2XTLA 2AJVH 1YEJH 4G8GE 1XR9A 2Q87A 3KYOB 1H3GA 2H45A 4OZIE 5CSGA 3PE9A 5J6GA 3IFOA 3QQ4B 2YUVA 3P4LA 4FXLA 3JWDH 1KGCD 3TCLB 2KH2B 4AM0A 3EGSB 4CGTA 5TFSH 1KTLB 5BMFL 4QXGL 4YGAB 3GFUA 1V7NH 1AIFA 1U8JB 4O9HL 4PJHA 3VXRE 3S3PA 4ZS7H 1A6ZB 5E4IA 2IQ9H 2HFGH 5FFLA 3RL2B 2X4RB 1A7QH 4Z0BL 4PJCB 2P5ED 3BKJL 4LLWA 4I2XA 4Z7OE 4XHJC