1IGJA

26-10 fab:digoxin complex-affinity and specificity due to surface complementarity
Total Genus 46
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
46
sequence length
216
structure length
216
Chain Sequence
DVVMTQTPLSLPVSLGDQASISCRSSQSLVHSNGNTYLNWYLQKAGQSPKLLIYKVSNRFSGVPDRFSGSGSGTDFTLKISRVEAEDLGIYFCSQTTHVPPTFGGGTKLEIKRADAAPTVSIFPPSSEQLTSGGASVVCFLNNFYPKDINVKWKIDGSERQNGVLNSWTDQDSKDSTYSMSSTLTLTKDEYERHNSYTCEATHKTSTSPIVKSFNR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title 26-10 Fab-digoxin complex: affinity and specificity due to surface complementarity.
pubmed doi rcsb
source organism Mus musculus
molecule tags Immunoglobulin
molecule keywords IGG2A-KAPPA 26-10 FAB (LIGHT CHAIN)
total genus 46
structure length 216
sequence length 216
chains with identical sequence C
ec nomenclature
pdb deposition date 1993-02-19
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1igjA02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1igjA01
12E8L 5EUOA 5IT2H 3K4AA 3AS2A 4ZO9A 2ZUXA 3IXTB 4H88H 4PGDA 4OGAD 5E2TL 3KYAA 3PQYD 3CH8A 4PUBH 3GSVA 3L95A 4LCYB 2BNQE 3ARQA 5F3HB 2AXHA 2NW3A 3SOBH 3HE7B 4L8SB 4LLQA 4CAGA 2JKXA 1CGXA 2CKNA 1T0PB 4NFCA 4YXLH 1SMAA 2XZCL 2IBZX 2OL3B 2R2HA 4QRQB 1LP9F 1A1OB 1P7QA 2K3TA 4P5MB 2EXYD 1OGAD 4X98B 1AR2A 1T21A 4JY4B 4O2EB 2O5ZH 3LRSA 5J4MA 1HKFA 5AD0B 2XKUA 4JG0L 1KCVL 1C08B 4Y4FA 3HNSL 4PGJA 4MNGA 4CN6A 1XR8B 3D2UB 4H1LG 2IG2H 4HIJA 4QHKI 1NCDH 4LNVA 4F7MB 2ARJB 1JGVL 1YY8B 3EIFA 3UC0H 4D9RE 3O3EB 2XT1B 4ZOBA 5ICXB 3IF1B 2Z4QB 1OF2B 1D6EB 1R24B 2W60A 4PTUA 4D0BA 5HHMD 1FZOB 2Y07L 1CLYH 3OB8A 3WIFB 1N5YL 4J3OC 4PRIA 1CGUA 4X7SL 4OLVL 5IB5B 1KCUL 3LQAL 3VA6A 2MWCA 3FMGH 5IOPA 3B9KD 5F9JB 3HI6L 2BVPB 5DMYA 4EI5A 3O9WA 4I0PA 5CKAA 3PP4H 2D2OA 3NFSH 5KVMC 3JV4B 3GJFA 1I8MA 3UTTB 5IJKA 1CXIA 2IAMA 4BQCA 1WBXA 1GZQA 3BZFA 1HKLH 3V7AE 4WTXA 1K4CA 3QFJD 1FFNA 1WQVT 3MRLB 3TZVD 4F9PC 5CBEA 4XP9L 4K7PY 2VLRA 4JLRA 1NGXA 2VLJB 1PJ9A 2QSVA 2YPLD 4KKBC 5F89B 2ORBH 3BMVA 1JPGB 4PRAA 4UDUB 5TH2B 4DW2L 2EH8L 2I26N 1H8OA 4UB0L 5GS1B 1EJ6A 1H5BB 3VDAA 5JLZB 1RUKH 4XPTH 5HGBB 1NJ9B 1B0RB 3WHE0 1FORL 2OR7A 3G9VA 1WIOA 5HYJD 4XNZB 4XCEB 4Y16B 2LV4A 4H1LB 4GRLB 4YFDB 4YE4H 1JWSB 1FZJB 1CL7H 3HUJB 1JUFA 3K2UL 4JRXA 1RURH 4P5KA 1IBGL 4JHZA 1YEKL 3C8HA 3KJ6L 1XGUB 3VXRD 1SJHA 5C0GA 1JUFB 1D5ZB 2UVFA 5I1GH 3V6FB 5BRZB 1MFNA 2ADJA 4HDIA 1YN6B 2G60L 2VDPL 3FFDA 4LAQL 1EGJA 2LTQB 4I5BA 1KCSL 1CK0L 1CFVH 5IEHA 1ZOXA 5FO7B 2MQCA 4D8PA 5IFHL 2XWJA 2ARJQ 5E00A 3UTQA 1JPSL 3VXPA 2EC8A 5D7SL 4NHUA 4PRAB 4S11A 1T4KA 4Z8FL 1GZPA 2DIBA 1LO2H 3IJYA 3CDYA 1UWEH 5HHNB 4FZEL 4JAMB 2G75B 5KANG 5ISZB 3LAFA 5T3ZE 4P5TD 1MHHA 4GH7B 3RJQB 4Y4HB 4LLWB 4L1DA 2YC1A 3CSGA 3IDYC 4N0FA 4TQEH 4EVNA 4LHUA 2F54D 1RQ5A 2B5IB 5GGRB 2X9XA 5T3ZL 3WKNA 5DTFB 4EUPB 4GS7C 1QLEL 3H9SE 4I3RL 3F12B 4G8EB 4G8GE 4UNUA 3OAZK 5L2JB 3MBEC 1F4WL 1N5AA 2P44B 2BVPA 2X1XR 1N26A 4IMKC 5CMAB 3SPVB 4PB0L 3HE6D 5KVDL 3QUXB 5IF0B 5KVGL 3GBML 5FOJA 3U9PL 1R5WB 2ADIB 2W1NA 3W81A 2VDOH 3MODL 1K8DA 3BUYB 1HHKB 3U4BL 3G6AA 1T20B 3WFCL 4FFYL 3UX9B 3VXSD 4Z5RB 3KPRE 5MEND 1N3NA 4HD9A 4QRPB 4F7EB 4RRPG 1EMTL 4DKAA 2B7DT 2IAMC 5I75C 1RY7B 2FYYA 2SEBB 4FFWC 7FABH 4WFED 5ADOH 5FO9B 4DGVH 4QLRA 4YEFA 2QKIB 4YIQB 1NMCB 5DSCA 4AM0A 2OL3L 3VFMA 1KIUA 4DKEH 4P4RB 3BW9B 4IHOB 4U1MB 3FQTB 3BH9B 3ILPA 4OD2A 5J3HC 3ARPA 4P4RA 3IDIB 1ZLSL 3AUVA 2GJJA 5JPMA 3ILPB 4ZPTA 3ZDZE 5C7XH 4WJ5B 4KI5C 4QOKB 1NC2A 3HI1A 2RB8A 1E4XH 1HYSD 2HH0L 3T2NH 4JFFB 3O3UN 1AP2B 3QXDA 2VISA 1VGEH 1IVLA 1EHLH 4LF3A 1KPRA 5C0AE 3C5JA 1S8DA 3FCTA 4ZFGL 4OT1L 1WISA 1X6NA 2K1MA 2PTUA 4JFXB 4R7DB 4YHMH 1Q72L 5GGSB 5L2KB 3VXQA 5JHDB 2PW2B 2RQ8A 3WFZA 3MROA 1F3JA 5E2JA 5BVPH 3GIZH 4RMSA 4AMKL 3OKYA 1AE6H 4X4XA 1YMHB 2CRYA 5E2WL 2ZUWA 5DWUH 3ARBA 4Z7UF 4YDIH 4GRWB 2EH8H 5TPWL 2V6HA 4ZPVB 3VGDA 4D2NA 4UAOC 3B9KC 4YBLC 2HFGL 3AXLA 1CXEA 1QLEH 1U3HA 4PREA 5C09A 3WEXB 4HUUB 4X6DA 2XG4A 4B7LA 4XB7A 1DLHB 3DXAB 3RAJL 1EK3A 5F9AC 5DQJB 3UTSD 43CAB 3D0LB 1WTLA 3I6GB 1QSVA 3O9WC 3MJ9H 2VMFA 3JXAA 3BOVA 4F7PB 2QADB 2DYPD 1EFXA 4UMGA 4LQ1A 4EJ1C 2ADIA 3IKCB 5C2UB 1AHWB 2YD2A 2NXZD 4JRYA 5DDHA 4QXUH 3RHWF 1E4JA 3UTSE 4GG6B 1YC7A 3EZ8A 3W39A 2VXTH 5I1KH 2NY0D 1MHEB 2RBLA 3MRJB 2AABH 4WI3A 3CD4A 4B7IA 3VFUB 5E6IB 1RJYB 4MS8D 1GOFA 3V95A 1EEUA 1Q0XL 1FVDA 2X4OA 4ERSH 2QSTA 3LKOA 3ZTJG 4WGWB 2GK0B 4N1CA 4ZTOH 3DO3A 1C5CH 4L4TA 4F9LC 4Q9QH 3ES6A 5D6DA 4ZFOA 3NPSB 2OK0H 2AXFB 2X2YA 4G6FB 4WY7H 5C0CA 1AO7D 3VXOA 1PSKL 3BHBA 4IRSC 4KK9D 4Q58C 1D3CA 4KK6C 2BOBB 2FRGP 3U2SB 2IH1A 1PG7H 25C8L 3SDDB 3RGVC 1T5WA 4J3WA 5EZOH 4AIXA 1CD8A 1LGVA 5I1AB 3LHPL 4CADB 3WLBA 3D25B 1AR1C 5JUEL 4PP2A 2Q8AL 2OR8A 3VGFA 3PWPA 4M02A 5B4MC 4Y4KA 7CGTA 3TBTB 4M3KB 4I8DA 3FB6B 2VDRL 5A2LH 4N0RA 5SWQB 4HGMA 3QEQD 1LEKA 1IGIL 3NIDE 4QXTB 1I8LA 3SBWC 4JQIL 3VXRA 1V3JA 2Y23A 3D69B 3QDGA 1MIEL 4R7NB 4C56A 5L0QB 1HIML 1C08A 4HT1H 4X7SH 3OAYH 1OTUC 1DE4A 1NFIB 3BYYA 2X4UB 4NFDA 5IV2A 3PL6D 1E4KA 1BEYH 5FK9B 5IROA 4HK0A 3H9SD 1ITCA 1CICD 1QLRA 3RHWK 4Z76A 3RIFK 4Y1AD 5AWNH 4Z7UA 3V5KA 1I9EA 2R0KH 4J3TA 5H37H 4PJDF 1UM4H 2DQDH 3G6JB 4KHTL 3FT2A 3OJ2C 4QHKJ 3OJDB 3O6FA 2YXFA 4JRYB 3HE7C 4L8SC 4U1NA 3OZ9L 5BJTA 3ARRA 1J86A 3MV9B 5GHWH 1JVKA 3BPNB 3U30C 3SGDI 5D6CA 4NWTH 4LPUA 1YMHA 4OZIF 4J4PA 4K94C 4X98A 1MHPH 1R5VB 4PJ9B 2PYEE 5IEKA 4POZD 1BD2A 1T1WB 3WNKA 3ARDB 3VXUB 4LFHG 3SDCC 2VE6B 2AJYL 3RZCD 1XGYL 3RL2B 2AK4B 1PG7X 4GMSH 3QFJB 1XF5A 1XR8A 1KXVC 4FFVC 5E6IC 3LDBB 4OTXL 3MUGA 1T0MB 4N9GB 3R8BB 4PRID 3DGGB 3QJHB 4PJAA 3GSNH 1DEEA 1LDPL 4YK4B 3X13B 3QNXB 4OT1H 2X44D 3WE6B 4M4PA 4PRHE 3PWLB 3KPSD 4G8IA 1N4XH 4HUVA 3QEHA 5EA0H 3SE4A 4XVJL 3WJLA 1M05A 4NIKB 4OV5B 3IXAB 3BP6A 3RDTC 2GW5A 2B4CL 3BXNB 4ALAL 1UACL 2PXYA 5I76A 1PLGL 2VNCA 4S1RL 5JW4R 1F4YL 5D7JD 1U8KA 4XB8A 2EDKA 4R2GD 3L3HB 4MXVF 3SCMC 1HHJB 5DFWH 4JPIA 1VA9A 4JY6A 1P7QD 5J8OA 1IEBB 1ZLWK 4DEPB 2EDNA 3BAEL 1ETZA 3B43A 2DDQH 4HLJA 3WFEH 2GTWB 1BVZA 3QNYA 5ADOL 3HC0B 4P9MH 4JFYA 5IB3B 2L7JA 1HSBB 2XY1A 1LK2B 1XGRB 2X4NB 4HWBH 4JG1H 4JO2L 8FABA 1LD9B 5CZVH 1RHFA 2EDFA 3WUWG 5IVXE 1ES0A 5E1HB 3G5ZB 1VADA 3LB6C 4NZRL 1FAIL 4M9OA 5LAXA 3P4NA 1DVFD 3W0WD 3PIQA 4Q0XH 4UBDD 4MWFA 3U0PB 3VE0A 1WAAF 3G6DH 5EZOL 4X99A 5L88L 1P6AB 5MEQB 1S9WA 2QTEA 1S3KH 4F57L 5C3TA 1WZLA 3ULVF 4I0PC 4QOKD 1BOGA 4XC3H 4RGND 2A6JB 4TQEL 1EZVY 5B22A 1WJ3A 3DIFA 4IM8A 1S7TB 1TZGL 3B5GA 1JNJA 1L7IL 2F53A 1I8KA 4LGPB 2BY2A 3WFDL 3C6LD 2XRAH 3ULVD 3GKZA 2DM3A 5DJCA 3VDBA 4EN3C 5D1XB 5F3BB 2VITA 2XTJD 3F7PC 5I19H 3WYRA 4XC1H 4NWUL 4Y5XC 4NKOA 1DVFB 3B5HA 3W0WB 1TTGA 5JW3L 2XWTA 3IU4L 2WUBL 4D9LL 4I4WB 5DJAB 5C07A 4XVJH 2NY1C 5DHYB 4AIOA 3RJDA 3WV0A 2VDNL 1YEDA 3QI9B 1IL1A 4U1NB 5IMMB 4IRJA 3HRPA 1MWAL 3L3JA 3FFCD 1A4JA 4O51B 4RA0C 4KV5E 4UU9A 2XTJE 2X4TB 4JFEB 2XA8L 5EU6D 4JM2D 1L6ZA 5E8OB 1TMCB 3SO3C 2HFTA 1AD0A 3VFRB 1S5HA 5DLML 3EJZD 5EOCH 3P0VL 1YN7B 1CYGA 4MQSB 1O5DT 3BPCB 4FQ2H 1IAIM 4HPYH 2P7TB 3KPNA 1JK8B 4OSUL 3DETD 3ULUC 1YYMH 1M7DA 1RZGA 1F90L 4NQCD 4K8RL 5CZVL 5AZ2H 1P4BH 4FZ8L 3RUGF 2J8OA 5DWUL 2YUZA 4XP9H 4P46A 1U6AH 2EDTA 1IGCL 2X9WA 3KJ4C 4M6OH 5K9JH 3SDCA 5GSRB 4JPKH 5JR1H 3HZVA 1AGDA 4XVTL 2F74A 5C70A 2V17L 4I4WA 5I1AA 1LO3H 5EWIH 2V2XB 3EYOB 3SKMA 4Y4HC 1YEDB 4XMLL 3MLZH 2J12B 1KV3A 1EGJH 3LKSB 2OTWB 2ATPA 1C12A 2H26A 4X5XA 1S9WB 5T1MB 3V4UL 2HT3C 1E6JH 2R0WL 4PG2A 2OL3A 1NCNA 3P11H 4WHDA 3SGEH 3QHTC 4KWUA 1Q1JL 1U2HA 5IK3A 5GRUH 5CS7A 2EDQA 1JNHA 4N8VA 4G9DA 1V8HA 2H3NA 2VDRH 3MLYL 3JWDC 1MVUB 4NHCL 1RVFL 2AEQH 2EE3A 2DAVA 3THMH 2IADA 1GVIA 1KJ3H 2IFFL 1JHKL 3HUJF 5TDPB 1RULH 1SQ2N 5I74B 2WM0A 5E4EB 4TUJB 3IFLH 1F6LL 5D7IE 1F2QA 3I02A 1KGCD 3LS5L 1B6DA 3L1OL 4WO4B 3S37L 1IGFH 3CFCH 1EMTH 1KJVA 3QUZD 3FJTA 1Q9KB 2JCCB 4LP4A 2DYPA 4S0TD 4NM4L 1QSEE 1G7MA 1TETL 1LVEA 1YNKL 2P8PB 1IGFL 3CFCL 5GJTH 1UCBL 2YRLA 1ED3A 1OGAE 5LGKA 1Z3GL 3MCKB 3QUMB 4OZFA 2JELH 3QZWA 3QYCA 4XH2B 1BZ7A 1JMXA 2D4FA 3IKKA 3B9VA 5J06A 4GKNA 1AGBA 2V5MA 3VFTA 1J0HA 1AGEA 1D9KC 3RVTC 2DN7A 1AC6A 5IT2L 3PV6A 5F96L 4YIQA 5CEZH 2IPKA 3V4PH 4X0KA 2ZUQC 1OAZL 3K1KC 1A7RL 4LAJH 5TE6L 4UOJA 4A2LA 5KTEL 4Z8FH 1F4AA 2Y7QA 5FXCH 5INDA 1IMHC 1QQDB 5SV4A 3FO0H 5FUCE 3IAQA 1PDKA 1T3FB 3O2VL 1Z9LA 1A3LH 2OL3H 3HG1B 3TBWB 4GUPB 5ESQB 2CDGA 1W0VA 4OF6A 3M45A 5CEYA 5I15L 5EFIB 1KEGH 4U6HB 4X7EC 3DI3B 1LDSA 2NTSP 5JR1L 3UBXB 3QQ9D 1DBML 3UTPE 2BVUA 1FRGL 1MFCH 4XCNB 1QFWM 1YEJH 1BIHA 5GGTL 2QADC 4PGBA 4HJ0D 3NA9H 5I8CB 3VWJC 4JM2C 5MEOA 1GAFH 4MX7B 1A4KA 1V05A 3RPIA 5JPNB 3GMMB 1U3HC 5F7LB 4HKJA 1B6UA 5I1HH 3WS6A 1EXUA 1V5JA 2DTSA 1LP9A 1T03H 5EB9A 3Q3GB 4H8WL 1OM3L 2Q86B 4G6AD 2ICWJ 2H1PH 3NCBB 2VE6A 4MQTB 1C12B 2Q8BH 1HOCA 2V7NA 1LQSR 2QQLL 1VHPA 3IFPB 2AEIT 3QULB 1MFEL 4S1SH 4ELME 5K33A 4UUJB 5FO8B 3NCJH 4XAKE 3G6AB 1W8NA 1QNZL 4ZUWA 1OVZA 1MOEA 2MPAL 5E4EC 5JO5A 4M7JH 3U30B 4M61B 1I8IB 5ICYA 4FMFA 1NBZB 1NCTA 3MRNB 4KK5C 5BXFA 1MSPA 2BOBA 2H8PA 3TJHD 2YPLE 1MCRA 2DRUA 1DBKL 3GK8H 2XWJB 3UZEA 3O6FB 3CSPA 4JO3L 4NN7B 4TSBH 4OKVB 3QUZC 1IAOA 4L4TE 3BSZH 2ZCKL 3G6JE 3O8XB 4RAUA 3O4LB 2FD6L 4M4RA 4OLZH 1MHHB 4MMXC 2G2RA 3MGOA 3L3OB 1IC5L 2VN4A 3MRBA 1PGRB 4KZEL 2G2RB 1FBIL 2BCKB 1FZJA 1N6VA 5DVLA 1UVQA 1GGIH 2A6KB 5TF1L 4JGMA 4MA7H 1T7XA 3G6DL 1VKXA 4XPTL 1WC7A 5ERWB 2C1PA 5ENWA 5EUKA 4U1IB 3UPAA 4UILH 3V6FA 3N85H 2P5WB 1Q94A 3QUYB 1B9ZA 1T6VN 2YN5A 2HT3D 1P6FA 1UH2A 1RVFH 2AEQL 2V2TB 1T7VA 4RZCB 2BVTA 3B5TA 1INDH 1F42A 4MA1C 3C09C 3VI3F 5KSVA 1CN4A 4P3DB 2J4WL 4LHJB 4Y4HD 2IH1B 1RJYA 2Y06L 1TCRA 4JZJB 4QCIB 3W9EA 2J8UF 1IEAA 3KDMB 1BLNA 3WEXA 3CPLB 4NNXA 3PHOB 5J57B 3C60A 5C0FA 1MY7A 5F96H 3TT1L 2XZQH 1WF5A 3IDJA 4J3SA 4GAJH 1GC1L 4LIQE 1PX3A 3VMOA 4L4VE 3H9ZA 4N9OB 4YUEH 4A6YB 4XMLH 5F93C 2X4NA 5BS0D 2FEDC 1HOCB 4WW2F 5FM4A 3C6LA 4XVTH 3CSYA 5FO8A 5BCAA 5DQJA 2HJLB 3QG6A 1YEKH 5BV7L 1QSED 3LZFL 2DD8L 1X5FA 1TPXC 4LF3B 4ZOAA 2A38A 2BJMH 1T1ZB 1SY6H 2HWZH 4TULL 5DJAA 5T3XL 4DK3A 1E28B 1A14L 1WIUA 4C57C 3REWA 5GS0C 2XXCB 3PP3K 2CR3A 5JZ7D 5D1QA 3QRFM 1T04B 2AGJL 2GCYA 3LQZA 4X4XB 1YDPB 4FXGB 5DD6A 3O41B 3GI8L 4YXKL 2DLFH 3BP4A 3D85D 3PJSB 4HXAH 2BJML 4HUMB 3KXFE 2PUQT 3K4DA 1JPTL 4HGKC 4JCLA 4LSUL 4JQXA 5E56A 2ED7A 4WY7L 2DS4A 1HQ4A 3OF6D 3QRGL 4OZHA 1FGNL 3REVA 1KJ2L 4X6CE 2EH7H 2W9DH 3GHEH 4MB5A 1ZSDB 5BMFL 1IQWL 2HRLA 5E6ZA 4CMMB 2ZSVA 3KXFA 3KYNB 3LD8B 4PJXF 4KRPB 1N8ZA 3I75A 3KNBB 4GKNB 1P69B 5DQ9A 2O5XL 4UT6L 1V7MH 3BWAA 4OFYD 5J7CC 2VUOA 2D7QA 4TUKH 3UPCA 3X13A 2J8HA 3C5JB 3VE0B 3K80A 4I3SL 2COQA 1B0GB 1JHTA 2IPKB 4GBXD 5T33H 4LLQB 4OIIL 4L8DB 1XH3A 2Z8VC 4WVRA 4K55A 4LSUH 3T3PF 3V0VA 2A6IA 1I3VA 3MOBL 1L6XA 4FXKA 1JPST 1UM5H 4JFEE 3BXNA 4GXVL 1IC4L 3LKNB 4UIMB 4DFHA 5HYQA 3WNNA 2P8LA 1MUJB 1TFHA 4YHNA 1EPFA 5DD5L 3HNSH 3LHPH 4O5LH 5HY9A 2X70A 3IFLL 1UC6A 3O2WH 3MRRB 2GFBA 3ZKNC 2O5ZL 5HI5C 4XMPL 2KQMA 3MNVB 1DN0A 3BWUC 1NGWA 4ETYA 4KK5D 2WV3A 4OAWA 4GRMB 4Y5YC 3B9AA 5BS0A 3MOBH 4HCRH 1BD2D 1A6UH 2OJZH 1EBAA 5IIEA 3GGWB 5EU3A 3SKJH 4P3DA 5F7FA 1GOGA 5IEKB 4YC2B 3WLBB 1R6VA 4JANB 4NM8L 4NWUH 1JYXA 1FNFA 5D7IF 3MV9A 1G6RL 3DX7B 1ONQB 4X7TB 3V52L 2D7MA 6CGTA 5JZ7C 3NCYP 5BQ7B 5C7XL 4DK6A 1CLYL 4E42A 4Z95H 4I2XA 3C08H 2HFFA 3PL6A 3HPLB 5DURD 1O0VA 1JZ8A 4L5FH 3TCXA 1ZLSH 4GG8A 4XGZB 3NCMA 5GGUB 2P48B 1EO8H 4UDUA 3P4OB 3BJLA 3ZE2F 4ZUVA 3NOIA 3ULUE 1MI5D 4KZDL 1JF1A 4PS4L 5KOVC 1WWCA 3VD9A 3ARXA 4XXCA 5HI4D 3EO9H 1L9MA 1JNNH 3G6JA 1NGQL 3SGDH 4HFWB 2EDJA 3AGVA 5SWSE 4JHAH 4GRLA 4GQ9H 5FDWA 1EA9C 1U8IB 3AU1A 3PDOB 5F88A 4HFWA 4XBEL 3LPGA 4F3FB 1BX2B 5T1MA 3MLXL 2PW1B 5DMIL 1KB5H 4WHYG 1MHPL 4EI5D 1MFCL 4H26A 4PGEB 1OP3K 4XI5C 3BEWA 2EKSB 5EPMB 4GT7A 4JLRB 3V9FA 4KQ3H 5DI8A 4I2XB 3RVUD 2JJTA 1YEIL 2DF3A 3WNMA 3BZ4B 1A3QA 4D0DA 5IHLB 4JO3H 4TSBL 3TO2A 4Q74A 1G7IA 3UPRB 1HH9A 1UEMA 3MRCB 2ZOLB 3BESR 5DGRA 4KRMB 1UQSA 3NA4A 1BBJB 1FG2B 5TDNB 2Q3ZA 3HFML 4JDVA 3D0VB 2E27H 5D2LB 2MPAH 4R26H 2OSLB 3UTZB 1MFBH 5I0ZA 2NY3D 4P59H 1UXSA 3HE6B 4WW1A 1IAII 4OLUH 3NCJL 5FUZH 2AJXL 3BRGC 1MCDA 1QRNE 1X5LA 1M71A 4XHJC 4I18C 3M07A 3QCTH 3CUPA 3STBA 5EUOE 2Z0BA 4MDIB 1W0YT 4UILL 3TYGL 1MCLA 2PETA 4U1JB 4K9EH 4NJAH 1A6UL 2XG5A 3NABL 4NRYA 4QRTA 2DIJA 3TA3D 3VH8B 4U1GC 5DRWB 1WAAE 2FJHA 3TH3T 3TN0D 1RZKH 3MRKA 4LMQE 1PG7L 1HHIA 3MRMA 3O8XD 4M93C 4N8CH 4Q9RL 4FQ1H 4RFEB 1ACYL 1BECA 4IRZH 2VQTA 3P4LA 5E2VL 1OLLA 3S35X 3QQ3A 5D1QD 4WNQA 4HKBB 3JTTA 5CINL 2VLKB 3KWWA 2XKNA 3QZWG 2DWEB 3LEYL 5M94B 1YNLH 2C9AA 1K4DB 1FE8L 4RAVB 5DD1H 5A16A 2DJ4A 4D3CL 2PTTA 3BN9C 1N64L 4U1LB 4PJHB 4WFHD 3RWHA 1KCRH 3ZYZA 1A9BA 5DQDL 1Q0YL 3V4PL 3KPLA 3MTRA 3RWIA 4I48B 4RMWA 3NACL 4I9WD 5DRXB 3NPZB 3MA9H 2F19H 3JV6A 4NOBA 2F8XC 2EXWD 5IFHH 1WEJH 5F3HA 1UXWA 4ENED 5D7IA 5F9WC 3ZZ1A 1AGBB 4PJ8A 3TN0A 4ZD3H 3MR9A 2BNRE 2L0DA 5GGTA 5DR5H 3UXFA 3D1MC 5CEXB 4YGVB 1P4IH 5HHOE 3SGJA 3O3BA 3VW3H 2DQFA 5DMJB 3MRHB 5I71B 2UWEB 2FSEB 3KPOB 3D18A 5DZNA 3GSNB 3MQIA 2BRRL 1HI6B 4LASL 2E7CA 2G5BA 1HILB 4WJ5A 3GSQB 5EBLA 3TWCL 4R4BA 2AK4E 5I8EA 4JHAL 2BSTB 5ID1B 2YOCA 4HPYL 5E5UB 3X3GL 2I27N 3GSOA 2GITB 2DICA 1TZIB 1E27B 4BQ8A 3U7WL 5I1DA 1XF4B 4LHUG 2X4UA 5A2FA 2DQHH 1D9KD 3QWQB 2HRPL 1OWRM 3QUYC 1GHFH 4LPVA 5J3HD 1SJVA 5DEFB 1JNHB 5DJDA 5TFSL 4DKFH 1P1ZB 5EOCJ 1ZT1B 1BLNB 4WO4A 3AREB 3D39A 4ETQB 1OAYL 4LRIC 4BSVA 1Z0NA 5DTFA 1R3HB 4G6MH 4NC2B 3KR3H 1I7UB 3K8MA 5EZLA 3SDDC 3DO7B 4MB4A 4GKSA 2VWEE 1XGUA 1NGZA 3CCHA 5J56B 4KVNL 1T1WA 2C3GA 3MLZL 3AM8C 4OLVH 3KS0J 5LJYH 5MERA 3GSXB 4YDKH 3OMZA 2VLRB 2Y06H 1KIRB 1N5AB 4GAGL 1Q94B 1PQZB 3ARFD 1XGTB 2X1QA 3QNZB 4LSTH 3VFPB 1WBXB 3OWEA 4S1DD 3F7VB 1UCBH 3UYRH 1KT2A 3KVQA 3UCRA 1LO0H 1H5BA 1MI5A 4PJFB 4RQQA 5FGCE 2BC4A 2CRIA 3OB0K 2H9GB 1CFBA 3MV9E 2OTPA 2P49B 3O2WL 1SBBA 1KCVH 1BVLB 2I5YL 4J3UA 1CDCA 2IQ9L 5L88H 4NP4H 3JZ7A 4XBPB 4I77H 1OT2A 2VKWA 5JMRA 4R96B 3BPLC 2OZ4L 2DMCA 5CBAA 5D96B 4PJ7A 1S9XB 5CZXC 2FX7H 5IB2A 2BVOA 1NANH 2FBOJ 4FTVE 4Y5YA 2ADFH 1IZKA 3ZDXE 4LLUA 3W2DH 5DK3A 4JZNA 3O9WB 2DQGL 4JKKA 2AXFA 5C0RH 1A22B 1KN2H 1SBSH 4G5ZH 4KK8D 3OX8B 1QFUH 3FRUB 1FH5H 2VLRD 2DKMA 1SJHB 1DN2A 1EFXB 1SVCP 3Q6GL 2GKIA 5DVNA 3MLRL 3S36L 2GSIB 5TQ0H 2ENYA 1IRAY 4RFNC 2Z9TA 5L8LB 3OXRA 1N6QH 4E9LA 5ID0B 1MRCL 1MHEA 1FSKB 2OQJA 3U4EB 5CFHA 2R2BB 1DCLA 4TSCL 2RHEA 2E3VA 1S7UB 3Q3GA 4FA8A 4EXPX 2D7TH 4OM1H 4X5WA 1N64H 3DRQB 4HUWB 1MH5B 4WU7A 2VTFA 3P30H 2VIRB 4ODSL 1S7UA 5EU5A 2QHRL 1NFKA 1QBMH 5IFJB 5CJOH 1I9RL 4MXQD 2AJUH 1ZGLP 1YYML 2AK1H 5DURB 1MJ7H 4NNYA 5C08A 3HKFA 4PJBE 3RQ3A 2EYRA 2D7PA 2ZG2A 3C5SA 2Z92A 3RDTB 5C6TL 4AJ0A 3FRPG 1I75A 1EERB 2BX5A 2Z35B 35C8L 4PJ5E 1S7WB 3U2SA 4JN2B 4KY1L 5FCUH 2ORBL 5JOPD 3OR7A 3UJIL 4AEHH 4JFPA 1K3ZA 3IDNB 1ZWIA 3VD4A 2I9LB 3U1SL 2V5YA 4OM0L 4U1MA 1FGVH 1AJ7H 3MACL 2YD6A 1A6VH 3CFDB 1ZA6B 1QFWI 4C58B 4U0RB 4HUUA 2YPVH 4X6DB 2DWEA 5F7MC 3PQYA 3LKOB 2BNRD 4RNRA 3FQNA 5DD0L 3RA7L 2BSSA 2PO6A 3MV8D 4D94A 1F3DJ 1A64A 3HNVH 2B0SH 4JFFA 1T1XA 2A0LD 3HRZA 2XN9D 1QFPA 4M3JA 3QO0B 5HGAB 1FGVL 1JMZA 1NKOA 3QUMA 4OZFB 4JFZL 5JPMB 3W5MA 3CLEH 1XGPA 5I17A 4K71B 4OGYH 4GRLD 2VXUH 1K8DB 3JVGC 3DV6A 3GSRB 2VQ1A 5J6GA 2R0ZH 1ZSDA 1I3GL 3QAZB 2EKJA 1KPRB 4X9IA 3LY6A 4RGNB 5HPMB 2FX9H 5BJTB 1EEZB 3HCVA 3QWRD 1BVKA 1EDQA 5EZIL 1H5BC 4R6UA 3DUSB 4C83B 4G8GB 5C09B 4DGYH 4HV8A 2Z93B 3B8SA 2Y1VA 3EGSB 5JA9A 5IGXL 4RGMB 3P73B 4LLYA 4ZFZA 1HH6B 5D1XD 1K2DA 3LS5H 3UYRL 4LSQL 4NPYA 4PR5A 3LEXB 1MNUL 3QIBB 4NC0B 5FYJL 3KG5A 4QRTB 4XTRD 2ZJSL 3PGFH 2AJSH 1U8QB 1UM4L 2BNUB 1ZLVK 2GJ6D 3WKML 1CICA 3SE3C 2NX5E 3MV7A 1FVEA 2NY2C 3TFKC 4D8PB 4JM2A 2BRQA 2NNAA 4GAYB 4DKDC 8CGTA 5F6HJ 3O0RH 3S5LB 3C5ZA 1NFDE 3BFOA 4LIQH 5MI0C 5JW4N 4X7DC 3TYFB 1QNZH 5IB4B 2AKRB 3HAEH 3F62A 2QQQA 5ISZA 2LE9A 2X1OA 3VXNA 5DRNA 4CU6A 1MCPL 4FQCL 1HIMH 1YECH 1U8NA 3E6FB 5DJ0A 3V5DA 3BKYH 4KUCD 1QSFD 2QL1A 4Z7WF 1KN4H 4DVRL 3WNPA 1GGTA 4GW5B 5I18L 4PY8J 1RURL 5LGJA 2P8PA 3NZHL 3EYUL 3MV01 1TLKA 3KPMB 1VEOA 2HA1A 3BP7B 3WIHL 2OYPA 4Y5VB 3RUGB 4NQXB 5HDBF 1FHGA 5HVGB 5EBWB 1J11A 5F89A 3I50H 5C92A 1IGMH 1KTDB 4NO2B 1G7JA 4U1HA 1RIVH 4NZTH 3S88H 2YPKB 3T77A 4OGZA 5GGUA 3EOTL 4OSUH 1HK6A 1OAKL 2W07A 5GSRA 4IOIB 4WWKD 5JLZA 4XAWL 4I13B 4ODWA 4E5XA 4B5EA 3CVHL 3QG7L 3DOSA 5EZIH 2ZUQB 4AY0A 1JGDB 1KGCE 1DL7H 1K5NB 4YDVA 4ODWB 3LKSA 1J0YA 3PWUB 4PJGA 1EX0A 4H26B 1CXLA 1LE9B 1OARL 4NZJA 5ITBL 3DIFB 1FPTL 1G1YA 1S5IH 3B2UC 1RJLB 4PGZA 4PFEA 2QBWA 5JXAL 1KCUH 3LQAH 2DQTH 1FN4B 1Z5LA 3HC3H 2D4DA 5JHLH 3OAUL 4ODUB 3GRWL 3DXAA 1DLHA 1EFQA 4ZS6C 3GMOB 1ROWA 3BO8A 5C09E 4X80L 2DQTL 3SE8H 4GRMA 3ETBF 3H9HA 4Q7DA 1V7ML 3K46A 4LSVL 3TBSB 1U8QA 4FQXD 4KK9C 5I73C 4Y2DA 3SDCB 4M1DL 4KAQH 1S9YA 5GGQH 4ODHL 3OKMB 1A1MA 4UQ2A 1TQCC 2UZXB 5ID0A 4BUGA 2PXYD 1EZVX 2EE9A 1LILA 3AROA 1MAKA 1CZ8L 4EZMA 1RUMH 2YBRB 3QPXH 3KPRB 1VFAA 4Y19B 4AT6A 2I60H 1MAML 2OI9C 5CKGA 5C0AA 2NW2A 4WI8A 1DSFL 2DLFL 4MJ6A 3AMKA 4Z7VA 4N90E 4P2OA 5CHNB 3STLB 2ZSWA 3MCG1 1SEBB 3ZO0A 2EDEA 4NPYB 4PR5B 1Z6JT 3DX7A 1XGTA 3QNZA 2KZWA 3GKWL 3IDGB 4XRCB 3MJ6A 4HK3N 3VWJD 4XCYA 4HUVB 1OSZA 4QTIH 5IQ9A 3TZVB 4DVRH 4PV8A 1EO7A 3RTQA 5AUMB 2IPTL 1FC1A 4MWFB 4ZS6D 4RRPA 1NGYA 1B4RA 4P4KB 1J05B 1FFQA 4WU5A 4RAUB 3OTTA 3QDGD 4C56D 4XX1G 3VCLB 2GQHA 1CFSA 2BDNH 1CGYA 3E8UL 3MJ9A 1SEQH 1AQKL 2J2ZA 4ZUSA 1U95A 3VG9B 1N6QL 1U8NB 3E6FA 2BDNL 3FQTA 1P7KB 5FOBA 3ARDA 3TJEL 3VXUA 3GMLA 3SGKC 1Y18A 2MCPL 1GXEA 2ZCHH 4KDWA 1ES0B 1BOYA 3G5XB 4N9GA 1MNUH 2ARJA 3V6OC 3IU3A 2FZ3A 5I16A 4ODVL 2UY6A 1YYLL 1F4HA 3V6OE 1OTTC 2D9QB 1INEH 3DX9B 4EUPG 3QEQA 3BGMA 3BT2H 4DVBA 4BUHA 1J5OL 2VDOL 1X5YA 3WFCH 1IC7H 1OD7A 5JW5A 3RY5A 4R9HA 4YO0A 1GCFA 1JHLL 3KPOA 4K94L 4NNPL 4RDQF 3MXVH 2FJGA 3DROB 4JJ5A 4M03A 3P0GB 2BSED 5SWSD 3I3BA 3Q48A 4YGVA 2WZPD 4KPHH 4PJHF 4PJCB 4Z0BL 4X99B 1CFTB 5EU6B 3C60B 5C0FB 1C5DB 5D5MF 5BV7C 3FRPA 4XVSH 3D9AL 1Y0LA 5IKCA 4QXTA 4PJCA 4Q6YA 2B39A 2C3WA 1QOKA 3QIBA 4KI1A 4P59L 2VB5A 4QYOA 4PJIE 3RWIB 1WSST 4HKXB 2X70B 2H3NB 1T5XB 3ULUL 3FT4A 1PAMA 4Y8AA 5I19L 1GZPB 3VFNA 3TPUB 2P45B 1NDGB 1QRKA 2W0PA 4OLYL 3WBDA 2VQUA 3BD4A 3N1MC 4G8GD 2W0LA 3BD3A 3SKUD 3JWOH 3QH3A 4WTZA 3BEVA 5HHVL 1B0RA 1MRDL 4YNYA 5CJQL 4PJEB 1AKJB 2OTUA 4LDEB 5IBTL 2J1KA 1X5KA 3W5NA 5F6IC 5C0BB 4MJ4A 4BSWB 4QTIL 3O2DL 5MEPA 5TQ2L 1CL7L 2JB5L 1FZKA 4NUJA 1IBGH 3QUKA 2A77L 2YMXL 5DVMA 3X12B 1C8PA 3MRLA 1BZ7B 4HS3B 4QHUA 3FAXA 5ALCL 4UQ3B 4O2CA 3S96B 2PXYC 5FDYA 3HR5B 5C0CB 4YHYC 5CJ5A 2AEPL 3EO1B 1C16A 4OF3A 4PJ8C 2YD8A 1KFAL 2A2QT 2CIIA 3PWNA 3VG9C 4K07A 5GS1C 2J8UB 1YEJL 1B4JL 3MZGB 4LSRL 4Z0XB 2I60L 2OQJB 3U4EA 3TZVA 4HBCH 1T83A 1N0LA 4MCYB 1CD1A 1HXMB 4L29B 4AIZB 2UYLB 3CK0L 1RUML 4YHKL 5C0ND 4F2MA 1BVLA 2OSLA 1MCFA 1ZT7A 3L3JB 1QSZA 1BIIB 1GGCL 3J8F7 3PWUA 1F11A 3E8UH 5EU7E 4LVHB 3D69A 4R7NA 3BGFB 4WW2C 4E41B 1BEYL 4HPOH 3QCUL 1GGBH 2C1PB 2AAVA 5JIHA 4ZS7L 4HIEA 1I1AB 4PRPD 4M61A 4V2CB 5HHXL 4UQ3A 2VL4A 5DJ6B 3S96A 3N1PC 3WD5H 1MEXL 5DJ2A 1MHCB 4JFHD 4AG4L 4NZDA 3O6FC 4NN7C 5CEZL 3DXAD 3CU7A 3MRIB 3BRFA 5DI8B 2BXYA 3V4UH 1NKRA 1MJJA 1BF8A 4FRWA 3UC0L 5HYEA 1P53A 2B1AL 3RVTD 3ARWA 2C26A 2Z91A 4Y2DB 1BQLL 3D2UA 2V5RA 3PABB 4Y4FD 3W39B 3MOAL 3P4NB 4DUWA 5IMOB 3T0WA 3ZYJA 2VSCA 3I6LD 1OQXA 4LPWA 1HINL 3AREA 3D39B 2CDFB 2R2EB 3MBEB 4LQFH 2JCCE 1AFVH 4LARL 5TPWH 3IDIA 2A73B 4RFNB 4GKZB 2DTML 5E9DA 5C0BA 5E8NB 3RVVD 2DM2A 3ULSA 4PJAE 5F21B 2GYSA 3F58H 3O6KH 4HIXL 5EUKB 3N1QC 2NY1B 2FEDD 4Y19E 5E2UL 1X5ZA 2NNAB 4YHLL 2XACC 2FHBA 3GO1H 1CIDA 3L6FB 4I9WE 1UWXK 2CR6A 4LOUD 3O2DH 4ZUTB 4KVNH 5IR1B 1A4KB 3L5JA 1A1NA 1P4LA 4IMLA 5DHVH 4IRSA 1TQBB 4XBPA 2C3VA 2R23B 1BD2E 4UINH 1NANI 3FHAA 4JKLA 3VFMB 2VXQL 3OKOA 4YHYB 3DNKA 2XWTB 2EH7L 1BJ8A 1Q0YH 1HHHA 5ESAA 4IOFC 1KJMB 4P5TC 1ZANL 2EDBA 5D70H 4PJIB 3QUMH 2ZPKL 3NFPB 4N68A 4MD4A 4DKEL 1X5HA 5JOFB 5C0DA 5A2IH 3C8KA 3HTLX 2XOTA 4G6KL 3NFPA 4RFOH 2HMIC 4GRLC 3SDAA 4O4YL 1JYNA 3GNMH 5ICYB 2Y5TA 2VN7A 5ISZE 5GGSA 5KSBB 2WBJD 3P4MB 1RK1A 4OGXH 4PJ7F 1JJUA 4F58L 3CGTA 4DN4L 4E41E 1UJ3B 1KFAH 3C6SA 3ULUD 2E6QA 4E0RB 2FZ3B 2XZZA 4Y1AA 3BI9X 5GIRA 1BQHB 1IC5H 5D7IB 5INCB 3DUSA 4JPWL 3SKNB 3O6ML 4LPCA 1MCHA 5GJSL 5KSUA 1T80A 2B2XH 4Y1AB 2Q20A 4MLIA 4J1UA 1OSPH 1E4XI 1NAML 3CLFH 1NDMB 2ERJC 2QQNL 3B9KB 4YBLB 3BT2L 1ZEAH 2CK0L 3RGVA 3BSZL 3NAAL 2GSGA 4HF5L 3K4ZA 5DGQA 3B9KA 5INDB 1ZKAA 3BE1L 3U0TA 1N59A 3VRLF 5I2IA 4M7ZB 1CXKA 3VFOA 2RAMA 5FV2A 4K8RC 3EZJB 5KG9A 3EFFB 3HZYA 1A2YA 2FB4L 2WP3T 4HDIB 3SGEI 3ZL4H 1KNOA 2AJZB 1PYWA 5LG1A 1MQKH 4QXGL 3RTQB 1YY9D 2PYED 3MYJA 3BUYA 1J1OL 1HQRB 3CH1A 4UV7H 2NTFB 4OV5A 3JWNC 3BDBA 3EYFB 4POUB 4IMLB 1JGDA 1Z2KA 3T08A 4APQA 3T2PA 4JY5L 3SKJL 1ORQA 4ZXBA 3QA3B 5EU4A 3VXSE 4KUZH 4LPTA 4XVSL 2EE2A 4PGCB 2HTKC 4AEHL 2VLKA 2BSSB 2PO6B 3NH7H 4JFFE 5DMIH 4EVNB 4UU9B 2XQBH 3IS0X 4G7YH 4WHYH 3REVB 1KJ2A 2B1HL 1G7LB 2APTA 1T0MA 1RU9L 4ISVB 4XXDA 3RZWA 4X8JA 1U3YA 1E6OL 2I5YH 1RUKL 3BH8A 3N50A 5ITFA 4MNQD 4XCYB 1S5HB 5IW3A 2AV7B 2YD4A 1AC0A 3BZFB 3ZE0E 4PV9B 2Y36H 1FZMA 4GMTH 1J8HD 1JWUB 4UTAL 1S9YB 1KLGB 1BHGA 3CFJA 4NGHH 1K85A 1LEGB 3DURA 5I71C 2LAGB 1MCCA 4Z18A 1I9IL 1IC1A 3ZKXC 3HZVB 1A7OL 4PLOB 2A1WH 5CP7B 4PP1C 1LMKA 2W91A 1VFAB 4MDJB 1ADQL 4JANA 1NCCH 5LXGL 4K2UH 5F9WB 5L6YH 1PZ5A 3CDGA 4KAQL 1GRWA 4LSSH 2EIEA 1JWSA 1T21B 3KYOA 4U1KA 4MS8C 1CFVL 2IANE 3RUGA 2WINA 5D1QC 4HFUH 3AXLB 3SCMA 4MCZB 1I1AA 2XN9E 3SDXA 5D8JL 2XQYK 4KJWC 4HH9A 2GAZB 3QHZL 1KOAA 2NXZC 5IEHB 4PJ5D 2FIKA 2Y25A 4QY8A 2UUDH 3SDXF 1J12A 1LDPH 2P5EA 2X6MA 4IOIA 5DJXB 1CG9B 1HCVA 3OGOE 2LFGA 5BRZE 2EDLA 4O02L 4KU1A 3PGDB 4K3EH 5HHQB 5E6ID 1T0NA 1CDIA 3H2WA 3PWJB 3GUTA 4BZ2H 1BM3L 4Y5VC 1XGYH 1AXSB 2UVEA 3OKDA 3KPQA 25C8H 3MNWA 3TPKA 5C8JA 1ZS8B 5LGJB 4TULH 4XHJD 4NZUH 5A2KH 3RWGB 3QA3A 2E9BA 2Z8SA 5IB1B 4FQLL 4OD1L 1RK0A 2OMBA 4L3EA 5E24E 4WCYL 3D48R 5BW7A 3QB7C 3S3SA 1A6WH 3P9LB 4Y0GA 2F8VA 3VFOB 5GRZA 3X3FL 1U8OB 2MCPH 3I75B 5JQ6H 2WBWB 3TIDA 4G3YH 2FL5B 2VZ3A 4ONFL 1Q9LA 2VR4A 2FBJH 5DK2B 2CK2A 3ZTNH 4DVBB 2ARWA 3SE9L 1X5AA 3NPSC 3U7AA 2FBJL 3GSVB 4X80H 3ROLA 4M62L 4GAYA 4NM8H 3SE8L 5LQBL 4MNHA 4FABH 1PZUB 4KI5D 2D0FA 4F9PA 1LO3L 3GFUA 5DRZA 4OZHF 3MLUH 3IDNA 3MCLL 3TC9A 3VA2C 4GSDL 2CMRL 1S5IL 1DUYA 4DKFL 2N4IA 4KKAD 3L3IB 1OLZA 5J9PA 5E8DH 3LEYH 4ENEC 4KTEH 1I3RB 3QNYB 4J8RA 1I1YA 3LQAC 3SBWA 3OJVC 5J12C 32C2B 2WP3O 3QG7H 2CLVA 2E6PA 4FQ2L 4NQEB 4JY6B 5DO2C 4C54A 1QVOB 3FKUS 1UB5A 5ACMA 4JQVC 3ORJA 4CW1A 1D5MA 1EAPB 4YBHA 1CT8A 5ACLA 1NUFA 4XZUA 3EDEA 1UKQA 1V3KA 5E2WH 5HI3D 2WIMA 4XZUB 3DX9A 5GGVH 5DHXB 3QUXD 4YZFE 4WEUD 3O11A 3PP4L 4NQCE 2AK4A 4JFDD 3MNWB 4AZ8A 3CMGA 2ZNXA 4WDIA 2Y5EA 1IGJB 1U42A 2R1XB 2JIXD 1I3RA 1CLCA 5DJ8A 4YHIB 2VLRE 4YHNB 3IS1X 3OBAA 1KCRL 3I85A 3DARA 3VFGL 3QBTB 5AG9A 1DBBL 5KSAA 5T1LA 4S1SL 1T22A 3VWJA 1RZJC 2X41A 5DA0B 2VAAA 2ITCA 4CVUA 1J8KA 4FQLH 1I7TA 4OD1H 2RFXA 3DGGA 3QJHA 4PJAB 3TLRA 1FO0A 4MA8L 3TNNA 3V8OA 1T1ZA 4MZ3A 4U0RC 4HJJH 4W70A 4EIGB 2Q6WB 2GY7B 4LSPH 1T03L 1EEYB 5AUMA 4XAWH 3DX8B 1F45A 4WEBH 1UM6H 1FIEA 3WL9A 3RAJH 1MCSA 5I6XB 3T09A 3EAKA 4FQ1L 4NO3A 3UBXG 2I9TB 4B50A 2R9HD 5ALBH 4Z7QE 3CFDA 1J7VR 1RIVL 1QA9B 2JB5H 2MJWA 4APQC 1BFVH 1R5VA 2B4CC 4PJ9A 4LBEB 1JPFA 3P9MB 4HIEB 5IB1A 1VKXB 1LE9A 5F72S 2R2CA 3E0GA 3MLWH 3OQ3B 1PEWA 2D31B 2AXGB 1IKFH 3EOBB 2DQEL 5C0BD 4HIHA 4HEME 4XI5D 4ODTL 5JDSA 3MJ7B 3T4AA 3CVHA 5FECB 4P23D 3RKPA 1CGSH 5I75B 3S4SA 2BY0A 3WXVL 1PG7W 3O4OB 5KSVB 4D0CA 3KXFD 3VXME 2V9RA 2W9LA 2CLZB 4Z95L 3V5HB 3P77B 4WU7B 4HC1H 5E9DE 2UZIL 5TE6H 5CD3B 15C8H 2RJMA 4F8TA 4NFBA 5KVEH 1OAXL 3PDGA 3H9YA 2E27L 3KDMA 3RVWD 3CUPB 5IMKB 2UY7A 5CD3A 5EIVA 3L3DB 5BRZD 5SWQA 4HGWB 5AD0A 4QWWD 5HYFA 5IESH 4OFPA 1YMME 1KIRA 2VZ1A 5FYKU 5HXMA 4OI7A 4XCCH 1RZJL 2NMSA 3BEWB 1N7MH 5TGBB 5B39A 2ESVE 3F58L 4HIXH 4ORGA 5F7YC 4Z7WB 3QFJE 4J4PC 3MLSL 3WO4B 4JN1L 4QKXB 2QHLA 5CIPB 3WJJC 1UJ3C 4YQXL 4J7RA 2NZ9D 3H9HB 5BO1H 1DR9A 2IBZY 4F15B 4JGJA 3SDAC 4HCRA 4BSVB 4OI9A 4PLNC 4X6DF 5CUSL 1KLFA 4MJIB 2Q86A 5KVDH 5HYSB 4LSPL 3WO3B 1W0WB 1P1ZA 3L7FA 2Y7QB 5IB2B 3QHFH 3P2TA 3F7YB 3TP4A 4PG2C 4OFVA 2VZSA 5A1AA 4NQCA 5F71A 3FO9A 1NCWL 4NKMB 4MAUL 2W0KA 4HJGA 4G8FA 4OLWL 1DUZB 2E7MA 5IKCB 1NGZB 1UZ6F 1PKQE 2F58H 3QIUC 3VFPA 3ULVC 1CBVH 1AGEB 4KQ4H 4OF0A 4YDKL 4DTGH 2GJ6E 2DI7A 3TCLA 4TUKL 2LVCA 5I0DA 4PYHA 5KANI 4P46C 4P2RE 4HK3J 4EBQL 1R3KA 1EEQA 5EU6E 3MRFB 4LLVA 3Q6FB 3SDYL 5B8CA 3VXQB 1IGTB 3S36H 4DFIA 4HG4J 5JHDA 3EYFA 3RI5K 3E3QC 1I1CA 4QF1B 2VLMD 4X4YB 5BMFH 4L4JA 3OKNA 1GGUA 4G6JL 1IM9D 5DEGA 4P9HL 2VH5L 5F7DB 2NLJA 4AYFA 1RZFH 2XZAL 2OJZL 3UJTL 3MR9B 2B2XL 1M1SA 3QQ3B 4HV8B 4PJEA 5EZLB 5DRZB 1FQ9C 4I2XE 4YDJB 2UWEE 3B3IB 2G5BB 3T0BA 2WSKA 4N5UA 3IGAB 1QBBA 5F97E 2GTZA 3DBXA 3O81A 4U6HA 1FYTE 3R06B 5DC4B 1AXTH 1FJ1B 2B8OT 3MREB 2OXGA 2ADGA 4L9LA 4BQ9A 2Q3AA 3TIEA 1J87A 4MXVE 2AGJH 4IRJC 2HG5A 4XP1H 1HINH 1TIUA 4KDVA 1WIPA 2Y6SC 2F53D 4JVPA 1MJ7L 4UDTB 2AP2A 1PX4A 3LRSB 5BZDB 3VWKB 3PE9A 1FVEB 3MFGB 1CE6A 2X89D 3JWDH 4PJ9C 5GSVA 4G7VL 5FYKD 1EVUA 3IRZA 2QHRH 1DN0B 2E5EA 1UXWB 4X9BA 5IFAH 1LWRA 4OZGF 2WLZA 4NC1C 3UAJC 3T3ME 3WO4C 4NKDA 4AG4H 1R3LB 4JAMA 3H0TA 3U7YH 5EO0A 5AAMA 3K8KA 2R39A 3EBAA 5E0QA 3CVIL 4V1DE 3AC0A 4OLYH 2EC9T 3H0TB 1RZ8A 4M5ZH 4MAYD 3DBXB 3V79C 4G3YL 2P1YA 1IT9H 4O9HL 5B38G 1RIUH 4BZ1H 3L6FA 3VFVB 5BRZA 5H2BA 1XF2A 4HUXA 4WCYH 3UZVB 3ARBC 5AZEL 5TH2A 1ZVSB 4K7PH 1CFQA 4Z7WA 2Z92B 4WI6A 3BPCA 3OF6A 5DS8B 4QXWA 5JIIA 1TQCB 5KZCB 1I9JH 3OKOB 2ZKHH 4OJFL 5I8KH 3BISA 1IGML 3MRFA 4JHWL 5KS9E 4F8QA 5ESVB 2BY1A 3S6CA 1A1NB 3MRGB 5EO1B 3QDME 1QZ1A 4RWHA 4JFPB 5E1AA 5B21A 4WU5B 2VL5B 3FHQA 1D6VL 2O26U 1KIPA 2CQVA 4IRJB 4JM2F 1IC4H 4Y4FC 3FO1B 3UMTA 2DD8H 1H9VA 1ZA6A 1VPOL 4YDJA 4L3EE 5F7KC 4NKMA 4ESKA 4NNYB 4OFIA 3QEUA 4YEEA 4P5KB 1MCOL 4L9LC 1MLBA 4QHNA 3RDTA 1NGPH 4X5XB 2VH5H 3C9NB 1I1RA 4ZG1A 2BNQB 1DQML 2GSIA 3FQRB 5KS9B 4U2ZA 3SE4C 3FQUA 3QDMA 3GHBH 4DZ8B 3FN0L 4PD4K 3EUUA 2PCPB 2VC2L 2O5XH 2OX5A 4P23C 1UQSB 5JDSB 5CP7A 3WIHA 2KZ1B 3ULVL 3MRCA 5EH1A 2J6EA 4JKMA 4KQ4L 5EBMB 4H0GA 3VJ6B 1CI5A 1UJTA 4N0FB 3FB6A 5MENB 3ESVF 4X8XA 4NO5B 3Q1SL 1IFHL 2ZNWA 5EIQA 4FFWD 2O61A 5IBLD 1RJLA 3PP3H 3CSBA 2W65B 4U05A 4MXWH 2OP4H 3T0EE 4OFDA 4NCC1 4L4VA 4JRXB 4YXKH 5IP4A 4LARH 3L5HA 2NXYB 3N85L 4KC3B 5K9QG 3ARBB 5EOTB 4EI5B 4GKSB 2V9TA 4XWGH 3EFDL 5FKAA 1U9KA 4U1SA 3KYOB 1VACA 3GBMH 3MYZA 5T1LB 4JFOA 1G7JB 2FGWH 1RU9H 1AXTL 1HSAB 2AK1L 1AGFA 1XMWA 1FNSH 1MF2H 4IBLT 2D0HA 1JCKA 4YFLI 4KXZI 5I30L 2HTLD 1P84K 1NAKH 3HI5H 1ZAGA 1RZFL 1EBPA 3WFHA 3WFBL 1R24A 5KW9L 4ZSOE 1A5FL 3WJJA 4X5LA 4OF7A 2ICWA 5C9KA 4J1UB 5LGHH 3J7HA 1W8OA 2FJFB 5D72L 3CU1A 2FR4B 4LHQB 4CJ0A 3ESUF 4OUUA 5CBAB 4K9EC 1AO7A 4QRSB 4CVZA 3BPOB 4XMKL 5L8KB 4X6EB 3C08L 5FGBA 2LABA 3U83A 2JLLA 1KCSH 1G7LA 1A9EB 4ONOA 5FM5O 1FH5L 2WBJB 3VFVA 4HWZA 4D3CH 1B0WA 3HI5L 3KPSB 1BQHG 1KNOB 1ZMYA 4EXKA 3I6KA 1CGTA 1LK3H 3EO0A 4CVXB 1TJGH 2IH3B 3PIQB 1D5IH 4QRPA 5CGYD 1RK1B 1XH3B 5LBSL 5I1JL 1KBGL 1EH9A 5M7QA 2NTFA 4CMHC 3L5IA 2HJFA 2VUYA 1UT9A 1M7IB 4PJXA 1IC7L 1Q9OA 4WFGD 2P8LB 2XQBL 1IKNA 3SJVB 4DZBA 3W11C 4P3CL 1MIML 2BFVH 3LN9A 1EJOL 4KUZL 3EGSA 1BBDL 4M1GL 5GGRA 3I50L 1F00I 3EOYG 2BMKA 4N0YH 3LIZH 5DD3L 4P9ML 3BPOC 3MFFB 5I15H 5DD5H 3MNVA 1FL6B 1OY3B 5D7LE 1YEEL 3CZJA 3V8CA 4PJEF 1I8LC 1UGNA 4ZDHB 5HHPA 1G9EA 2M26A 1NAMA 1EO8L 4S1DC 4Y1AE 1ZANH 4Y88A 2AV1A 3HLAB 4WWKB 1Q1JH 4JPVL 4O58H 1F4YH 2CD0A 2OLDA 2YRZA 5B38B 5GS0H 5INCA 5DF0A 1TCRB 4WUKH 3DLQR 4Y5XB 5K9OB 2R0WH 4HS6B 1U8KB 1ZLVH 2Q8BL 5FGCB 1Q9KA 2JCCA 5FO9A 3O0RL 1TCMA 4XPAL 2R0LL 3ZYIA 2E9WA 1VPOH 4LU5H 4AT6B 4L4VB 1U3JA 4FFZH 3FOLA 3CC5A 1QBLL 2CGRL 4XH2A 3TH2T 3MJ9L 1URLA 5GQBA 2FJHB 4ELMF 4LCWB 4FQJH 3UP1A 2ZSWB 1XGQA 4GBXA 1OAKH 5DC9B 1GOHA 2OJEA 4TNWF 1NEZA 2OBGA 3OPZH 3BP6B 4JZOA 4OCSL 2IFGA 1WVZA 1S7SB 4LSTL 2VDLL 2Z8WC 4OKDA 4PV8B 2HYMA 1H15B 2CPCA 3A67H 3ARED 5DLMH 4DAGH 1IE5A 4BKLB 4Y19A 4PRPB 4C55A 1ZWIB 3AFLA 1AD9A 4X4ZA 1FFOB 4CN1A 5IM7A 2ATPB 4NQSA 3THML 4W81A 4MDJA 1CU4L 2FJFA 3BIKB 4Y89A 3DVIA 2YK1H 1V3MA 5D7LA 3RWGA 1DTUA 3DETC 5ANME 4OZGB 4CDHA 3ZE1F 1IAIL 4P0DA 3V7AG 2OR9L 3TNMA 1UH4A 2IF7A 1KPVA 5DQDH 1OGTB 1RJCA 5E8PA 5T5NF 3FQUB 2W9EH 3MRKB 2EXWC 2MHAA 4UQ2B 3NCCB 3TT1H 4FTVB 1TTUA 1IKNC 1S7VA 1KTLB 2EYSB 2ITDA 5HHNA 4XP6H 4LLMB 2FNBA 5IMLA 5D5MA 1UXSB 4WFHE 4PJBA 2YSSB 4P5TA 4KMTH 4YHOL 1BBJA 1FG2A 1T66C 5DDHB 1S7RB 3U46A 2A1WL 5E2VH 7FABL 4M5YL 3MRJA 5A43C 4WWKC 2MSPA 4P2YA 2E7HA 3EDKA 1F90H 1P4BL 4FZ8H 3FONB 3ZDYF 1ZTXL 4OLXH 1NCBL 4FFYH 2BSRB 5JO5B 2UUDK 3L7EA 4MHHG 4HUXB 3P4OA 5FGBC 2AERT 1A47A 2EDWA 4WV1A 4U49A 3I6GA 1JRHI 2CIIB 4TNWK 3ULVE 1SY6L 4M7LL 4JFOB 4Y5VA 1FO0B 1OPGL 2HFFB 3MLYH 1MI5B 4PJFA 4RQQB 2QSCL 4XPFH 5GGQL 2AJZA 4EOWH 1LK3L 2B1AH 4YNYB 5FGSA 4Q9QL 2NY2B 2WWKO 5F1NA 1NGWB 4LSVH 3VFNB 5FUZL 5IMMA 4TRPL 4BH8B 5I1CH 3MGTB 1WGOA 2ZUSA 1AXIB 3T77B 3T0VA 4PJCE 3QEGL 4IRJD 5MEPB 3VXNB 1EEYA 3BDXA 3O4LE 4TPRL 1I1AC 5DFVC 3GSUB 3G5YA 1II4E 2C5DC 3TV3H 5SWZA 3VFWA 2DQUL 2MMXA 4MJID 5JXEC 3M17B 2VAJA 3STZA 4ALAH 5SWSB 5T3XE 4RMQA 5D93B 4R0LC 2NY6D 1HHGB 4PLJD 1CK0H 5BZDA 5FHAH 5BQ7A 2HVKB 4MA3B 1AP2A 3A6OA 4IMKA 5IG7A 2BP3A 2PCPA 2FEEL 3RIFF 3G5ZA 3NBNA 5C07E 3GEWB 1J0KA 5LWYH 3MRRA 2DKUA 5I30H 4R90H 5TE4H 2HKFL 4RISH 2G9HA 2X4RA 1HSBA 2C3XA 4ELMB 4S0SD 5CJXA 3QXUA 3IU3B 5DFTA 4Z7VF 1VGKB 5E99L 3MLSH 5ACZB 4LVEA 5HDOA 4FQJL 1FNHA 3LEVL 4GXUM 2XTJB 2HMID 1BZQK 5CEZD 3FO1A 4C83A 2FEEI 3T1FB 5BS0B 1R3IL 1WZ1L 3GSNA 4LHUB 4OCWH 2AXJA 4PP1D 4Z7NE 1UZ8B 2HLAA 1FAIH 3TA3B 3HG1A 3D3VD 4HX1B 3DROA 5CEYB 1UADC 1OWWA 1JI1A 1QSEB 3DRTA 4HWBL 2E7BA 3L3IA 4F37F 1VSCA 5C2BL 4HX1A 1VGEL 1EHLL 5KVEL 1MUJA 3WFEL 5C0EB 1AH1A 4LVNB 4U6XA 5C0CD 4MJ2A 5HGHA 5CEZE 4OM1L 4ORZC 1HCFX 4RIRB 5SX5K 2NY6C 5CLTA 2L7UA 4ZUTA 4F37K 1J1OH 3MYJB 1BQHA 2JTDA 1BFOB 4K3JL 2R1WA 4GRWE 4KTDL 1JV5A 1QPPA 1T6WA 2FYYB 1WFNA 2G9HB 4HKBA 2N7BA 4OI8A 3PWVA 1VFMA 1A6VL 4IIQA 4LDLB 4CDGC 5B38A 4NQCB 1UA6L 2IADB 1AGDB 5A16B 1JL8A 2A73A 1OCWH 5C09D 4XC3L 1W0WA 5H35A 4R97B 1DQDL 1WITA 4TVPD 5FKAB 4I3GA 3QUYD 2XKNB 1YY9C 2I07B 4OZHB 1XIWB 4MLSA 3NIFE 1TENA 4YE4L 3ZMRA 4UOW1 5E9DB 2VLJE 2RIKA 1XF5B 2PN5A 3QIBC 1N3NB 4GLRI 1U8OA 2EE6A 1FG9C 43C9A 3MCKA 4ORGB 5HJ3A 1K4CB 4RX4D 5J11B 1FL5A 2GT9B 4R90L 3ARYA 4PJDE 1UH3A 5D9SA 1KTKE 2QKIA 3N9GH 2CUIA 2XZCH 3ZKND 3Q6FA 4RCAA 4W6WB 4XPGH 1JBJA 1CDHA 3VFGH 3NFNA 5JW4M 5B4MD 5L2KD 3VW3L 1NMCC 1CFNB 3UYPA 1AY1H 4JDVB 3IGAA 5LKNA 4G6KH 3CPLA 5C07B 4YAQB 3C09B 3MBXH 2OK0L 4XP6L 1QYGH 4JZNB 2NY5C 3I02B 3CXHJ 5IB5A 5EU7C 3HR6A 1G6VK 1T89C 4ZTOL 4WW1B 1QFWH 4TPRH 5D70L 1JPSH 1S9XA 5D2NC 1RUPL 2IAND 2VC2H 5ECJE 3QUXA 2WMPA 5IF0A 5E08L 1ODAA 1TVHB 4OQTH 1NC2D 3QUYA 4OCYL 4UINL 5J1SC 3EO1A 4MNGB 3NTCH 3WCYA 2WK2A 3OHXB 1H3UA 1MF2L 4H8WH 1OM3H 5D71H 2OCFD 3H3PL 2IBGA 4I0CC 3WDHA 1DL7L 3OXRB 4YK4C 1BQUA 5HGDA 4IOFD 2JK5B 1CF8L 3VRIA 1OB1B 2VO5A 5GJTL 2R1YB 1FZOA 5DEZA 4P48A 1JFQL 3U79A 4K8RH 4WTZG 3OL2A 4G6AC 1TQBC 2JB6A 1LO5A 5B3NA 3Q5YA 5H35B 1JN6A 1BP3B 3WN5B 3CDFA 1PKQA 5AZEH 4O2EA 3ARFC 4KMTL 4LEOA 2XZAH 3U4AA 5KOMC 1KJ3L 1SJEB 3BPNC 4UT7H 3TYGH 3I9GL 1WFTA 1KTDA 4HWEL 4YHZL 4M1CC 4KTEL 2PTVA 3HG1D 1T5XA 5MP6H 3S98A 3QXAA 4H88L 3SDCD 2CSPA 2VITB 5B39G 2HT2C 2A74A 3GB7A 2X89A 2APWA 1CL7I 3K81A 5K9OA 3JUYA 3TNNB 3VMPA 2OR9H 3QH3B 3RY4A 2XFXB 2PXYB 5FDWB 1OAZH 1T7YA 3GMNB 3IETB 1TJHH 4JR9H 3RKDD 3S3JA 2R4RL 4PTTA 5C6WH 2WWKT 1CWVA 1RI8A 3ZTNL 4KKAC 5D5ME 2VR9A 4JFDE 4YPGB 5F9JA 4A6YL 1QEWB 3O3DA 3MRHA 3L5WB 1FE8H 3DV4B 4YHZH 4HWEH 2Z31D 4LCWA 4ELKA 3MRQB 3IFPA 1DFBH 1KYOK 2CXKA 3RX5A 3T0DA 3GI9H 2KKQA 4OZIA 2DQJL 1W72B 1BFSA 3PF2A 2A83A 1TZHB 3HNTH 1ACYH 3H6JA 1C5BH 3EO0B 4JGUA 5D2NB 3QO0A 5HGAA 1OTTD 5I16B 4HIHB 4MNHB 4K23H 3VWKA 4YDIL 2AV1B 1EEZA 1J18A 2KL6A 3BX7C 4H1LH 4AEIL 4WW2B 5HVHB 3BPLB 3DV6B 1LP9B 3TZVC 5D9SB 5EIIA 6FABH 3RGVB 4LLAA 3RTQD 3VXMA 5F7UA 5JPNA 3P73A 4LLYB 4PJAF 4ZFZB 3MNZB 2X4PB 1F4WH 3LRHA 3CFBB 4HFUL 4W68A 4X7FC 3QJFA 3P40A 1SM3L 5IVXB 4KK6D 3U6RB 4OGYL 1HQ4B 1RFDL 4TNVK 1G6RB 1MFAH 3TBWA 5FK9A 1ZHNB 2LU3A 4KH2A 3BAEH 4DTGL 4XNQB 3FB7B 2GEEA 4JPVH 2IAMD 1WBYB 1A7OH 1N8ZB 3T4YA 5IQ9B 5TFSH 1RIHH 2CUHA 3B2VL 1HHKA 5CCKL 2HJKB 1YEEH 4P4KA 4AM0B 2Y36L 3OKDB 3G5VB 3JTTB 3HE6C 5T1DL 2IMMA 5IMOA 1NMAH 1RZ7H 4DGVL 1XFPA 1D5XA 5GGVL 5IW1B 1T0NB 2NX5B 5IWLA 1YEHL 2IPUG 1ZA3B 3CFBA 4RMTA 4J3VA 1QR1B 2IEPA 3P3YA 2W65A 4J8RB 4L8BB 4DN3L 4QT5B 5LCVL 1FNLA 1DQLH 4MMZC 1A9EA 2FLRT 1BJ1J 2ZSVB 3KXFB 4RMUA 1FL6A 4LEXH 4P2QE 3CXDH 3WE6A 4JREC 4YR6B 2F5BL 1BPVA 4XWGL 1YPZB 1HN1A 4HEPG 3AMLA 3QCTL 3QG6B 3UEZA 3V5KB 4OCLC 3QO1A 2ZP0T 3SO5A 1O7SA 2XNAB 3IDYB 4I3RH 1YQ2A 1X6LA 2DLGA 4QO1A 5FO7A 2VLLB 3KPSA 4NJ9L 4NQDE 2HH0H 1KLGA 3HMXA 1UA6H 4R0LB 3F5WB 4TVPL 5DHVA 2IWGA 4RDQG 5EO9A 1X5JA 3WDIA 4ZXBD 3O6LH 2HT4C 3SEPA 4UV7L 1A7RH 3IDJB 5EBMA 5IMKA 1P7KA 4FABL 3WLWC 4HBQA 4K3JH 2IJ0C 4U6YB 1SEQL 1HHGA 3SCMB 4U7SA 1JZ5A 3LN4B 1Y6KR 1C1EH 3MBXL 3ARDC 2GJZA 4HKZA 4U3CA 3BO8B 1LEKB 3GJFH 4NQDB 5D93C 1NGPL 2E7LC 5I1HL 4R4ND 1G7HB 5C2BH 1QFUL 1Q9LB 3LVEA 3D6GA 3P0YL 4ZFFB 4G9DB 1OW0C 2KH2B 3N06B 1DE4B 1SM3H 3BQUB 4ODXB 3K2UH 1OPGH 1BFVL 2DLHA 4PG9B 4U7MA 5FB8A 1X5GA 2WAHA 1JWMA 4GRWF 3G08B 3IJSB 4K9EL 4NJAL 4QRUB 3V5DB 5ICZA 1A4JB 4O51A 4JZJA 1JWMB 3RU8H 1WZKA 3VGGA 4CADA 1R5IA 3OPZL 4XX1E 4P2OB 4V1DA 5FUOL 1QR4A 4APQB 1CD9B 1NMBH 1PZ5B 3CDGB 4DW2H 5EO0B 4MXWL 1QBML 5DJ8B 3L7EB 1YUHA 4G42A 3LZFH 4M5YH 5B39B 3ALXA 2V7NB 4L4TB 4ZO7A 1YN7A 4M1CD 3OZ9H 2DQIL 1RHHB 4NQED 5D1XA 4OF5A 5F3BA 1MFBL 4X6CB 4P2RD 3HZYB 4ZUUA 1U8HA 1YY8A 1INQB 4R97C 4HAFA 5D7SH 4Y16D 1QSFE 2JJSA 3CDCA 4LU5L 3ZHLA 1Z9MA 3ULVH 5D1XC 5JOEA 4F80A 4NO0A 3IKCA 4AQ1B 2IC2A 1DQJB 3R4DA 1VERA 4K3GA 3QI9A 3P77A 4XTRC 4TTGA 3VGEA 4EEEA 5C9JA 1YEGH 3IJHB 4KVCH 3TYFA 5EA0L 5IBUG 4R0LA 3VFUA 4WENB 2VWEC 1NBYA 3OAYK 1KC5H 5J1AB 5JXEA 1W72L 1UKTA 1AIFB 3AY4A 4NQVB 1JPTH 2K7PA 3VXUE 4R4BB 3L5XH 1HWHB 4KMQA 2XN9A 2FO4B 1AHWC 1YC8A 5IQ7L 4ZQKA 2Y5TB 3CAFA 5HGGS 4ZPTB 8FABB 5GZNC 4JG0H 3TT3H 3IXTA 4HJJL 5D2NE 1YNTB 3DVNB 5DZOA 5I9QB 4TNVF 1X7QA 3O3EA 5ICXA 1HNFA 4DUXA 4NO2A 3MOQA 2BRRH 4OFYA 1CGWA 4BJLA 3PHSA 3QO1B 2GUOB 1QLFA 2HLFC 1CZ8H 5GIRB 1P4IL 5IW6A 4OAWB 4WV1C 3OAZH 1MEXH 1KBGH 3HCVB 1F97A 2X40A 2XIDA 5F1IA 3C60C 3SQBA 4L8DA 4YWGL 5FYLL 5JW3H 4KJPC 1KN4L 4JY4A 4NBZB 2HG5B 3LSOB 1A0QL 2BERA 1CXFA 5MEQA 1G6RH 4N1EA 4Q6IC 1HH6A 2XZQL 3MA7A 3GSOB 3S35H 2JCCF 1E4XL 2NY1D 5C0IA 1RK0B 3T8XA 1RZIB 5D1ZD 3B4NA 5CHNA 2R1XA 3STLA 2FX8H 5GRJH 2AI0H 1MY5A 3LMJL 5DRXA 3GBLA 5ETUB 1FLTX 4QF1A 2BVYA 3C5ZC 4PBWD 2YC1B 1JZ3A 2BNRB 4RWYL 3H7BA 3BWAB 1F13A 3BKJH 2VDLH 4NN5B 4XPGL 5D4QA 4JFHE 4G8IB 4FHBD 4RAVA 3TO4C 2DYPB 1ZGLM 2LVEA 5IWLC 1RAMA 4ZODA 1M6OA 3MLVL 5F1IB 4ZSOB 1FC2D 3R06A 1MIMH 3TBYB 4RNRB 5CMAA 4PB9H 4OCXL 5DC0A 4X7CC 3IDMA 5E8DL 3GRWA 5J1AA 4IEFB 1KB5A 1AR1D 4P4KC 4LLDA 2R4SL 1REIA 1G9ML 2RGSA 2CGRH 2H2PD 4UBDC 1DUZA 3GBNL 1X3DA 4WFFD 3RL1A 4OZGE 2IAMB 1I9RH 5EPMA 2WW8A 3LB6D 2EEBA 5IESL 3D0VA 1MVUA 3B6SA 1CD1B 1HXMA 5FV1L 4AIZA 2X4QB 3INUL 4AEFA 4EDWL 3IJYB 2NYYD 1G7IB 3UPRA 2R69H 4RGOL 4EBQH 5CZXD 1EO5A 1DDHB 1KELL 1T7ZA 4FQPA 4QCIA 2EDHA 2ITDB 2LQRA 2YUVA 1FVCB 4LIQL 1IGYB 3TGXA 2H26B 3IJHA 3RIAF 3RA7H 5ABDE 3PWPB 4HWNA 1AD9B 3T0ED 1I9IH 1T1YB 1K8IB 4OCNC 3HFMH 5FUCC 4ELKB 2A6DA 3EJYD 5HTSA 3WS6C 4OQTA 5D6CB 1SVZA 4QNPF 3U9UB 1BX2A 3HUJA 2PO6C 1OAQH 5TGBA 3T65B 4F33A 4NBYB 1AJ7L 5FUOH 2VLKD 4FS0A 3O3AB 3VXRB 2F5BH 2PF6A 3TCLB 1OSPL 2F54A 3B83A 4K71C 3HUJE 2BOCA 2C1OA 3TNMB 1KXQE 1E4WH 3GIVB 1NFDA 2J88L 4I5BB 2ADFL 2ID5A 5EULV 1NUNB 3VGBA 4JDTL 2YN3A 1E4WL 5DFVD 1LE5B 2M2DA 1ZLWH 2EYSA 1ZHBB 2Z91B 3N1FC 5HD8D 4WRLA 2EO9A 5BVPL 3BRDA 4Y16A 3GI9L 2FCBA 4OD3H 4MJIA 1D5IL 2VXSL 4YUEL 1A8JH 1AKJA 2OTUB 4POZC 3O4LD 1TPXB 1MAJA 5GZOC 4KFZC 5IOPB 4IDJH 3TVMC 5T3ZD 1GPOH 2KBGA 1NBZA 2NY7H 2F53B 3O3AA 4FQQA 1NSNL 2ESVA 5FYJU 4P49A 1NCAL 5I1EL 2F54E 5E6YA 4EQ2A 3VFRA 4XPHH 1A6ZA 4GG8B 4XGZA 3ARDD 3VXUD 4NN6B 2UYLA 1KTRL 2PW2A 1C16B 3D5OF 1HXYB 2V2WA 4FQIL 1KT2B 1D5XB 4R4NC 3RP1A 4YAQA 4O2FB 1VADB 1MCOH 3CX2A 1HI6A 2CLZA 1IJ9A 3NIDF 3MLXH 4XNXL 3KJ6H 4KMLB 4IJ3C 4RMRA 2AJYH 4OQ1A 4XNYL 2B1HH 4J3XA 1DUYB 4NQSB 1T2JA 3H9SB 4M7LH 2HVJB 4XMPH 3RKDC 2AV7A 2HT4D 1F4XH 3QWRA 2R8SH 1E27A 4KRNA 3X17A 4UTBL 4WUUE 4Q97A 1IEBA 1YZZA 1NMAL 5DO2D 3BZEA 3MPCA 4WI4A 5ADPL 3EJZC 4JHWH 5J13B 2VDKL 1K9TA 3K74B 4KHTH 4OB5L 1XEDA 1LK2A 1XGRA 1BQLH 2D9CA 3KAAA 2CKBB 4FQXA 4IRSD 1LD9A 5DVOA 4KGJA 3VH8G 1Q8MA 1FL5B 1MQKL 2GT9A 4QXGH 5ESVA 2AI0L 1U8LB 3LMJH 4PRPE 5L7XL 5H37G 4WUUD 4TOYL 3MCLH 3OKKA 4RBPK 3SQOH 5IW1A 2GCYB 3EDDA 3BN9D 2CLRA 5T5FL 4PJDA 3MBED 1T83C 4ODHH 2ICEA 4M62H 1WK0A 2QQLH 2HTLC 4QXUL 2DBLL 3MA9L 3TA3A 4PJDB 2BMKB 4QGYA 1KENH 4FXLA 1SYVA 2H1PL 4LPXA 4HWUA 4X83A 4M7LT 1ZVHA 3GRWH 3AVEA 4P2RB 3SQOL 5EWIL 4N8VG 4JO1H 2Y07H 2W9DL 3GHEL 2NY7L 5C0IB 4Z5RA 3GM0A 1KLUB 4HWZB 5C0EA 5JUEH 4EDXA 5I2IB 1NAKL 1I4FB 1E0OB 5IR1A 4NSKA 3DJ9A 1WTGT 1P9MC 4G7VH 4KHXL 4XNQA 5ETUA 3EOTH 3TF7C 5HHMB 3OJDA 4CBPA 4W6YB 1OW0A 3GMRB 1PD6A 2IALB 1BREA 3IETA 1X5IA 2Z31B 5FYLE 3RI5F 4LCUB 2R56H 4MJ5A 5I76B 3LKQB 2R2BA 3VI4F 2X4PA 4BFEA 4F7CB 5I8OL 1QSFB 5FYKL 3DTXA 3SO3B 3QJFB 4HXBH 5DYOA 4OJFH 3WFHB 3UTPD 2C4XA 3UTTD 4N0CC 4OZHE 1F02I 4ZMAT 5I18H 2YEZB 4ZFGH 3QFDB 5EUOF 5E70A 1FNEB 1NLBH 3F6IA 4FG6D 3RY6C 3RIAK 2C4FU 1FJ1A 5D2NA 3QI9D 1F8TH 3ABZA 3GMOA 3WN5A 1T89A 4M8VA 5DK0A 3HAEB 3C5SB 4PRHA 1MRDH 1LEGA 2NXYD 4CVXA 2Z8RA 4LCIL 3SGJC 3FFDB 1WICA 1A6ZB 3FQRA 4LRNL 3V4VL 5KS9A 3PXHA 1S7QA 4WI2A 5I73B 3AM8A 2Q7NA 1L7TL 2YUWA 5IBUB 4N8VB 3GUTB 1OAYH 4Z7WE 4NHUB 2DJSA 5GS0L 4MQXD 1UG9A 3SDDA 4CNIB 4V1DB 1YPZE 3CK0H 1KCKA 4N0YL 1L7IH 4XCEA 5HI4C 1U6AL 5K9JL 3CZFB 2X4SA 3LD8C 5CGYC 1D9KB 2DTMH 4Z7OF 1ORSB 1FYTB 3GSWB 3SDXB 4KI5E 1IAMA 1MCKA 2J5LC 2DL2A 2JIXA 1TVDA 2VLME 5D1ZB 5C0GB 5CJXC 4HHAA 1NL0H 5EBWA 2JIXB 3DHJA 1ZHKB 2X5PA 4ZUWB 1IAOB 4PB9L 3C5ZB 4GW1A 4LCCC 2NY6B 5CSZB 3QQ4A 3GIVA 4HUNB 1JE6A 3BEVB 3DI2B 3F7VA 3PWPD 2H8PB 4BSJA 3QXVA 5GRUL 4JY5H 4KJQD 5EU4B 3KPQB 3R0MA 1DLFH 3ZLQC 4L8CB 4N0UA 3QWOB 5FB8B 2PO6D 3UAJD 5ILTH 1EXUB 2H41A 3S7GA 4ZFOL 3NCYS 4CNIA 2D0GA 3BIKA 2GY5A 3JWOL 1U92A 1IGJA 2EIZA 3V6ZA 2KQNA 4ISVA 4QRPD 3TH4T 4M1DH 2X7LB 1LP9E 1FYTA 2XTJC 4P2QA 1BF2A 5ERWA 5FYKE 5ITFB 3TN0C 15C8L 3E2HC 3I2CL 5LGHL 3UTTA 1PLGH 4S1RH 3VMNA 4W4OC 1IAKA 2VZUA 3C6LC 4GW5A 5DT1H 3OXSA 3SKOB 4NCDA 3B6SB 3QDAA 3MV8A 2CJUL 4FMKA 4QTHA 3RWCB 3H7BB 1O7VA 5KSBA 5JHDE 4FN0A 4YDLC 1P84J 3JV0A 5IBLC 5IHBA 4D9QE 1R3IH 1WZ1H 4OCRL 2VLLA 5DJZB 1NAMH 3CLFL 4IRZL 2BNQD 3ZKQD 4C4KO 3QIUA 1S7SA 4JVWA 3ARGA 2JJTC 3O4OC 3UZQA 4YLQT 1CS6A 5DUPL 4DWHA 1DSFH 3ET9F 2BY3A 4GJTB 4JO2H 4PRNB 2EYTB 2FD6H 1FNEA 5C3LD 1RZJH 1OCWL 4Y4FB 5C6TH 4HLZH 3UTSA 1K2DB 3RVUC 4Z6AT 4R8WH 2ZOKB 4D9LH 4YHOH 4TN9A 3QPQD 5JIPA 5IROC 3MZTA 1JZ7A 4OBSA 4ZUVB 3QXDB 3DUHA 1NEZB 3X14A 2DM7A 3U0PA 4PLKC 1UJ3A 3C6SB 5TJWK 3PG2A 3T1FA 5CGMA 5EZJB 4PPTA 5L2KE 2XRAL 2APFA 3GMMA 2HJKA 2A9ML 2FH8A 3RDTD 2GUOA 5KAQF 3OKKB 5FKPA 2VXQH 3DYPA 1N4XL 3HB3D 3ARZA 1NC4B 1JNLH 5D1QB 1JGEB 4JM4L 1Q9OB 3D9AH 5FKPB 5TQ0L 4J6RH 3LQZB 4YHIA 3A6BL 1C7TA 2VXSH 3VXMD 4YHLH 2NZ9C 2JF1A 4CL7A 4HKXA 1S3KL 4JB9H 4ZQKB 5JQ6L 5L2JA 4J4PD 5GS3A 4FP8H 4Z7VB 5F9OH 1A7PL 1FGNH 4KKLC 3KHOA 4LCWE 1KPUA 1I1FB 4KRPD 1QO3B 1G7QB 3ARUA 5AYUH 6FABL 3MUY1 3O6MH 5GJSH 3MO1A 1U8PB 3ZSSA 1IAKB 1GAFL 2YD5A 5SX4H 3RVVC 4K23L 4QWWC 3T4YB 5JOPE 1B2WL 4IRSB 1XGPB 2XICA 5I17B 3S88L 1FRGH 4ZAKB 1WCQA 3QDJE 5TE4L 4QY8B 1G84A 1IM9B 1YMMD 3CIQA 3PUCA 3BKJL 4NO0B 5EZJA 2IGFH 1RULL 1AE6L 1U58B 4G6FD 3SKMB 3REWB 3QWOA 5I8KL 4JB9L 3TO4A 3M17A 3Q5OA 3ARVA 3OKEA 2J7LA 2VABA 2FR4A 3HS0B 1R0AH 4KHXH 2HVJA 1I3GH 1FN4A 2CLVB 1CICC 3CX5K 3KLHD 3OR6A 3HHRB 3SJVA 2X7LA 4LVNC 3N1GC 5DXWA 5HI5D 1IZJA 1MHCA 3MRPB 4OCYH 2B4CH 1LNUA 1HYRC 1QHPA 3GMLB 4RGOH 5F70A 2AVGA 4A6YA 4HZLA 2VXTL 2NYYC 4Z0XA 4U1IA 5TDNA 4UT6H 4NRZA 5J12B 4MAYA 3RBSA 1X9QA 5JXED 5BOPA 5KZCD 4PJGF 1KXTB 4GW4A 3T2OA 4APQD 2YPVL 3I6KB 4WUUB 3VGHA 2J6EH 3MC0A 5K9KA 1JP5A 4UT7L 5KSAC 4B53A 4N0CD 4Q6IA 4YHKH 4Z7UB 2V17H 2WANA 3ZSTA 5D5MB 2OTWA 2ZUUA 3D39D 5L7XH 4GBXC 1INDL 1U36A 1J1PH 4LKXA 1J10A 1IGCH 3C8DA 4M6OL 5IFJA 4LSQH 1BJ1H 3U36A 3JWDL 2BXZA 5E8OA 1EHAA 4LKXB 1T7WA 1YDPA 4G43B 1AD0B 1D9KA 4FXGA 4L4TD 1IEHA 4JQXC 1J1XL 2CO7B 2WWMC 4LEOB 5I8OH 3MODH 2HFEA 3TVMB 1PQZA 4H0HB 4OZGA 4S10A 5ALCH 1F58L 1DQLL 2FX9L 4P99A 1JF1B 2X4QA 2OS7A 2YWYA 1UM5L 1ZT1A 4XNYH 2P46B 3G6JF 4JRYD 1QRNB 2XA8H 1JGUL 5HGDB 2VR5A 1JNLL 3RNQB 4L4VD 2RCSH 3M8OH 2FX8L 1OB1A 2AS5M 1MCPH 4CU8A 1RZKC 3IDXH 1IGYA 4OQTL 4BZYA 3OAUH 2Z4QA 2WUBH 3QDHA 3RFZC 1CE1H 3WDJA 1I8MB 1HZHH 5J6HA 5CSBA 3W9DA 4PJ5A 4AENA 1ZLUH 2H2SD 2BCKA 1G7PB 3QFDA 1HILA 2NR6C 2NZIA 1R0AL 4CVWA 1BOGB 4YWGH 5FYLH 5K59F 1YNLL 1L0XA 4XWOD 5C08E 3ZKXB 2H6PA 3IB4A 1NUDA 3K0WA 1VEMA 3QQ9C 5CINH 1KB9K 4R8WL 4M8QB 4DEPC 1ULVA 5E8EA 1TZGH 3LIZL 4XCNA 5DD3H 4LLDB 1ZK9A 4HIJB 1OP5K 4RX4A 5FFLA 1QO3A 4JFXA 1NBVH 1F5WA 4NKQB 2DMKA 3BDYL 1MPAL 5DUBB 1WT5A 3QXTA 3S8WA 1I85A 4UV4L 1K6QL 5I1IH 2VL5A 1PSKH 3EJJX 1QACA 2J8UE 5AYUL 4PY7A 5IQ7H 5DUMH 5H94B 4Y5YB 9CGTA 5T3XH 1F4XL 1VFOA 3IXAA 2XA3A 1WWWX 2OM5A 5IIEB 4JZJC 4K3HA 1UEYA 1DBJH 4NO3B 3QEUB 1UB6B 2KUTA 4F58H 1MPAH 2NY3B 3A6BH 1CLZH 1OP3H 1Q72H 3HS0A 4KKBD 1HHJA 4JREB 1SHMA 2XWBB 4ERSL 2ZCHL 2IPUK 1I1YB 4NKIH 5E9DD 1DFBL 2YRPA