4LVNC

Crystal structure of pfsub1-prodomain-nimp.m7 fab complex
Total Genus 43
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
43
sequence length
220
structure length
216
Chain Sequence
QVQLQESGPDLVKPSSSLKLTCTTTGYSISSGYSWHWIRQEPGKSLEWMGYIHYSGSTDYNDSLKARITITRDTASNMFFLQLSSVTSDDTAVYYCVIYRYDGQWVFDDWGAGTTVTVSSAKTTPPSVFPLAPGSNSMVTLGCLVKGYFPEPVTVTWNSGSLSSGVHTFPGVLQSGLYTLSSSVTVPSSPWPSETVTCNVAHPASSTKVDKKIVPR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase/inhibitor/immune system
molecule keywords Subtilisin-like serine protease
publication title The malaria parasite egress protease SUB1 is a calcium-dependent redox switch subtilisin.
pubmed doi rcsb
source organism Plasmodium falciparum
total genus 43
structure length 216
sequence length 220
ec nomenclature
pdb deposition date 2013-07-26
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4lvnC02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4lvnC01
1U8KA 4N1HB 5F1NA 4EI6A 1NQBA 5IBTL 4YGAB 1DE4A 3ARBA 3QYCA 1S7WB 3MBED 3CFDA 5BW7A 4OGXH 1U8QA 4MHHG 1GIGL 1V3MA 4WFFD 4ZTPH 3OJ2C 4Q6IA 5SWQB 3RWFA 3MXVL 4KI5D 1NGXB 1KLFA 2BP3A 4GW5B 4YE4L 1UWGH 4FRWA 4Y16C 4UOW0 1LEKA 4I0PA 5KOVC 5HI5C 5IW3A 1FQ9C 3RGVB 2OI9B 5DHYB 3QO1B 3K0WA 5C3LD 3EOBB 2XZAL 3QXWA 5CJ8A 1Z6JT 4B5EA 2ZKHH 2DQCL 4NQVB 5CWSB 3IETA 2AXFB 3TEUA 2HG5A 4YQXL 3FQWA 1GGBL 1ONQB 2ZSWA 2DS4A 3BPLC 3PWPD 4WEMB 2QHRH 2V17L 3TVMC 2YSSA 4XNYL 1TNNA 1UJ3B 2QHLA 5J7CC 2BVOA 4M6AA 5EU4A 3IDGB 3CU1A 4LIQL 4BSJA 3IU3B 3GK8H 3U4BH 2IAND 1T4KA 4Z7UA 4HW6A 2IPKA 4MCZB 4PGZA 1EAJA 2DL9A 3WFCH 2F58L 5DUMH 1JZ8A 5IW6B 1NDGA 3LS5L 1AE6H 4MXWL 2VLKE 4XPBH 1P7QB 3ZKSD 2D4FA 1P4IL 2LVCA 4N0YL 2GHWB 4RRPG 3BUTA 5DO2C 2N7AA 5HDBE 1DR9A 1ZE3C 1NAMA 1DLHA 4KKCD 2X9WA 5EWIH 4OCYH 4LSQH 3BAEH 2G5RA 2XY1A 3T8XB 2E6QA 1CR9H 3LQAH 3P9MB 4X7EC 3HR6A 2XFXB 2BHUA 1R5VA 2P42B 5D1ZD 2ENYA 2ZP0T 5L8KB 5F1IA 2OP4L 3DSNA 4N9GA 3QSKB 2GI7A 4GS7C 3QZWA 4G6FB 4DGIH 2H9GA 2A6JA 4X98A 4WUUB 3B2VL 2ICEB 4JB9H 5EPMA 3VW3L 4TQEL 4M7KH 1A6VH 1GCFA 5IQ9A 3MCLH 5CEZH 3VDAA 4LSSL 1UXWA 5DJ8B 1A47A 1DBJH 4GRWH 2EDJA 1MY7A 1QHPA 4LSRL 1NPUA 4D0CB 2CMRH 1F6FB 1ZVSA 4UDTB 5B21A 2ERJC 1RURH 3S3PA 3ZHKA 3B83A 4Y4FB 2HJLB 1T5XA 1U8NA 5F88B 1CFVH 2EEBA 3GMRB 3PQYA 1LQSR 4GKZB 4N0CC 4JZNB 5FDWB 1AGBB 4WI7A 7CGTA 4CMHB 4LPTA 4MQSB 3H7BA 2FYYA 4C57C 1RZKC 3CMGA 3OJDA 5E6YA 5D5MA 1J12A 1JGVL 2W07A 4HWBA 2FJFA 4MJIE 3THML 3F6IA 3EHBC 5F3HA 4BH8B 1EZVX 4HUXB 3ULUC 5JNYA 1QRND 2DBJA 4K3EL 5DWUH 1K9TA 1OM3L 2IADA 4K3DH 5EO1A 1G9MC 3TN0D 2QADB 4LLMB 4XP5H 4PP2A 1CE6B 2QKIB 1NUDA 2A74A 1V5JA 4JFZL 3X3GL 3IFLL 5CZKA 3RFZC 4JPVH 1PAMA 5I2IB 4F57H 5C2UB 2B4CL 2Q6WB 5KSAC 5L9DH 1KACB 4PJ8A 2OL3H 3RP1A 3RUGA 1RAMA 3VI4F 1M7DB 4LLUB 5IEKA 3WO3B 4ZSOA 2MNUA 3B5TA 4NQUA 2KL6A 3I02B 3QUMH 4TUOA 4O2EB 1T6VN 3L95A 3MRDB 3ZSTA 2EDKA 2CDEB 4FXLA 4X4XB 2NTSP 1FYHB 1F4XL 4Z8FL 4N1EA 1BLNA 1L7IH 5SWSA 2OSLB 4J3XA 4V1DE 2NX5B 3WNLA 2DF3A 4XAKE 3CD4A 4PJGE 4ZQKA 5SWZB 4AEEA 1LNUA 2KPNA 1MLBA 3R06A 4NM8H 2OBGA 2F54A 1FNEA 3O6KL 3OXSB 1YECL 3FO0H 1FL5B 4U1GB 2R29L 3RAJH 5DLMH 1I7RA 5LCVL 2H45A 1ULVA 4WI8A 4R3SA 1BOYA 1OGTA 3D25A 2PXYB 1NBZB 2NY4C 4POUB 2IFGA 3S5LB 1JUFB 3EDKA 1GZQA 4Y16B 4UTBL 5KZCB 3IAQA 3LRSA 3QDMB 2J8UE 4FZEL 3IXAA 4LCCA 3IDJA 3MRPB 2XIDA 4MCYB 5I8EB 3AVEA 1NEUA 1ZTXL 3LKNB 3OWEA 4X6CB 4WO4A 4XBGB 3I6GB 3S96B 4YHOL 1BZQK 2A83A 2XQYK 3CDCA 4X9GA 1XF4B 2HFGL 2PTUA 3L3HB 1I85C 4WUKH 3VFWB 1JWUA 3CSBA 3HC4L 1YEFH 4PJCB 3MRIB 3I2CL 1SYVB 1G0DA 3VMOA 1C1EL 5EZIH 2D2OA 4H26A 2EE3A 3O9WA 4NO0B 5I1JH 2W9DL 4LLQB 4JY6A 1X5YA 4PJEB 1IQDB 4YZFE 3WFHB 2DQIL 4JY5H 1R3KA 5HVFB 2DWDA 3VGEA 4KKNA 4X8XA 3GSQB 3MJ6A 3WSQH 4TN9A 3QNZB 2DQHL 3MOAL 3TWCH 1W2KT 3L6FB 5L8JB 4AT6B 2P8PB 5JHDB 4X0KB 2WUBH 2P1YA 4QRSA 1I8IA 1QPPA 4M1DL 2VE6A 5K9OA 3VXUB 1MRCH 2VH5H 3TYGL 4X7CC 3B6SA 4P4KD 2RBLA 4WWKA 4GKNB 4ESKA 3MROA 3ES6B 1J1PL 3MRHB 1KB5B 1S9YA 4JHWH 2Q20A 1EHLL 3C5JA 3U6RB 4PGBB 3V0VA 1T5WB 4AEFA 3V8CA 3H42H 4EN3D 4GS7B 1XIWD 4N8VG 4I9WE 1KIRA 4I4WA 5F1NB 4ZD3H 3L3DA 4PLJC 1FRGL 4EI6B 1Q9OA 1QSFE 2CK0L 1DE4B 1KGCE 4AIOA 1UCTA 1U8QB 3S8WA 1OB1A 4LCWD 4RGOL 1U95A 2FLBT 4KXZH 1I1AA 3RWFB 1F2XK 1ADQL 1MWAL 1CLZL 4YWGH 3IAGC 1LEKB 1T0NA 4I0PB 5J3HD 4P99A 3KYKH 1SJEA 3VFTB 1NLBH 2XOTA 1AH1A 2P24A 3WXVL 1I1YB 1H3XA 5MEND 5FUZL 3WD5L 1FO0L 1MCLA 2P48B 3IETB 4ZNEA 5B39A 4ORZC 4ACPA 2NLJA 3VXQA 5D2LA 4LKXA 3EJZD 2ED7A 4I3SL 4CN1A 3HRPA 4M7JL 3HCVA 1CI5A 3PDOA 2BVOB 5ESAA 5EU4B 4L3EA 4X9HA 4OCWL 5F72S 2VXSL 4Z7QE 1T4KB 1C5CL 1MCKA 4KI1A 5FF6A 2IPKB 4LGSB 1S5IH 1CZ8L 1VSCA 5EORL 2VDKH 2CUHA 4QCIB 1NDGB 5BXFA 2DWEB 5B38G 3LKSA 5KSAB 4XVJH 2DQFA 2E8ZA 3VXRE 2JF1A 5I1IH 4G8GE 4LARH 3TO4D 3NMEA 5T5NG 5I8KL 2CKBL 1HQ4A 2BX5A 4FTVE 1JPSH 3TIDB 4UV7H 3MUGA 1LP9F 1BFVH 3BKCL 1DLHB 1PKQB 4JFEE 4D94A 4KWUA 1AD0A 3PWJA 3RU8H 4IMLA 2H26B 1HKFA 3FZUC 3W11D 4FFWD 1R5VB 5LWYH 3QDGA 1HWGB 1P5VA 3EFFB 3S4SA 3UZEA 5GS2D 4OAWA 5F1IB 4DAGL 4RGNE 4N9GB 2BSTA 3CH8A 3HA0A 1QA9B 2A6JB 4X98B 3VRIA 1M1SA 5EPMB 1A6AA 1K4CB 1QFUL 4RMSA 1JVKA 2FWOB 1UXWB 3MRBA 2HMIC 1LO0H 3MOQA 5C70A 2EEAA 4KVCH 4NZJA 3BYYA 1BVLA 1LE9A 1F4WH 1ZVSB 2EDLA 1IAIL 2E7MA 4EQ2A 4D3CH 1I3VA 3X12A 1H8OA 3DYOA 4OLXL 1T5XB 4XI5C 1U8NB 4RIRB 1BVKB 4ZPVA 2B1AH 3EZJB 3PQYB 1BJ1H 4K07A 5FYKE 3BN9D 1MCNA 1CBVL 2BC4B 3H7BB 2FYYB 2Z8WC 4NNPL 3OJDB 4FQ2H 4NBXB 2EXYD 2WWKT 5IVXA 4UB0H 4O00A 5CSZA 4YX2H 2FJFB 5F3HB 1ZK9A 5JNYB 8CGTA 5HVHB 1CICA 3O4OC 4PP2B 4AK1A 4GAFB 1KYOJ 3EFDL 5K59E 2XI9A 4M5YH 1I3GL 3SQOL 5T3ZE 4Y4HA 2CIKA 4UUJA 1LK3L 4RMWA 5HGBA 5FKPA 3TCLB 2NY7L 2UZXB 1PSKH 1R3IH 3SE9H 3HB3D 4YPGB 1OAKL 2AW2A 4PJ8B 3RUGB 1OPGH 4Q2ZB 4L3CA 3MLRH 4OF0A 4ZSOB 3ARED 2OK0L 1WFNA 4TUOB 1DUYA 4G6FD 1U8MA 3L95B 1QSED 2V5RA 3R1GH 2NCMA 4U1SA 4DN4L 2CRZA 4MAUL 3CFBA 5H8DA 3CFCL 3D87B 4ZQKB 1LNUB 1MLBB 3HAEG 5AUMB 2F54B 1FNEB 3VFPB 4JM4L 4U6YB 1M7IA 1HHGB 1X5JA 3D18A 3AB0C 4G9FA 1GGYA 1I7RB 4EJ1C 4M6NL 4R3SB 1KN2L 4ZNCD 1EV2E 1BMGA 3C8KB 4Y4FD 3EYFA 3BH9A 5DTFA 1J88A 1KIUA 1GZQB 1UYWL 3LRSB 2IALA 2QL1A 4JRYA 3IXAB 4HXBH 3IDJB 4IRSA 1I1CA 5GZND 3E6FA 1S9XA 4O2FA 1SEBA 3N9GH 1G7LA 2VAAA 3U9UA 5JW3L 3UJTL 5EFIA 4FG6C 3G6JF 4JN2A 2A83B 2CJUL 3PABA 1MRFL 4PRNA 2IWGA 3KJ6H 3KYAA 3S36X 1ZHLA 5B8CC 3QI9D 2C3VA 4LLWA 3BKJH 3S34L 3NN8B 4PJ7E 1W0YT 1J0KA 3OAZH 4P5TC 4PJHF 3MYJB 4H26B 5E94A 1H5BA 4QHNA 2VQTA 4FQLH 2GCYA 3WIIL 3B5HA 5T1KA 4OLWH 4NP4L 2EECA 3CVHH 3FT4A 2HA1A 4GOSA 1R3KB 3VA6A 4AL8L 4M02A 2DWDB 4QOKB 4L8CA 2AJYH 1J05A 1IGJA 3QPXH 1MIML 4HFUH 3H3KA 3X11A 5F7UA 4PJXB 4KZDH 1EEYA 3SDAD 4FABH 4YHYB 2XNAB 3B9VA 4ZUSB 3VWJD 4QRSB 1I8IB 3B9KC 4J6RH 1N5YH 5K9OB 4RMQA 1LEIA 3HZVA 3VXTA 5EIQA 1D5MA 1AQDB 1BZ7B 1NMAH 5EO9A 4IS6A 4ZFZA 2MCPH 3NIGE 2VDNL 2Q3ZA 4OKVB 4OZIE 2C4XA 2YKLH 1BGXL 4F33B 1A1OA 1GH7A 1TTFA 2XQYG 1S9YB 3PP4H 1CYGA 3CFIC 1U36A 1JZ4A 3C5JB 4FQXA 3QWQB 4JFDA 2UVEA 2VDQH 2PXYD 2ADFL 2R2HB 2FECI 5D7IF 4EDXA 1A8JH 1KIRB 3ME0A 1Q8MA 4I4WB 2E7LA 4MA7H 4X80L 3L3DB 1Q9OB 2EZ0D 2ZUTA 3H7LA 3P9WB 3KLDA 2D9CA 1IFHL 2CPCA 4P9HH 4E5XB 1OB1B 5DK0A 2X2YA 1D7FA 5E2TL 1I1AB 1MSPA 3FN9A 2J88L 2O5ZL 5GSVB 3GHEH 3U30B 1RSFA 1J0YA 1HZHH 2Y06H 2JE8A 1TETL 1SJEB 3PL6D 2VXQL 4NQEA 3ARDC 4YBHA 3CUPA 2P24B 1OGAE 3QDJB 5GRZA 4F7PA 2LAGB 4JFYA 1RHFA 4ZXBC 2EDNA 4PY7A 1WTLA 5B39B 3VXQB 3ZHLA 2OTUB 5DVOA 5D2LB 4HQQL 3O3UN 4LKXB 1XF2A 4P49A 1PBYA 3VFMA 3SOBL 1A6WL 4XC3H 1I7UB 3HCVB 3PDOB 1YUHA 4HCRL 3BPCA 4L3EB 1I8KB 2NW2A 2CDGA 1NC2D 4C58B 1LO3H 5FF6B 1K5NA 1OP5H 2WM0A 4FXGA 1FP5A 3HTLX 5ESQA 5D7LA 4YDKL 1YPZA 3FO9A 1KC5L 3LKSB 2QSQA 1RJYA 3ALXA 3WNMA 1XGQB 3FMGH 5GS1C 1PX4A 1HQ4B 4ZOBA 1U8HA 1YMME 3WHE0 3NFNA 3D85D 3MUGB 1L0XA 2RB8A 5IQ7H 3FRUA 1CGUA 1HDMB 4RFEB 2HT2C 2V2WA 5HHPA 4U05A 1YN7A 4IMLB 4R4BA 4PYGA 3ARBD 4QNPF 1NAKL 1W8OA 2VR5A 3G08A 4U1KA 1A2YA 3QDGB 3LIZH 3S4SB 4OZFG 3MLVL 4G8FA 3F12A 1RUKL 2NY5C 3AB0B 5I15L 4PRIB 2HFEB 2BSTB 4OFDA 4I18C 1CK0L 3VRIB 4DW2H 5HPMA 1WBXB 2LE9A 4FHBD 1A6AB 5CEXA 1F58L 4NKMA 4WEUD 4C4KT 5FA3A 4QTHA 3L7FA 1R0AL 4MNGB 3PWVA 5F89A 1PX3A 3ARTA 4EI5C 1TQCB 1BOGB 1BVLB 1LE9B 4R6UA 4AM0A 3X12B 4KTYA 4MB5A 5T1LD 3QUZD 4XRCA 1A9EA 3BP5A 5F1KC 5HGHA 4UT9L 4MXQD 4OKDA 5FGCE 5B8CB 4MWFA 5LGJA 3GJFA 4PLNC 1U2CA 3QXVA 2BNUB 4GG6A 3VH8G 4LVOC 3HRZA 1NBVH 3VDCA 1A4JA 4P3CH 3F6LA 1HILA 1DQMH 3OTTA 5GGQL 4OTXH 3CH1B 4JG0L 4C83B 3QUKB 1J11A 1KCSL 5JZ7C 2O5XH 4G9DA 1TENA 2CGRH 4UOW1 1CICB 3B2UC 1P84J 3ZKMC 3MFFB 1MFBL 4Z0XA 3PGCA 5GGUA 2C7UA 1KTDB 4Y4HB 4LU5H 1BBJB 4UUJB 3ZDXF 1KXTB 3MGOA 4F3FA 5FKPB 3IYLW 4XBPA 4HUKB 4BUHA 2HFFA 3JSSA 2VZVA 4OM1H 1O5DT 3OHXA 4ZTPL 1AXIB 4L3CB 1X5GA 3NCYS 4JJ5A 5F8RC 1T1ZA 2EDQA 3HZMA 5F9DC 1G0YR 1UWGL 2C3WA 3QIUA 1DUYB 1U8MB 5DGRA 2FL5A 4GRWF 1WVZA 3RPIB 4LVHC 1H0DA 2AEQH 1REIA 3GIZH 3CFBB 4HAFA 4N90E 2ZKHL 3J7HA 4PR5A 3S35X 4F9LC 2ARJQ 3BW9B 4BELD 3NA4A 4XMLL 4YXKH 3ZE0E 1VDGA 3P11H 3AMLA 1ZEAH 3ARVA 5CUSL 2VDPL 2PYEA 4W81A 2GW5A 1QLFA 4WWID 4Y19A 2HTLD 3HE6C 3MSPA 4LAJH 2VLRA 2QHRL 3I84A 2XZCL 5EULV 2JJVA 4TOYH 3EYFB 3BH9B 5DTFB 5JW4N 3ULVE 1GXEA 1NUGA 2D31B 1TFHA 3MX0A 3A6OA 3ZTJH 1H3PH 3PQYD 2IALB 3GK8L 2FO4A 1FNFA 4JRYB 3U4BL 4CDGC 2UWEF 4IIQC 1FC1A 3DRTA 4IRSB 3ARDB 4KTDH 2GFBB 4LOUD 3E6FB 3PE9A 1BQSA 4O2FB 3T2OA 5ALCH 2NR6C 5DUML 2YD1A 1XGTB 3LKRA 4MXVF 2DQUH 3ELAT 3JWDH 4JN2B 3SDXE 4H8WC 4GUPB 3TM6A 4XPBL 3PABB 5ICZA 4PRNB 5IFAH 1ZHLB 4JJHA 2WBJA 5DHVH 2C3VB 3OAZK 4LLWB 4WRLA 3O3DA 5F3BA 1CTNA 3P2TA 5EWIL 1OLZA 4OCYL 2C1PA 3VI3E 5E94B 5GSRA 5KG9A 3C5ZA 4M7LT 1CFNB 1H5BB 4QHNB 3SBWA 5D7JC 1ZOXA 2GCYB 5IFHH 1CR9L 5T1KB 5EBGA 3LQAL 4M1GH 4QRPE 1QBBA 3FT4B 3K2MC 3PJSA 3GMMA 1QSFD 2LU7A 1IGJB 1MVUA 3HC3L 3X11B 5E2UH 5HGGS 2KQMA 1EEYB 4DGIL 2YXFA 5D9SA 5LJYH 2DLFH 4P2YA 1EUTA 1FGVH 1XGPA 4JB9L 1CF8H 4RGMC 5SWSD 2P5WE 2NY6C 4M7KL 4U1JA 3MCLL 4X5XA 3RL1A 2Y9RT 1LEIB 3HZVB 3PUCA 2Q8BL 4OZGF 3VXTB 5CEZL 1D5MB 1DBJL 1SY6A 1VCAA 4IS6B 4ZFZB 5C0DA 3WIHA 4JY4A 4HS3A 3D6GA 4APQC 2CMRL 4H25A 4Q9BA 4GKSA 3WCYA 1RURL 1X5XA 4FQXB 1A1NA 1YEGH 4JFDB 1EIBA 1A6UH 1HWHB 1NFKA 1IEAB 4K71B 1JHKL 1JK8A 1IAMA 4I18B 4ODUB 4WUUE 2R1WA 2PF6A 3RNKB 4LPWA 2ITCA 1T20A 3MGTA 3BP7A 4GQ9H 1RJLA 2WMPA 4W4OC 3TFKC 2QQLH 1T7WA 4WO4D 5DK0B 4BK5A 1E28B 3FB5A 1A7QH 4GAYB 3IDYC 5DWUL 4K3DL 1ZMYA 4PJFA 5IG7A 1NUNB 4XP5L 2JB5H 4N68A 3P40A 2Z31D 4OI8A 5JIIA 2JIXA 4G8GD 4NQEB 3CUPB 4JPVL 2NY2D 3H9YA 5D70H 3REWA 1RUPH 1U0QA 4F7PB 4F57L 1AIFA 4QRRA 1OSPH 4PG2C 1D5IH 4LVOB 3O9WD 4PY7B 4BSWA 5C0AB 5L9DL 2YK1L 4WTZG 5KAQF 1YMHA 3GSUB 1XF2B 1GGTA 5KS9B 3OV6A 3NOIA 3KGRA 3MV8E 3QUML 5DEGA 2ZOLA 4LGPB 5IMMA 5C09A 3BPCB 3BUYA 3SGKC 1Q0XH 1UM5L 3RZWA 1OP5K 3FQUA 2CDGB 3C5ZC 5KVGH 1R6VA 3BQUC 1S7VA 1K5NB 4ETYA 4FXGB 1CDYA 4WWKD 3F7RA 3QFJA 5ESQB 1P4LB 5D7LB 1RD6A 1BFSA 3FO0L 1FFNA 3FO9B 4JRXE 5K33A 4MQXD 5DLML 1NGYA 5EBLB 1T2JA 3MBXH 3WFDH 1H3VA 4Z7WF 3T0AA 3K4ZA 4YFDB 5DD3H 2EH8L 4ZUTA 1S7SA 2EE9A 2HH0H 3NFNB 3UYRH 3GM8A 3FRUB 4ZODA 1YN7B 2NX5E 3HNVH 4R4BB 3FCTB 5JMOC 3MREB 5SWZE 1C5DA 5FYKD 3G08B 4U1KB 1A2YB 4CUCA 4M6OH 2ADGA 1HH6A 1XCTB 4G8FB 3F12B 3Q3GA 5I71C 4ELMF 1F4AA 4JM2D 3HE6B 1BM3L 1S9WA 3SE4A 4QYOB 1WITA 5HPMB 1YEFL 3IDXH 4HIEA 1J0IA 4QEGA 5TH2A 5CEXB 5FA3B 4YK4B 3L7FB 1IGTA 4IIQB 3RIFK 5I1JL 4FQIH 5HI3C 4S2SB 1N64H 5T3ZD 4JY5L 1CLOH 5JUEL 2QLVB 4RDQF 1T89A 1HCVA 4PJIF 3EYSH 3WSQL 1OY3B 4KROB 3C60A 1DBKH 1UB5A 4M1CC 3TWCL 4PGDA 5KTEH 4XRCB 1W72H 1A9EB 5HGHB 5TJWK 4LNVA 2WP3O 3FOLA 4WTXA 1OTTD 5KBNC 4L3ED 2WUBL 4MWFB 2GITA 4JO4H 5HHOA 5GS0C 5LGJB 3GJFB 1IAOB 2DKUA 4GG6B 4PJCE 2VH5L 5FIEA 1Q0YL 3HRZB 3HPJB 1Q72H 3LQZB 5F21B 5I76A 1YC8A 4U1IA 1HILB 4S1QH 4PJEE 4FS0A 5D7JB 1KELH 2BDNH 2NXZB 2JCCA 4L4TA 1G7HA 4DVBB 2MMXA 3VXSE 4G9DB 1P7HL 4JHWL 1ZXQA 5TFSH 2J4WH 2ZPKL 1KCVH 2DMCA 4Z0XB 3PGCB 3H42L 4M00A 5GGUB 3VJ6A 3ZE2E 1N7MH 2C7UB 4RAUA 3MGOB 2W92A 2WQ8A 3I9GL 5AYQA 5KVFH 4HIXH 4RGMB 3VXUE 1NEZG 4XBPB 2NY6B 3BFOA 2NXYC 2R4SL 1QR4A 3OHXB 4X7DC 3RL2B 3QQ3A 4J3SA 1KV3A 3DWTA 4RA0C 4CNIA 5CJXA 2AJUH 4JJ5B 3HZMB 3MOBH 3QIUB 4YWGL 4NNXA 1NKRA 5F97E 5I75B 5E2VH 2BZDA 1FBIL 4PV8B 2FL5B 3VFRA 1NLBL 4DUXA 1HINH 1J0JA 1NDMB 1H0DB 4EDWL 4U1NA 5FGBC 5I19H 3GO1H 1F3DJ 2BOBA 4ZS6D 4CU8A 3NCCB 4KU1A 5BO1L 2CD0A 4JDZA 2PYEB 2MSPA 1NGQL 1QLFB 2IMMA 2X9YA 3TBYA 5IV2B 4PJBE 3S3JA 1Y18A 3DTXA 1I7ZA 5FOJA 4P46C 2Q3AA 3IDYB 1CVRA 4BQCA 2IBZX 1B4JL 1KLGA 3RZCC 3ZKXC 1CE1H 3ILQC 3DRTB 1E4XH 2MQCA 1P53A 1S5IL 2VDRH 4PJAA 1FFOA 1INEH 2VDKL 1VGEL 2W60A 3LKRB 4PBXA 1AO7A 4XVJL 1D5ZB 5I1IL 4LARL 4DZBA 1ORQB 1YY8B 1UVQA 1T21B 4YDJB 4Z95H 1T0PB 2WLYA 4HGWA 5HDBF 3ULUE 3EOTL 1JPSL 3QDAA 2WBJB 4Z7OE 3O3DB 1U3JA 4UV7L 1U3ZA 1I8LA 4XPTH 1BFVL 5EUOA 3DUSA 2N4IA 5TQ2H 2C1PB 3RU8L 5KG9B 3C5ZB 3MRRA 3V6BR 4HG4J 2IF7A 4EUPH 2VRAA 1DCLA 3B9AA 4NWUH 3H9HA 3PJSB 2X4NB 5H35B 5TGBA 5GGTH 1MVUB 2YC1A 4Z77A 4U3XA 4NKOA 3RI5K 3BKYH 4TNVK 2CH8A 2FRGP 4YO0A 5D9SB 5HD8D 2OTWA 3BIBX 1J8HE 1XGPB 3EOYG 5K9JH 5ESVA 3DVNA 1VACA 4JPIA 4U1JB 1PKQE 4X5XB 1IKFL 2D7NA 4I0KA 3RL1B 5MERA 4PB9H 3G5VB 5K9KA 2BY1A 5C0DB 4Y4KC 4JY4B 1EGJH 1FH5H 2VQUA 1OGAD 5HHVH 4G9FD 4H25B 2X44D 1F4WL 4D3CL 5DRZA 5CLTA 1A1NB 1CGSH 3S37X 2F53B 1JK8B 4MAYA 2B1AL 2R1WB 1WZ1H 5E2JA 4P2RA 8FABA 5I30H 2X4PA 5A1AA 1YEDA 2ITCB 5F1SA 3GRWH 1T20B 4KMTH 3EYQD 3BP7B 3MGTB 2A1WH 3CVIH 4FQ2L 2H2PC 2EIEA 4O4YH 4UB0L 4GRLC 2GT9A 4YX2L 3OJMB 3FB5B 5BVPH 3HI1A 5E6ID 4JKPH 2JJTA 1WQVT 4U4BA 5IG7B 4FQCH 4PJFB 1NSNH 1HHIA 1PY4A 5T5FH 3GBMH 5FHBH 2QR0A 4OSUH 1R3JA 2VXUH 2ZUYA 4FP8H 4NQXB 4PJ9C 3BP4A 5CS7A 1PSKL 1M4KA 1R3IL 4ZMAT 5AWNL 2DAVA 1AIFB 4QRRB 3SE9L 1X4YA 1YMMD 4BSWB 1PDKA 1KJ2L 2OJEB 1OPGL 4HXAH 3SGJC 5HYSA 1CT8A 4JR9H 1I7TA 2ZOLB 1I8LC 4L8BA 3R1GL 2DQEH 3NFSH 4A6YB 3Q5OA 2I9LA 4WW2A 3LQMA 4DQOH 5BV7H 1NFDA 4OV6F 3FQUB 4D0BA 1KPUA 3AROA 1FZOB 5J8OA 4FN0A 1GOFA 3IDUA 4DEPC 4I13B 4E41A 3QFJB 3TT1H 1PYWA 1MUJA 1T6WA 4M4PA 3UEZA 3E8UH 3ECBB 2CR6A 1FFNB 2NXYB 2OXGA 4C54A 2EH7H 1NGYB 4L4VE 4ZSOE 4WFGD 3U7WH 1NCDH 4NQDA 5IBLD 1S7SB 4FQXD 4L8SA 4Y8DC 3ARFA 3WNNA 4HG4K 3QHZH 4XXCC 4TVPE 3W0WE 4HXBL 1QKZH 4KJQC 4AY0A 2GJJA 2IFFH 1A6ZA 2ID5A 3PGDA 3DO7A 3FT3B 1C5DB 2G75A 4PRPE 3BO8A 3DX9A 2ADGB 4MD5A 1HH6B 3Q3GB 4FXKB 5JOPE 2XG4A 2CLVB 4HD9A 3H9ZA 3KJ6L 1FHGA 3T1FA 3MRLA 1S9WB 4JKKA 2OZ4H 3OGCA 4OGZA 3S3SA 3KLHD 3BKJL 4OIAA 4JVUA 3WNOA 1BF8A 2FX8H 4HIEB 5F7YC 3ZKXB 1EEZA 4L5FH 4FQLL 2YUWA 4KJWC 4OLWL 2PTTA 4KGLA 4YZFF 1EO7A 5BZWA 4AQOA 1A6TB 3CVHL 3UTZA 3GBLA 2DLIA 3QPXL 2COQA 4HFUL 3LVEA 1UB5B 3HG1A 3KNBA 3P0YL 4PGDB 5ITBH 4KRPD 4W6YB 1DEDA 4WIQA 4FABL 5DVNA 2B20A 4K23H 4S1SH 3FOLB 5D96C 4NUGH 5HHOB 2P49B 4HKXA 5CP3A 4NBYB 3QUYA 1WLHA 1N5YL 3DV6B 4QHKJ 1L6XA 1R5WA 2DLEA 5I76B 1X6LA 4U1IB 2EDEA 4Q0XH 2MCPL 2QQKH 1WJ3A 3WKML 1IZKA 2HJFB 2YKLL 2JCCB 1G7HB 1RMFH 3PP4L 3HE7A 4QOKE 1GGUA 3V5HA 4TTDC 1S7QB 3INUH 1X5FA 4PJXE 2PR4H 1F4YH 2VDQL 3VJ6B 3CFKA 1T66C 4RAUB 4HHAA 4MA7L 3VXNA 4Q9QH 1RI8A 3ULVD 3RWIA 4EXKA 2GEEA 1OD7A 2CR3A 4X7SH 3QQ3B 2C3GA 3NA9L 2W9EH 3EYUH 5E03A 3C6SB 4H20H 3GHEL 1I9RH 1B0RA 1HZHL 2Y06L 1J5OH 3SCMC 2XN9A 2J5LC 4N9OB 3VFRB 2QV2A 1OAQH 4R8WH 4AIXA 3RHWK 4QGYA 3RIFF 2C1OA 4U1NB 1MREH 1S7XA 2BOBB 4HT1H 1G7PA 2YOCA 1AFVH 1H15A 3OAYH 1MFEH 1W0WB 4P2CG 1F6LL 2W38A 4GRLB 3O0RH 3WJLC 5EU6A 1A3QA 3TBYB 1LE5A 3S7GA 4XC3L 2NY1C 1MNUH 5EIVA 3WHE1 3DTXB 3QIBA 5JW5A 1BQLH 2Z0BA 4Q6YA 1YEEH 3CDYA 4QRPD 1KLGB 3KVQA 4JCLA 1JTPA 2IMNA 2IC2A 4Z7QF 4U6TA 4OFKA 5TDOA 5EN2A 4DOHE 3FRPA 3AS2A 1LO3L 4LHUG 4OCXH 1JGEA 3QDJE 1OD9A 2K9UA 4K8RH 4PJ9B 4PY8J 3BOVA 4U7SA 4KV5E 5ICXA 1HNGA 1FL6B 5J12B 2VJXA 2W60B 2VLJA 5D1XA 4QWWC 5ACMA 1BWWA 1R24B 3CX5K 2NXZD 2P5WD 3QISA 2QEJA 4OT1H 4YC2C 1L0QA 1ZT4A 4DZBB 3FMGL 5C0CB 1MH5A 5D6DC 4P2QE 3UXFA 3UTSE 1UCBL 4U33A 1UWXH 5IQ7L 1OAYH 5F44A 2X09A 4OM0H 2RR3A 2FJHB 3AGVA 3MNWA 1WICA 2G5BA 4EZMA 3LIZL 3T0BA 2BY3A 2ZUVA 3AUVA 4AENA 2BOCA 4NKOB 3ZTJG 1GSMA 4XVUD 2AI0H 2AXGA 4FQHA 2CXGA 1IEHA 4DW2L 4YDLB 1JN6A 3RTQC 1OTUC 3JVGA 2PUQT 1VACB 3DJ9A 3ESVF 2HLFC 4JPIB 4G7YH 3T2PA 5IJKA 1U3HA 3QXUA 4MX7A 5MERB 4WV1C 4LMQE 3LDBC 5E2WH 5K9KB 3BJ91 2CUMA 3IGAA 4UNUA 4UZGA 3FN3A 4R9HA 2PYED 4DKEH 2VZTA 4Y19D 1FLRH 1X5ZA 2VLRD 4NRZB 4WGWB 3BRDA 4PRIE 3DGCR 1H3WM 4IOSD 1ADQA 1MWAA 2JJWA 3EJYC 4I48A 3UTTE 4MAYB 1YJDC 4P2RB 8FABB 1YEDB 5ETUA 4HUVA 1TDQA 3BMVA 5I0ZA 4JM2F 1NBVL 3GSWB 3IB4A 5FA4A 4P3CL 1FO0A 1DQML 1FYTA 4D8PB 1NCBL 4MNGE 2GT9B 4OTXL 1JZ7A 4NQSA 3HI1B 3K2UL 2O5XL 3IKKA 3QIBC 5DGQA 5GGSY 1BD2A 2PO6D 3X3FH 4ELKB 4G8IA 4RAVA 3VFGH 1RZKH 5C9KA 5K59F 5CBAB 3BHBA 1JF1A 5F1OB 3ZLQC 2FCBA 4HK3N 4LU5L 3KPOA 5D96B 3ULUH 3BP4B 5AD0A 4KUZH 2AQ2A 2VB5A 3FAWA 3WHXA 3KPRA 3Q2CA 2MFNA 4RWYH 4ERSH 5TE4H 4ODVH 5EOCH 4PJ5E 3D3VA 1QBMH 4XPHH 2ENSA 2ATPA 3RI5F 5B4MC 5HYSB 1CT8B 4TNVF 3R8BB 3S36H 4LLVA 1X44A 1I7TB 1D6VH 1MFCL 3GJEA 2CKBA 2VLME 2G60H 2I9LB 4WW2B 1KNOA 1WTGT 1QACA 5DQ9A 2AEQL 3GIZL 4D0BB 4K55A 1KPUB 5E5UB 1N4XH 1X9QA 4OJFH 4YXKL 4W68A 1AXTH 1MUJB 3ZKND 3KYOA 3OKYA 1OARH 3BDXA 1BAFL 1FSKC 1LMKA 3VI4E 4QHMA 4C56E 4ZDHA 1NFIA 2A6IA 4NQDB 4L8SB 1BQHB 3ARFB 3WIFA 5GPRA 4PD4K 3DNKA 5IHUH 2VL5A 1GJIA 1H3PL 4HK0A 4H0GA 5MI0C 5ANMA 3TBVA 3IJYB 2FEDD 4KUCD 2YZ1A 1A6ZB 2EKSB 1MJJA 3PGDB 3TVMD 5ALCL 2G75B 4XPGH 1HYSD 3BO8B 3DX9B 1BWMA 2DQUL 3JWDL 4MD5B 3BIKA 5E4IA 3L3GA 2XA8H 4Y1AE 5IFAL 3T1FB 3MRLB 2JELH 3HZKA 2NY1B 3BPOB 4Y5VC 2ZUUA 3OGCB 2EYSA 4G6AC 4XNXH 3U0TB 5FYJU 1JGLH 1IT9L 4PJ7F 3VXSD 1T04A 2XZQH 3RKDD 1IRAY 2JIXD 3ZSSA 1EEZB 2CRYA 5T3ZL 5FOBA 4F37K 3TA3C 5IFHL 1KCUH 1NBQA 5BZWB 3BEVA 3UTZB 1F02I 4OLUH 4MJ5A 4GMSL 1N3NA 2EIBA 3OGOE 5E2UL 1V05A 3HG1B 3KNBB 3IAPA 2YXMA 4YC2B 5ADPL 4TUKH 2VDOH 4HWBH 2DLFL 5JPNA 5A3ID 5C09D 2PNDA 1UXSA 4HKXB 3RKPA 4W6WB 1AXSA 1CF8L 2WLZA 3QUYB 1CXLA 1R5WB 5D93B 4IJ3B 5IKCA 3NIGF 3MUZ1 4Y2DC 3PWLA 1LP9A 1EJOH 2WINA 2JK5A 3VFVA 3STLB 3HE7B 2MOVA 4HJGA 3N06B 1MFDH 3UDWC 4MVBD 3V5HB 3DBXA 1YEGL 4JHBA 1XGYH 1A6UL 5DF0A 3CFKB 1CDHA 4CADA 5ISZB 4V2BA 1YN6A 3VXNB 4I3GA 3VWKA 3CLEH 3HR5A 1MQ8A 3T4YA 4F58H 1FGNH 2QQLL 2ZCKH 3R4DA 4U7MA 3O2DH 4NZTH 4TVPH 3RWIB 5IUSA 1EMTH 3LDBB 1ZGLB 2F19L 1HNFA 3B9EA 4DFHA 1XF1A 5I8OH 1RUMH 5E00B 1YDPA 4OGYH 4N0CD 4FFVD 2CK2A 3CLFH 4FQQB 3F58H 4X83A 2JB5L 2J8OA 2ZJSH 4P9HC 4GLRI 2XN9B 2CIIA 4JFDE 3UZVB 4NQCA 3UJJL 3QIWC 1TJHH 4LEOA 1JWMB 5D70L 3EHBD 3OAYK 4GXUN 1S7XB 4QHKI 1OSPL 1G7PB 4UBDD 1D5IL 3LPFA 3VXME 4NWTH 5E5MA 1ETZB 4XMPH 1H15B 1MF2L 3VU2A 1EDQA 5T3XE 5CHNA 1INDH 1YC7A 1LE5B 3N1PC 2DQDL 2E9JA 3U83A 3G5XA 3QIBB 4LHQB 3C60D 3IDMA 2MQ0A 1EERB 4J23A 4D9RD 1X3DA 3EOAA 2ADIA 1Q0XL 3GI8H 3G04B 3FL7A 1A4KA 4IOFC 1I9EA 5TDOB 5KVGL 5HGAA 5BRZE 1JGEB 4QRUB 5AG9A 5JW4R 5C6TH 4WHYH 5ICXB 4WGVB 1J8HD 1NL0H 3P77B 4YHNA 2VLJB 5D1XB 2VLLA 5C0AE 3G6DH 4CN6A 1RVFH 3WFDL 1I3RA 5BZDA 4L4TD 1ZT4B 1UWXK 1ZVYA 1J7VR 5KS9E 5DD3L 1XMWA 2WV3A 1ITBB 3VXPA 1MCCA 4IMKC 2HH0L 2ESVE 3WUWG 3E1F1 3CSYA 3UYRL 5ID1A 4IRJC 4JQVA 3WMSA 2JJSC 5LGHH 1OF2A 4UMGA 3FQXA 3HNVL 4CRPA 3NBNA 3MNWB 3OX8A 4XNUH 2G5BB 4M6OL 5FXCH 3HNTH 3NCJH 2P5EE 4OCRH 4WHCA 2OTPA 2VOTA 3AAZA 2AEPH 2JJUA 4X6FA 1MJ7H 4YHPA 3PF2A 2BOCB 3F5WA 1FSKB 3UTPE 2XWBA 4OFYA 1JZ2A 2B0SH 1FVEA 2FJGA 3RHWF 4O02H 1JN6B 3IDXL 4M8QA 2YHGA 4TNWK 4RZCB 5EZLA 5MI0B 4MX7B 1FZKA 3VG0H 3MBEA 4FQIL 5EBWA 4KC3B 1N64L 1CLOL 4XP9L 4HBCH 5FYLD 3EYSL 4GXVH 3QCUH 4NT6A 1DBKL 1QZ1A 1UT9A 5CIPA 3U7AA 5KTEL 2VC2H 4MMZC 1V3JA 1W72L 2CLRA 1E4KA 2HVJA 4GBXA 1BJ8A 4I48B 1SHMA 2ZNXA 4JO4L 4Y5VB 3SDDC 2Q8AL 3VRJB 3G6JA 3S35H 4EUPG 5ETUB 4HUVB 1CU4H 4D9LH 1Q72L 2ZNWA 5FA4B 3ZMRA 3SO3C 1FYTB 1EUUA 4S1QL 3SJVA 5E8PA 5I74C 1KELL 2BDNL 4XPAH 4LRIC 2ZOKA 5HI4C 2BNQA 1MHPH 3NABH 4M5ZH 1AO7D 4NO5A 1BD2B 4DGYH 5TFSL 4PJHA 2F74A 3RY4A 4PGCB 5AZ2H 2J4WL 4G8IB 4RAVB 1S78C 1KCVL 1JF1B 1N7ML 3NH7H 4HCRA 3KPOB 2V7HA 2HTKD 1RV6X 4L4VD 2IANA 3W39A 5KVFL 4QTIH 4HIXL 1X5AA 4RMUA 3IFOA 3RNQA 3KPRB 3WHXB 5CD5D 4WI3A 3LD8C 5I1DB 3D3VB 4XWOD 3W0WD 3NCMA 4Y2DB 3O3EA 2AJUL 4LLVB 4J8RB 3MOBL 1KLUA 3GJEB 4PRPD 5F6HJ 5E2VL 4LNRA 3LZFH 1E27A 1HINL 1KNOB 5JOPD 5DQ9B 3MLZH 1TLKA 2FBOJ 2W1NA 1CQKA 5MEQA 2E5EA 5I19L 3PDDA 2OCFD 3LMJH 3DIFA 2FNBA 3U4EA 4R26H 4U3HA 5D7IA 3KYOB 3T2NH 1UZ6E 3RIAK 2RHEA 3NZ8A 4CL7A 1FNSH 2R0WH 3D39E 4JO3H 3EGSA 4QHMB 1TVBB 4LP4A 1NFIB 2CO6B 3ULVF 3NPSC 3WIFB 5I1AA 5ILTL 3QXDA 4MAYD 2PKDA 1VERA 2YD7A 1CE1L 4RCAA 2FSEB 5ANMB 3TBVB 1E4XL 4JEGB 5C86A 3X14B 2VDRL 1N8ZB 2UVFA 1MJJB 4JPKH 1INEL 2APFA 5BCAA 2I60H 1JYNA 3QCTH 3BIKB 1FAIH 3L3GB 2RJMA 2W0KA 4Z95L 2LV4A 1DQJA 3HZKB 2QSCL 2HVKA 4DVRL 2EYSB 3SDYH 4YFLI 1M7XA 4XPTL 3EO0A 5TQ2L 3BGMA 4PRHE 1LK2A 3VI3F 43C9A 2ZUSA 3GSVA 3VXOA 3VRLE 2C5DC 2X70B 5DEFB 3BEVB 2YR3A 3GKWH 4PP1D 4QF1A 1RZGA 3O3AB 3Q6GH 5GGTL 3MRQA 4MJ5B 1QRNA 1N3NB 2A73B 4LPCA 1E6OH 2X1OA 4N5ED 1MEXH 4X6DE 3TN0A 3BKYL 1TIUA 5F6IB 4MQ7B 1PY9A 2SEBB 1AXSB 5K9JL 2WIIA 3F7YB 3LEVH 1Q9WB 5HHMB 3D0LA 2F8OA 2YUZA 2DIBA 3QXTA 1HN1A 9CGTA 4PB9L 1JGUH 2Y5EA 3EYOA 1T83A 4E41D 1ZHBA 3NIFE 1EGJL 3PWLB 1FH5L 2A6DB 5HHVL 4P3DA 4MD4A 4B50A 2WINB 3FB6A 4OCSH 3VFVB 1WIUA 5D6CA 2PYFA 4HJGB 1IARB 4DTGH 2B39A 5DD6A 5C07A 1CGSL 4ZYKA 4KKCC 3P4OA 1WZ1L 4CADB 1YN6B 5I30L 2BJMH 4OZHA 3VWKB 4NGHH 3UPRA 3GRWL 3FHAA 4V2CB 1LD9B 2VSDA 3ULVL 2A1WL 2HKHH 4KFZC 4KKAC 3T4YB 4WNQA 5D1ZC 3ARWA 4LPYA 1JP5A 4XI5D 5BVPL 4JKPL 1T1YB 1HHKA 2WK2A 1E4JA 1YDPB 3P4NB 2C4FT 4MLIA 4FQCL 3L3KA 5T5FL 3D69A 2EKJA 3GBML 1ACYH 5FHBL 4MNQE 4OSUL 2F53E 2VXUL 4FP8L 5C0FB 5E7FA 5L6YH 4F37F 4P2QD 3UTSD 2BMKA 5J57B 2F9BT 4P0DA 5FKAA 5E5MB 4LAQH 1D9KD 3CJJA 5HYJE 1HKLH 4HXAL 1F11A 5F7HA 4TRPL 3V6FA 4JR9L 1OAUH 4AZ8A 3ABZA 3KXFB 3G5XB 3BVNA 3WEXA 3IDMB 1X7QA 4YBLC 2DQEL 3EOAB 3NFSL 2ADIB 3OB0H 4LPUA 4DQOL 1A4KB 5BV7L 1ZHNB 2ED9A 2OJZH 2X1XR 2XWJB 3QUYD 3BH8A 2KDGA 1UH3A 4CJ1A 2YRZA 3EUUA 2O93L 4HF5H 3ARXA 2NY3D 1KT2B 4P59H 1PQZA 4YHNB 5J11B 2VLLB 3E8UL 4XZUA 2EH7L 1I3RB 3U48A 5BZDB 5I9QC 1H8NA 3HE7D 3LV3A 1FN4A 1UACH 3U7WL 1NCDL 1MI5A 3VXPB 1FIGH 4R7DB 2IPUK 3OZ9L 3QHZL 5ID1B 4HGKC 3S5LG 3MXWH 5DDHA 2YN5A 3CFJA 3FQXB 4KKLD 4JLRA 4XNQB 3WE6A 2IFFL 3K7UA 4UILH 3UTTD 3OX8B 1UB6B 1J0HA 3D5OF 2EEDA 3IJHA 4GSDH 1DVFA 1QVOA 5EU7C 4HPYH 5FYJE 1NCTA 1RZJL 4X6FB 4YHPB 3RA7H 3K1KC 3VFSA 2OZ4L 2XWBB 2FJGB 1R5IB 2XN9D 2HKFH 4CJ0A 4M8QB 4FZ8H 1MHHA 1MCBA 1N2RB 2NY5H 4XAWH 4FG6D 4OQTH 5EZLB 3T04D 1FZKB 2ZG1A 3HUJA 4L5FL 5F9WC 3MBEB 3MJ9L 3WFEL 1SBSH 4JQIH 4XPFH 5INCA 4KDTA 4PPTA 5F7DB 3RRQA 2UWEA 3SN6N 3MO1B 4NT6B 5EU6D 3SGDI 2V5TA 3T3ME 4P5TD 2CLRB 3ESUF 5DJAB 4ODSH 3ZZ1A 4JFFA 4K23L 4S1SL 2B1HH 5HVWA 4PJ5D 1XGRB 4MZ3A 1WFUA 4F7CB 4M61A 1P2CA 3C5SA 3G6JB 2X1PA 4PJCF 2YPVH 3RBGA 5MENA 1WC7A 1OSZA 4OUUB 1IAKA 2BVYA 1CXIA 4LVEA 3PHOA 2VLMD 4PJEF 4XMKH 2QQKL 3MLSH 3O6LH 2F15A 5E8PB 3WNKA 1C08B 5ID0A 2ZOKB 5D1XD 1QD0A 1RZ7L 3F7QA 1F4HA 4NO5B 3PWPB 4PJHB 3N50A 2OYPA 4AIZA 2PR4L 4H1LG 3ZE2F 3QUMA 3GMPB 3OAUH 1M71A 4KY1H 5GHWH 2DQTL 4LF3A 3DI3B 3V7MA 4KRLB 35C8H 4LLDA 2V7HB 4Y5XC 4GLRH 4N5UA 2IANB 4UQ3A 3W39B 3O3BA 1N6QH 3T09A 3IFOB 4NNYB 4ZO6A 3RNQB 4UIKH 3KJ4C 4HUMB 3OL2A 3L1OH 1I8MA 5D2NC 1P4BH 4X7SL 3TYFA 3N85L 2M26A 1IMHC 2W9EL 3O3EB 3EYUL 1S9KC 1SYSB 4H20L 3WLBA 4CW1A 3SGEI 1J5OL 1WFOA 4P57A 3V5DA 4WFHE 1FCCA 4LNRB 4TNWF 1OAQL 4R8WL 2AK1H 5IB4A 3BISA 4Y1AD 5DK2A 4IDLA 3GZKA 1X5LA 4P4KC 1MJUH 4JANA 5AYUH 1MREL 4PRAA 5H94A 4M9PA 1DEEA 1DQQA 4HT1L 3DIFB 5IB5A 1U3HD 2ZCLH 2AAVA 4HKBA 2IH3A 1AFVL 3OKKA 1WWBX 2DQGL 3O0RL 3W2DH 3FFDA 4PJBF 3BPNB 3VDBA 5IROC 1MNUL 4EN3C 4S10A 3CZFB 2G2RA 1XIWC 3O8XC 3MLPA 3DXAE 3H3PH 1YEEL 5I1AB 4HLJA 3QXDB 3DOSA 2YEZA 1SM3H 5E99H 4GRWE 1KG0A 1O7SA 2EDFA 1V7MH 5I1CH 4XBEL 2Z93A 25C8H 4K8RL 1A1MA 5GRUH 3L9RB 2RAMA 4I3RH 4G6MH 4KDTC 4Y5YA 4JGUA 3GMLB 4OT1L 4Y89A 4R2GB 3ULUF 1D5BB 3S37H 1DQJB 4Z7OF 4M3KB 2HVKB 4NN5C 1DSFH 4YBLB 2NW3A 5F6HI 1PFCA 3PWNA 3KPTA 3QG7H 4Y88A 4C59B 1G6RH 3EO0B 1OAYL 4H8WH 4NDMA 3BGMB 3U46A 1LK2B 1ES0A 4OM0L 1QFOA 1Z0NA 4ZO7A 43C9B 3GSVB 3VXOB 4DWHA 3KPRD 1AHWC 3EJZC 4J3VA 4WTWA 4QF1B 3N1QC 1S7UB 1QRNB 3R0NA 1B90A 2YPKA 2FDBP 4BFIA 4X4YB 5B3NA 2R9HD 5I9QB 3TN0B 5C0CE 2AI0L 3C09C 2XTJE 3O6FD 3QZWG 1LILA 3KHOA 4UU9A 4ZFFA 4I2XA 2WIIB 3V6OA 2A9MH 4Z7WA 2JB6A 2X4SA 3D0LB 4G7YL 1G7IA 5F7NC 1DLFH 1IM9D 1CTOA 1S5HB 3EYOB 5E2WL 3RIAF 1FZJA 1ZHBB 1JNJA 3W5NA 2XXCB 3TO4C 3HC0A 3LEXA 4DKEL 4P3DB 3FB6B 1FLRL 5D6CB 2VXVH 2PYFB 3AREA 3HMWH 4LSPH 3GHBL 1QSEA 4BZ2H 3SKJH 4ZYKB 3V4PL 5FHAL 3DRQA 3P4OB 1AGDB 2BVEA 5T3XD 3L7EA 4ZFGH 4OZHB 3RDTD 3BP6A 1KOAA 3KPMA 4YBQC 1IKNC 5F8QC 4ELMA 4O9HH 3W11C 1BEYL 3MODH 2WUCL 1MFAH 4OZGE 4NKIH 4ZUUA 5FM5O 5BS0A 3CFEA 1WAAE 2FGWH 4PG9B 1HHKB 4TUJA 5BRZD 2IQ9H 3X3FL 1DBMH 1BFOB 3VFGL 1RZKL 3L3KB 5MEPB 1PEZA 1UZ8A 3D69B 2VN7A 3PV7A 3RGVC 3MNVA 1G9NC 3SKNA 3LPWA 1NCAH 2X89D 4XNZB 3CX2A 4PJDA 1V3LA 3Q1SH 4F8QA 4PJIA 4JG1H 4HWUA 3ULUL 5E8NA 1ZT1A 4KUZL 3ORJA 5DS8A 1EHXA 5IFJA 2MQ3A 4ERSL 4F15B 5TE4L 2ESVD 4U31A 2H32B 3B2UD 4ODVL 5FKAB 1Z9OA 3ZKMD 1QBML 4BH7B 4XPHL 3UTQA 4GT7A 1K4DA 1F11B 4DJMA 3HAEH 4JPWH 3OB0K 1UJ3C 5TE7H 4HDIA 4NUJA 1QFWH 3KS0J 3BVNB 5JDSA 1X7QB 2ORBH 3BN9C 4YIQA 1JTTA 1K8DA 2G60L 5J1TC 2W0PA 5HHQA 1TCRA 2YN3A 5J1SC 3U7YH 3QBTB 2MWCA 1WT5C 3E3QC 3KYMA 2XYCA 2M2DA 5D4QA 2QJDA 4OJFL 3LEYH 1ZVHA 2EXYC 4AQ1B 3UTPD 1HH9A 5TDNA 2X4RA 3AXLA 4TTGA 1AXTL 3OKOB 4LDEB 4O51B 3FQRA 4G8EA 3KJ4B 5E8EA 3F7VA 1U8PA 4XZUB 5C9JA 1OARL 4PFEA 4S1DD 5E56A 3LV3B 3IVKA 1YEHL 4HMDA 4PREA 3SDAA 1ZGLP 3MCKA 2IG2H 1MI5B 4WCYL 4G80A 2IAMD 4NHCH 5TE6H 5JTWA 4MHHI 1YEJH 3VWJA 5L2KE 4J1UB 3L5XH 1C7TA 4LPVA 5KSUA 1LHZA 4U6HB 1LO2H 5DDHB 4FQJH 3CFJB 2P45B 3VWKD 3WE6B 4P4KB 3RVVD 4XB7A 3RX8A 4XPGL 1JMXA 2YUVA 3TBTA 3IJHB 4MNHA 4I5BA 1IL1A 3JV5A 1DVFB 3LSOA 1V7NH 4LDLB 1AKJA 2Q87A 3VFSB 2JELL 4AEIH 2YRPA 3WIHH 3WUWB 1KEGH 4HC1A 4XNXL 3PHQA 4EN3B 1XIWB 3VMPA 3NCYP 2OQJA 1EEUA 3ULSA 2NR6D 4NQCD 4WHYG 1MHHB 4E9LA 5FAAA 4KPHH 4PS4H 2XTLA 3HUJB 3ZT7A 1CXFA 1A0QH 3AY4A 5JA9A 1CFSA 5DJCB 1KCUL 4MDJB 1TZHA 4JO1H 5INCB 3WN5A 4OLUL 4Y4FC 1UGNA 1B88A 4GQPH 3MQIA 1L9NA 2FIKA 5FO7A 4TUKL 4Z6AT 5JXEA 2VDOL 4HWBL 3GUTA 2DJSA 5CBEA 1TTGA 1TVHB 3PL6A 2VLKA 1P2CB 3BXNA 1JTOA 4ODXA 5GZNC 2OXHA 5DSCA 3DROA 5J06A 5MENB 1WC7B 3I3DA 1IGYA 3O41A 2DD8H 4OGAC 1PVHA 1IAKB 5E9DE 3PHOB 2YPLE 3U0WL 2GKIA 5JIPA 2CQVA 1U93A 3CPLA 5ID0B 4OLEA 5GS0H 1KJ2A 3V52H 1EJOL 1YZZA 2DTMH 3JV0A 4KTEH 3QI9C 4JFHE 4PJXF 4B7IA 4NCC1 3ARGA 3ARUA 4AIZB 5BMFL 1AR1C 3C09B 1M71B 3JV6B 4J7RA 4LF3B 1DJSA 4PRBA 2I27N 3CK0H 3D39D 3CLEL 3O3BB 5FM4A 4LLYA 4HH9B 4F58L 4A6YH 4TSAH 1FGNL 3SKOA 3O2DL 3QEQE 4NZTL 4TVPL 4G6JH 1I8MB 1EMTL 2ARJA 4YGVA 1AGFA 3TYFB 2X4UA 4EVNB 5I8OL 5C0RH 1RUML 3MRJA 3P0VH 1IILE 3QWOB 3MV9E 4OGYL 3WLBB 3CLFL 4CW1B 2FHCA 2ZJSL 4P57B 4UT6H 3V5DB 4OFYD 5FYJH 2D4DA 5IB4B 4M6MH 1TJHL 5C0JA 5ISZE 2FGZA 4JANB 1J1XH 1RZ8B 4PRAB 4LKCA 1DQQB 1G7QA 3LN5A 4HKBB 3ZL4H 1PKOA 2EC9T 4XMPL 1U8IA 2AJXH 3OKKB 4U1GC 4RISL 5B39G 5A2LH 4PRHD 3NFPB 3FFDB 1T7ZA 1MCDA 3GMQA 4HUUA 4MGXA 2PXYC 3LB6D 4PLOB 1S8DA 2AV1A 1RIHH 2Q86A 3GI8L 4U0RC 4MJIA 4GBXD 5DFWH 4HKJA 2AV7A 4L1HA 2YEZB 2EZ0C 4CBPA 3T08A 3AY4C 2P4AB 1OW0A 2Z93B 1HSBA 1VHPA 4KV5F 1A1MB 3UZQA 5C6TL 5FO8A 3VD4A 1NL0L 1IC4L 5DUPH 2ATKA 4Y5YB 3Q5TA 3SJVD 5EA0H 5IWLC 4IEFB 1RVFL 5DQDH 2VITA 5AAMA 3JWOC 3CVHA 2BNQD 4WU5B 5T1LA 3QUZA 4K8RC 4KK6D 4NBZB 4OZFH 3FFCE 2Q7NA 2QQNH 2X5PA 3DPBA 2NW3B 4BUGA 2A9NL 3PWNB 1JZ5A 3U46B 4NDMB 5LGHL 4G6KH 1ES0B 3M17B 5I6XC 1Z9MA 3OKLA 5A40E 2EDRA 1XGUA 3DX7A 5IR1A 3HNTL 3NCJL 1HXYA 3CSPA 3K3QA 1F8TH 4V1DA 4GFTB 3MRFA 4N8CH 2AEPL 2R1XA 3S4SG 3F65A 4N0UA 1P6FA 4PJGA 4BFIB 3MA7A 1VGKA 3IU4H 4TULH 3KPSE 2J6EH 1KULA 3U79A 1YEKH 1BECA 3IDIB 5HDLA 4IDJH 2GTZA 3TNMA 4EIGB 4UU9B 5KANI 4I2XB 4JZJA 1R3LA 5INDA 3DVGA 5SV3A 4Z7WB 2JB6B 1G7IB 4NC0B 4AH2A 4O2CA 2PCPB 4XNMA 3VG0L 1FC2D 5IOPA 1FZJB 4MNQD 1V8HA 1QFWM 1J18A 3HC0B 3LEXB 2J8UA 4HBCL 3TBSA 1UH2A 2X4QB 3P4LA 1F00I 4GXVL 3QCUL 3AREB 5CSBA 1T03H 1IC7H 3KAAA 5LGKA 4YUEH 2FB4L 2VC2L 1YQVH 4J3WA 1QSEB 1TCMA 1X4XA 4L9LA 5HYJD 5DJ0A 3KR3H 5HI3D 1FE8H 1SJVA 2BCKA 3WFBH 5H37H 3B3IB 1ERNA 3L7EB 3S35L 1YY9D 3EW3B 3BP6B 1YNKL 3ARBC 3KPMB 4D9LL 1DN2A 5BW7C 3QPQC 5JIHA 3LKOB 4XP4H 2IQAA 4KVNH 5D72H 3MUY1 4ZUUB 4XPAL 3CFEB 4Q6IC 1MHPL 4M5ZL 3TPUA 1D3CA 4TUJB 4X6BA 5C08E 4DGYL 1Q9KA 3RVXD 2LTQC 4R2GD 4I0PC 5JQ6L 1UZ8B 5GIRA 3MNVB 3LHPH 2VWEC 3NH7L 5DZOA 3SKNB 3V2AR 1XH3B 4PJDB 1OW0C 4XVSH 4U1LA 2VISA 5D71H 1FFQA 4QTIL 2EE6A 5IFJB 1IC5H 1LO4H 5GZOD 3WFZA 2LQRA 5D1QD 3WL9B 3D2UA 1MOEA 3IJSA 1K8IA 4HS8L 4TPRH 5M95B 1K4DB 2E7BA 3MA9H 2ITDA 5JDSB 1NCCL 2YBRA 3QI9B 1K8DB 4P9MH 3LZFL 1MJ8H 1TCRB 3VGBA 1J1OH 2IBGA 1MCIA 2V7NB 3GSXA 4PRDA 1CDUA 3KYMB 4OFVA 3E6HB 4NJAH 1HH9B 3LMJL 1F97A 3AXLB 4WJ5A 1TZIB 4R26L 1J8KA 3FQRB 4QXGH 3T2NL 4G8EB 5E8EB 3F7VB 1U8PB 2HRLA 3RVWC 2AK4E 1FNSL 1QSFA 2R0WL 4JO3L 2GK0A 3IVKB 4PTUB 4PREB 5T1MA 5DRWA 3SDAB 4FQ1H 3T77A 5C07D 3GSNL 4G80B 4HV8A 5IB1A 2NY0D 3VWJB 1L7TH 1QRKA 4EOWH 4RQQB 2BXYA 2R2BA 5KSUB 1WCQA 2GSGB 3HNSH 3ZHDA 4E42A 2BXZA 1B0WA 4R97B 1JYWA 2AABH 5F9JA 3PNWA 3CXDH 4HWZA 4Z18A 3TBTB 2A2QT 5IBUB 3QCTL 1ED3A 3BT2H 2APTA 5CZVH 5JLZB 1FAIL 3LSOB 4X4ME 2MKWA 5DFTA 1RIVH 4XCYA 1AKJB 4OUOA 5GGSA 3NVQA 5CJQH 2E6JA 3IFNL 3SDYL 3PHQB 2OS7A 2DM2A 3VMNA 5EIIB 1AC6A 2OQJB 4OIIL 4XT1C 5F7LB 3ULSB 1VPOH 4U0RB 5IB2A 1BQUA 4IOIA 2FATL 3DECA 5C0BE 5ITFB 1ODAA 5MEOB 2VZUA 3O4LD 4PLKD 4K7PH 1G9EA 1CFSB 3LS4H 1YEIH 4MJ4A 4X9BA 1TZHB 1Y0LA 4OLYH 3PV6A 4B41A 3BN3B 3MLXH 4QO1A 1E6OL 3KYNA 2D7PA 1MEXL 1SVZA 2X7LA 4NCC2 5FO7B 5TQ0H 2FIKB 2VIRB 3MMEA 3HKFA 3GUTB 2Z31A 4UQ2A 3HPLB 3QH3A 4U2YA 3PL6B 3VXRA 4ODXB 4G8GA 5EO0A 3LEVL 4LOUC 3DROB 3QQ9D 2YD4A 3SE8H 1IGYB 2V17H 2VMFA 3O41B 3SKMB 2DQJH 3QCVH 3W5MA 2XRAH 1JGUL 4FTVA 3C2AH 4NIKB 5DUBA 4Z78A 5I6XB 3T65A 4OF8A 1RK0A 1U93B 3CPLB 4XHJC 3MTRA 4LHUA 1KJ2B 3C8DA 4JFEA 5C8JA 4OCSL 5HVHC 4WFED 3VGDA 3ARGB 4MLSA 1NANH 3GEWB 3T0ED 2DL2A 3C08H 1MI5D 4H5SA 4PRBB 2BJML 4Y4KD 1NC2B 3C6LA 4MA3A 4NGHL 5FV2A 3DUUA 1LDPH 1IEBA 5HHME 1FZMB 3SKOB 1HIMH 2W65A 1NGWA 2XQBH 4PJ8C 5FV1L 1RUAL 5CEZD 2ARJB 2DKSA 5J13B 1AGFB 4RMRA 3TT3H 4F7EA 4K3GA 1DVFD 4ZUWA 2B7DT 2BVUA 1AR2A 5A2JH 4H1LB 1EEQA 4QRTA 1DL7H 5FGRA 1ACYL 3D85B 3I6LE 1ZAGA 1U8KB 5C0JB 5L6YL 5EC2A 4HMEA 1GYAA 4LKCB 5I1HH 2H2SC 1G7QB 3MFGB 3ARBB 3LN5B 3CFDB 3NACH 1BIIA 1U8IB 4LAQL 3REVA 4WU7A 1JZ6A 1A7OH 2CKNA 4Q6IB 1OL0A 3GMQB 5GISH 4LHJB 5KSBE 4JM2A 5IESH 3DGGA 1S8DB 5CD3A 2AV1B 2Q86B 1HYRC 2EC9U 5CCKH 2LTQB 4JFFD 3MV7E 4LASH 5DHVA 2AV7B 1JBJA 2OJZL 1MCOH 4LCCC 2BRRH 5A2KH 5CZXD 4I1NB 4EBQH 1RJZA 4WEBL 3QQ4A 1HSBB 4WO4C 2XTJD 1FG2A 4HF5L 5FO8B 4S0SD 2Z92A 4P59L 1LGVA 2HG5B 4KAQL 2VITB 3FQWB 1K6QH 3CVHB 5DMYA 5KS9F 1R3HA 2ZSWB 1AP2A 1GGCL 5T1LB 3QUZB 2YSSB 1D5XA 3V6ZA 3KXFE 1KSRA 1FIGL 3KPLA 4C55A 3MXWL 5E8DL 1ROWA 2IGFH 3O9WC 4K3EH 4Z7UB 1OM3H 2C3XA 3OKLB 3WS6A 1U9KA 3BSZH 4UILL 3DSFH 3DX7B 2LAAA 1HXYB 4QHUA 4UT7H 4HPYL 4V1DB 4ZAKA 5J4MA 3RA7L 2R1XB 4N0UB 4PJGB 4F2MA 4KMQA 3VD3A 3MA7B 1VGKB 5JOEA 4YHYC 4QXTA 4ZPTA 2B4CH 4KJQD 2Y5TA 2EYRA 3OF6A 1HQRA 2ZSVA 2HKFL 3TNMB 1RULH 1FPTH 4FZ8L 2XWTA 1R3LB 3EYVA 1NAMB 4XP6H 5INDB 3DVGB 2NY5L 4WWKC 4XAWL 5FFLA 4OQTL 2MPAH 4FA8A 4AH2B 4O2CB 4XNMB 3WDJA 1HHJA 5ELIA 1NC4D 4MQXC 4XPFL 1FFPA 1OTSC 4P23A 3TBSB 2J8UB 5BOPA 5T5NF 3HMXL 1CL7I 5J56B 2A0LD 5F70A 3DUHA 3HI6H 3QZWB 4YXLL 2B1HL 4DKAA 5FCSH 1JRHH 2H9GB 5T3XL 5DMGC 4L9LB 5DJ0B 3O6KH 1H9VA 3QNXA 3A6CH 4XCCH 2ICWA 1WSST 1H3TA 5IQ9B 5JXAH 3WXWH 2AJ3A 1E6JH 2IQAB 4XMKL 3O6LL 3ETBF 1X4ZA 1I1AC 1EO5A 3TPUB 1YJDH 4X6BB 1AQKL 3U30C 4MJ2A 3GSOA 2CSPA 2KH2B 1ZTXH 4KK5D 3WYRA 5C0NC 4DUVA 3OAUL 4KY1L 5GHWL 35C8L 4U1LB 2VISB 4MJ6A 5ADOL 1JNHA 1N6QL 2HFGH 2VERN 3B5GA 4UIKL 3DHJA 3F7PC 1N0XL 3D2UB 5D5MB 3IJSB 1K8IB 4OBSA 4TTDD 5C0EA 1P4BL 1AGEA 3D9AL 1KCRH 1EVTC 3I2CH 3PWPE 1C1EH 5KJRL 2ITDB 1OTTC 2IADB 5EO1B 3MPCA 1WZLA 2YBRB 5ABDE 5SX4I 2A74B 4OZIA 1AGCA 2AK1L 2C26A 1QBLH 3O2VH 1MJUL 2I5YH 4PRDB 5AYUL 4J4PA 5LBSH 1NLDH 4UIMA 4KRNA 3I3BA 3MOAH 3LRGA 1UZ6F 4JFXA 4R7NA 1DQDL 5ERWA 3ZTNL 3W2DL 1QSFB 4M1DH 1F6AA 4LQ1A 5E0QA 1DUZA 4P5KA 2NYYD 2GK0B 5IEKB 3TYGH 3FOMA 1D6EA 5T1MB 5DRWB 3TCXA 3H3PL 3WBDA 4JQXA 1J1PH 5IB1B 1VFBA 1SM3L 2GUOA 2R2BB 1BLNB 5E99L 5SWSB 1ZS8A 1V7ML 4E42B 1RJCA 25C8L 4PYHA 4X6EA 5GRUL 2WANA 3R06B 2L7JA 4G5ZH 5BS0D 5I1GH 5J9PA 1OGAA 2FH6A 1CGTA 4XCYB 5DRNA 2FBJL 5GGSB 5E9DD 3S37L 1CG9A 1OGTB 1DSFL 3D25B 2N56A 5FK9A 5C1MB 1UM6L 3O2WH 3QG7L 1X5HA 1G6RL 4IOIB 4H8WL 4U0QB 3LKQA 4ZS6C 2R0ZH 4LCCB 3ET9F 3HI5H 4LFHG 4F9PA 2GQHA 3VRLF 2R23A 1XAUA 4WO4B 1Y0LB 4M93C 2FX7H 1TQCC 2D0FA 2J7LA 5E6IA 5HJ3A 5ACLA 4QLRA 1YNLL 3KYNB 4X6DF 2X7LB 2XICA 4AEHL 3RX7A 3MMEB 4HEME 2Z31B 4DK6A 1CFQA 4UQ2B 3QH3B 1S7TA 1JWUB 4G8GB 4ENED 5EO0B 3VGAC 2NY2B 4ONHA 3MV9D 3BKMH 4HKZA 1DLFL 1U8LA 3UP1A 1F2QA 4FTVB 1YMMA 3MLWL 2D3VA 3O9WB 3NIFF 4JY6B 1WEJH 3T65B 1RK0B 4P2OA 4JFEB 2VXSH 5C8JB 2VXVL 1CICC 2UYLA 4MA8H 3TF7C 3HMWL 4LSPL 3H9SE 3RTQD 1I4FA 1CZ8H 4U49A 3SKJL 4RSVA 4Y4HC 4H5SB 4E0RA 5DJZA 3RY6A 4XGZA 2NTFA 4RGNB 4ZFGL 2VE6B 4M62H 3DUUB 4O9HL 1EBPA 2FEEL 5C7XH 3L3IA 3MODL 3B6SB 4WWKB 4HZLA 2W65B 1MFAL 2HWZH 1NGWB 3LKPA 3MROB 4NKIL 3QUXA 1A02N 4Z7VE 4F7EB 2HJKA 2IQ9L 1WV7T 1DBML 1AKJD 5EU7E 4HUNB 4QRTB 3V0VB 2DBLH 3R8QA 3AM8A 3Q1SL 4KMLB 4JG1L 5EC2B 1BJ1J 3NIDE 4OZHE 3FO1A 4NSKA 2R8SH 5IHBA 1RU9L 1U8JA 2Z35A 4WDIA 3MJ7A 2GJ6E 3REVB 1HI6A 1JPGA 1U95B 3RWDA 5I0DA 4JPWL 5KVEH 5TE7L 1QFWL 4JM2B 2PW2A 3DGGB 2ED8A 4NOBA 2ORBL 5JXED 5JQHC 5DJ2A 1HOCA 1T0NB 1CGXA 5GGVL 1B3JA 1DP0A 3U7YL 4FFYH 3WJJA 2VLKD 3EYQC 4K7FA 4IRSC 4OI9A 2D7OA 3SQBA 3LEYL 4Y0GA 3KPSD 3BI9X 5B4MD 4NFDA 1FG2B 4LEXH 1BVZA 2Z92B 5E6IC 4MA1B 2NLJB 1FV1A 2DMBA 1ZGLM 5AEAA 4HH8A 2YA2A 1ZT7A 1AP2B 1DBBL 4M48L 5GGTA 1Z5LA 2Z4QA 2BRQA 1BZ9A 2IG2L 3EKCA 3ARGD 5ESAB 2HFTA 3KPLB 5TE6L 1CIDA 5GGVY 2HT4D 3SY0A 1TQBC 3L5XL 5IMKA 1EFQA 1LO2L 4FQJL 4ZFOL 1H5BC 15C8L 2RFXA 3EFDH 3FB7A 1A7PH 2HRPL 4YDVA 3SQOH 4JDVA 4QHUB 3UMTA 1V7NL 2BNRE 5BXFB 4OD3H 1EGJA 2DQFB 5CMAA 4ZAKB 5I1EH 5D2NE 3TPKA 2NY7H 1SJXA 1BJMA 1S7WA 5CILL 1G7MA 4AEIL 4QXTB 4ZPTB 3WIHL 2I9TA 2Y5TB 2EYRB 1U58A 1OAKH 1PG7X 3L3JA 2XWTB 5C08D 3EYVB 4P48A 1I9JH 3P0GB 4PS4L 1A0QL 4Y7MA 5B3JE 1AD0B 2YD2A 3GRWA 3PWJB 4JO1L 1URLA 4P23B 4MAUH 2CO7B 3EOBA 4OAWB 2X6MA 3T3MF 1XT5A 4FQXC 5IBLC 3CFCH 1MQKH 5HYFA 4K71C 5JPMA 1QO3A 2AXFA 1UC6A 2EIZA 2E7LC 5IHLB 3SDXA 4MJID 5E6ZA 1CDIA 4OD1H 1SVCP 4M6NH 2ICWB 2BK8A 4LCUA 2AJ3B 5TF0A 3MRBB 4LCWE 5T1DL 5GS0L 3V52L 1N5AA 4JHAH 4M93B 2DTML 3IXTA 2R4RH 1II4E 3AS1A 1B4RA 5KN5A 1F90L 2Y7QA 4QRPA 4X7TA 4ZPVB 5IW6A 1MHEA 2X1QA 5JW3H 4MJ6B 3IFPA 3FQNA 5DVMA 3VGAB 1VEMA 1MIEH 4A6YL 4TSAL 1DQLH 5IVXB 5C0EB 5CSZB 3EAKA 5GQBA 2P5WA 2VZ1A 5C0RL 4V1DD 4ISVA 4XAKD 5H37G 4UT6L 5FYJL 4NP4H 4OZIB 2XFXA 1AGCB 5CLWA 4WI2A 1T80A 4K9EC 2CIKB 5AZEH 4NM4H 1IC1A 1J1XL 5DHXB 5HGBB 4UIMB 5DVLA 3ZL4L 4WUUA 1XF5A 4OGXL 4R7NB 2AJXL 3MLYH 4YAQA 5DD0H 4AG4H 5IVNA 4P5KB 1HSAA 1WFTA 1ZKAA 3FOMB 2FO1A 3QIWD 4XCEA 1RIHL 2K3TA 1UA6H 4I77H 1K2DA 1U8OA 4U1SB 2OZ4A 1VFBB 2L7UA 1J9CT 5DZLA 4D0CA 2GUOB 1SJHA 1BGXH 1ZS8B 2L0DA 2DI9A 4UDTA 4KKBD 4GMTH 3GKZA 3VGHA 5F9OH 2MKLC 5ECJE 4JKMA 2ADFH 3GMRA 3MJ9A 5DUPL 5EA0L 1M7IB 4GKZA 5DQDL 3D18B 5J9PB 1OGAB 4G9FB 5I17A 1EO8H 4IOFD 4YDIH 3BD4A 5DRNB 3V7AE 1CG9B 2AGJH 3W82A 3SO5A 5I18H 3DMMA 5HY9A 2QQNL 5IW1A 3SE3A 5FK9B 1ZLWH 1TVDA 1QQDA 4HUXA 1P1ZA 3LKQB 2VXTH 4G6KL 4YK4C 3HS0A 3MV8A 3NAAH 3NTCH 1ZSDA 4LLMA 2R23B 1IE5A 1S9XB 1TETH 3BD3A 4MYWB 3D2UD 5KVMC 3WFCL 1SEBB 3N1GC 1G7LB 5ENWA 2VAAB 1F8TL 1FJ1A 2RGSA 5E6IB 1AE6L 3U9UB 5EFIB 3O6MH 4KROC 2PO6A 3OKEA 3IU4L 2J6EL 1EXUA 2PN5A 1YEKL 4JDTH 4KXZI 1CL7H 2EE2A 1UADC 4JRXA 3HHRB 4WW1A 1AI1H 4LLUA 1TQBB 4LSQL 1MY5A 1MCWM 1U8LB 3BAEL 3AMKA 1CDCA 1J10A 1YMMB 3E3QE 4O2EA 4R0LA 1S9VA 2FZ3A 2NXZC 2CDEA 1BX2A 4I9WD 2FR4A 3EDEA 1ZA6A 3U36A 5IF0A 2UYLB 5DYOA 2NX5A 1T03L 4L8CB 1J05B 1BREA 12E8H 1IC7L 4YUEL 3VFUA 1YQVL 5SWZA 5DFVD 1KGCD 3V4VH 4E0RB 3KR3L 4G7VH 3QFDA 1FE8L 3WFBL 1A6VL 1I75A 5JIKA 4XP4L 4HZLB 4KVNL 5D72L 1UEYA 3LKPB 3MV7D 5EO9B 3SKUD 1WAAF 2DDQH 1JUFA 4Y16A 1PLGH 2HJKB 3TV3H 1A64A 4MB4A 1A1OB 2X42A 3NPZB 3QIUC 5I75C 4LSDA 4XBGA 2O61A 3LHPL 3S96A 1CFVL 4FMFA 3WO4B 3NGBB 3K1DA 4XVSL 1H3GA 4EDXB 5J6GA 5D71L 1XF4A 2YD5A 5SX4H 1IC5L 3FO1B 4NSKB 5HI4D 1ZLUH 1LO4L 2YA0A 3I75A 3TVMA 1CK0H 1U8JB 5L7XH 4WDIB 4TPRL 3MJ7B 4EEEA 4NZRH 3DHMA 1BBDH 4PJCA 1G6VK 3RWDB 1F58H 3MA9L 1HHHA 2PW2B 5HYSG 3STZA 1F5WA 1Q38A 4JKLA 1RIUH 4PJEA 4P9ML 3G5YA 1T0MA 1HXMA 1HOCB 4KK9C 1L4IA 3MC0A 1MJ8L 2HT3C 4YEEA 4ALAH 1J1OL 3VXSA 4K7FB 3VXRD 3V0WH 4NJAL 5BJTA 4U2ZA 1CXKA 4FTVD 4JFYB 3M1BA 3L5WA 2XPGA 2OL3L 4LHUD 4JFED 1ZT7B 3VXUA 3VFMB 3D1MC 1Z5LB 2Z4QB 5JHLH 2WBJC 4KRPB 1BZ9B 4FQ1L 4GKNA 5FYKU 5M7QA 1YUHB 4HLZH 3MRHA 3T0VA 4WW2F 1L7TL 4EOWL 2VNCA 2NW2B 5IMKB 4JG0H 1L7IL 1BQHG 4UNTA 3CC5A 4RGND 1VENA 3C6LD 4ODHH 1GAFH 3SBWC 2AABL 1T5WA 3CXDL 3FB7B 4NM8L 2DYPA 3BT2L 5CZVL 4JDVB 1YPZB 1RIVL 4Q7DA 1CQYA 1RJYB 5CMAB 3RAJL 4LSVH 5IVOA 2YA1A 1G7MB 5CJQL 2I9TB 1Z2KA 1INQA 1U8HB 1U58B 1AD9A 3L3JB 1VPOL 4PJBA 3TZVD 1K3IA 2V2WB 5HHPB 3H0TA 3ZKNC 4K7PL 3LS4L 1YEIL 4OLYL 3VFTA 2Z8VC 3P9LA 3MLXL 3VGFA 3UBXA 1MCFA 1I1YA 5DURD 5TQ0L 4OF5A 1XR9A 4XMLH 4DGVH 5KVDH 5L0QB 3K8MA 5JPMB 2ZUQB 5CUSH 1OT1A 1QO3B 2EIZB 2VDPH 4WUKL 3SDXB 2FEDC 1FDLH 1OT2A 1SBBA 3SE8L 1MCPH 1KEMH 4NKMB 3QDME 5A2FA 2DQJL 3QCVL 1HYSC 1PJ9A 2XRAL 2XZCH 4U6VH 5EZIL 3MZTA 2IEPA 3C2AL 4LCUB 4QTHB 4WY7H 4K7PY 4X6CE 3T4AA 3DARA 3C8HA 3PWVB 1N5AB 5F89B 3FJTA 3NCEB 3IXTB 4AM0B 1IBGH 2H32H 2P46B 1PGRB 3BP5B 3C08L 5KN5B 1FNHA 2Y7QB 4QRPB 1DN0A 3RKDC 4QCIA 4X7TB 5CGYD 2YD3A 1MHEB 4YHZH 2DWEA 5IM7A 5KSAA 1LO5A 5BV7B 4X99A 3IFPB 3FQNB 1LDPL 1EFXD 4CMMA 4QT5A 1MRCL 4R4ND 4UNVA 1HIML 1A4JB 3VFOA 2XQBL 3BGAA 1UG9A 3TIDA 1J8HA 2MHAA 2VUYA 3TT3L 1L6ZA 1KTLA 2P5WB 4HEPG 4QRQA 1PKQA 5J0BA 1T22A 4ZAKD 4ISVB 5A3IC 1GHFH 1DL7L 2H26A 4TYUA 1PZUB 2VQ1A 4KKAD 3LN4A 3OF6D 4HSQA 3ISWA 3TNNA 3EFFA 5JHDE 4ZD3L 2QQQA 4F3FB 3QULA 3HC3H 5I1HL 2BHYA 5IGXH 1QA9A 3NACL 1XF5B 2HFFB 4P23D 1A7OL 4YAQB 4MVBC 3UAJC 5GISL 4JO2H 1HSAB 2NZ9C 1K4CA 5IESL 1T1ZB 1MFNA 2FWOA 4XCEB 2Q8BH 1UKTA 3VG9B 4H88H 1O7VA 5CCKL 1K2DB 3A0OA 1U8OB 4LASL 1MAMH 3KYKL 1MCOL 2X4TA 1F3JA 2BRRL 1SJHB 4P3WA 3WLWD 4EBQL 2ICWJ 1JNLH 4PR5B 3FRPG 2FX9H 3GFUA 1RUQH 4RIRA 1UJTA 1JHKH 1BVKA 3BZEA 4TSBH 1Q1JH 4FFVC 1I85A 1K6QL 4CU7A 4Y19B 5I17B 3RX5A 3ZYZA 2BC4A 2Y72A 2VLRB 1ZLWK 3W81A 3SE4C 1BPVA 3DMMB 5HY9B 3MJGX 5IW1B 4GAGH 1JYXA 1QQDB 1P1ZB 2VWEE 4UBDC 2FO4B 3H9SD 3HS0B 2IGFL 1KIPA 3MV8B 2UZIH 1ZSDB 1JHTA 3BSZL 3DSFL 3RWGA 1T89C 5H2BA 4UT7L 5ENWB 1FJ1B 1WF5A 4ZO8A 4GW1A 4L4JA 3C60C 2PO6B 3TCLA 5ICZB 4QGTA 3OKEB 1EXUB 3F8UB 1JCKA 4YPGA 1WGOA 1AJ7H 2YK1H 4JRXB 1RULL 1FPTL 3MV11 2LABA 5F3BB 4Q2ZA 4L4VA 4WW1B 4XP6L 4Z7NE 3SDCD 2MPAL 2XKSA 4LBEA 3B4NA 4J4PD 5GSRB 4Z7UE 5E08H 4BFBD 4R0LB 1S9VB 2FZ3B 1BX2B 2FR4B 1UM5H 3O2DA 1ZA6B 5LWYL 3W0WA 3U36B 5IF0B 1QFHA 5DYOB 3GMMB 4YR6A 4N0UE 3VFUB 2WIMA 3HI6L 4KK8D 4PRPA 5AUMA 1JRHL 3VFPA 2GJ6D 3OSKA 4U6YA 1HHGA 3QFDB 3A6CL 5KANG 2BSRA 4XCCL 5GRWA 2AJZA 2I25N 5JXAL 3WXWL 1E6JL 2EH8H 5LAXA 3C8KA 1LO0L 4XTRD 4QXWA 2DKMA 3DETD 4KVCL 4HS3B 3RVUD 1OWWA 2VABA 5CJXC 1YJDL 1I9IH 1FNGA 4GKSB 5DJDA 5IEHA 1JHLH 1UM4H 2O61B 43CAA 5AG8A 1ZLUK 5GS2H 3SPVA 5EZOH 5BQ7A 3G9AB 5FDYA 5J6GB 3DO3A 4JGMA 1OAXH 2YWYA 4KJPC 3E2HC 5IMLA 3BPLB 3I75B 1RJLB 3TVMB 1BM3H 2IPTH 3MRGA 2CRMA 4TSCH 1A14H 1G9NH 5HDQH 2K7PA 1A5FH 3NN8A 1KCRL 5EG6C 3BEWA 5DMKA 1HHHB 3MYJA 3L3OA 5CP7A 4MS8C 4Q58C 5DJ6A 3STZB 4MB3A 1VFUA 1W8NA 3G5YB 1KTRL 1T0MB 1HXMB 2Q7YA 4M5YL 4FNLH 1QBLL 2BNRD 3O2VL 5JUEH 3VXSB 3QNYA 2I5YL 2JIXB 3PQYE 4QOKA 2HAZA 5EC1A 5LG1A 3Q6FA 3S88H 4JVWA 5LBSL 3REWB 1NLDL 4PJXA 5BJTB 4PUBH 5J12C 3M1BB 2XNAA 3GNMH 4PBVC 5D5ME 1NGPH 3L5WB 3EO1A 2XPGB 4ZUSA 4HMCA 1EAPA 3BIAX 1YMHB 3MLRL 4P2OD 4BFEA 4Y2OA 1Q0YH 4QKXB 1QR1A 1AQDA 5DEGB 1BZ7A 4MMXC 5IMMB 5C09B 2HTKC 3BUYB 4OKVA 4F33A 3CC5B 4XXDA 5CD5C 4UOJA 1S7VB 1NMBH 1TJGH 4XWOC 6FABH 2ZPKH 2ZZUT 4KZEH 3U1SH 2R2HA 2DYPB 3O8XD 4G5ZL 5I1GL 3QUXD 3GB7A 4LSTH 3OKMA 4OBRA 3RUGE 3I9GH 1VEPA 4CVUA 2D7MA 5HPOA 1JWSA 1INQB 1SQ2N 4DKFH 4YDLC 4ZUTB 4E5XA 3DX6A 4HX1A 2R4SH 3OMZA 3O2WL 3KPPA 1AD9B 3WUZA 1GZPA 2R0ZL 4PJBB 4ZTOH 5SWSE 3ZDYF 1A3LH 1IGCH 3HI5L 2Y23A 3H0TB 4OCLC 5GSVA 2ERJB 2AVGA 2FX7L 3GSRA 1FBIH 3C9NA 3N9GL 3P9LB 4O58H 2F54E 3RWHA 3MNZA 3UBXB 3QDJA 4EDWH 4JN1H 4W4NA 1XR9B 4MAYC 4W6XB 2N7BA 5BO1H 3CX5J 2OTUA 1NGQH 5GJTH 5DJXA 1U41A 2F8XC 5F7KC 3BKML 5TH2B 3L5IA 1I7UA 5CJOH 4DUWA 4P2QA 1B0GA 3MLUH 3UTSA 1IGTB 2C3HA 2X9XA 1WEJL 1I8KA 3T4AB 3ZDZE 1D9KA 1B4JH 5EH1A 3OXRA 2JJTC 4X8JA 4MA8L 4POYA 2AJYL 3WV0A 2EDXA 5EOTA 3WDHA 3C60B 4KZDL 2IJ0C 4ZUVA 4IM8A 1DN0B 1VGEH 2GITB 3MCG1 5IM7B 1LO5B 4J6RL 2VDMH 4X99B 4M62L 4CMMB 1XGQA 4QT5B 5C7XL 4EXPX 2GIYA 5HYQA 3VFOB 2HWZL 3EOTH 4PP1C 1NMAL 1J8HB 2BSSA 2MHAB 4UI2A 1KTLB 4N5EC 1JMZA 2DJ4A 4L4TB 1HDMA 4NFCA 4QRQB 4RFEA 4N90D 1T22B 3T3PE 4G42A 1DQTA 4Q74A 4K2UH 4OIBA 4WW2C 4YBQD 2DBLL 2VQ1B 3EJJX 3LN4B 1ZV5A 4X9IA 4DFIA 4JREC 3GSNA 3TNNB 4LRNH 4RRPA 4PRIA 3QULB 2HFEA 3X13A 2R8SL 2BFVH 2X40A 3UTTA 4BM7A 4P9HL 4BK4A 1A6PA 4A2LA 2Y6SC 1TPXC 2NY4B 3KDMA 3RGVD 1WBXA 3UJIH 1UWEH 5KVEL 5KSBF 5ACZA 4CNIB 1IKFH