3THML

Crystal structure of fas receptor extracellular domain in complex with fab ep6b_b01
Total Genus 45
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
45
sequence length
214
structure length
214
Chain Sequence
b'QSVLTQPPSVSEAPRQTVTISCSGNSSNIGRYPVNWYQQLPGKAPKLLIYSDNLRFSGVPDRFSGSKSGTTASLAIRDLLSEDEADYYCSTWDDTLEGWVFGGGTKVTVLGQPKAAPSVTLFPPSSEELQANKATLVCLISDFYPGAVTVAWKADSSPVKAGVETTTPSKQSNNKYAASSYLSLTPEQWKSHRSYSCQVTHEGSTVEKTVAPTE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Fab EP6b_B01, light chain
publication title A series of Fas receptor agonist antibodies that demonstrate an inverse correlation between affinity and potency.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system
total genus 45
structure length 214
sequence length 214
ec nomenclature
pdb deposition date 2011-08-19
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3thmL02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3thmL01
1QTYT 4OLZH 4KU1A 1OHQA 2OR7A 1CBVH 1G9MC 4XC1L 4EXKA 1UJ3A 2VZTA 5HVWA 5DYOA 5DJ6A 4U0RC 1T1XB 1AY1H 4P2RB 4M6ML 5E2TH 5J56B 2VDML 3RVWC 1MCOH 2O5ZL 4L3EA 3DUUA 3PDOA 4XPBH 3BRGC 1BLNA 2MPAH 5HVHB 5IEHB 3WV0A 3VH8B 6FABH 3QIUB 4XP4H 4MQ7B 3MRPA 1QO3A 3MJ8B 4PD4J 1ND0A 4QLRA 1CCZA 5D8JH 4HKJB 2NXYB 2I24N 1BVLA 2PCPB 1FVDA 3WS3B 1OTSD 3LQZB 1T7VA 5DEFB 1U92B 3KJ6L 5E4EC 5EB9A 4RAUA 1HQRB 1BVKB 2GSIA 1RMFL 3EZJB 4NQTA 1E0OB 1XF2B 4G8GE 1TVHA 2FR4B 4MA8L 5HHMD 1FV1B 3LKOB 1YECH 3D2UD 1WQVT 5EO9A 5DD0L 1J0IA 3QUZD 3S35L 5TE6L 4WTZA 1AXTL 4MNHA 1SM3L 3RVTC 1PDKA 1I8IA 3KPRB 3D0LA 5SWSD 3S3PA 4N0CC 3KDMB 3K4DA 3PHOA 4P2OD 3TH4T 5BV7C 4K7PH 4G43A 3AFLA 1FNSL 1RSFA 3RP1A 3CU1A 4IRJA 4KUZH 5F70A 2Z8VC 4M4RA 3ZTJG 1FL3B 4PV8B 1AP2B 1KTLB 2XTJB 2HLFD 4DCQB 4X6CF 2AS5M 4HFWB 4ZSOB 3WYRA 4URTB 5T3XL 3CVHA 2EDKA 1MFAL 4HIEB 4CKVX 3N06B 4ZPVB 1V7NL 2WBJB 3VXUA 1NJ9B 1L9NA 4FOMA 1Q0XL 2AJVL 4Q6YA 1UQSB 3GJEB 5SV4A 2DB8A 4PP2A 4UAOB 4Q6IB 3PIQB 2CUHA 1G0DA 5HGBB 4X6CA 4KK5C 3NA9L 1RIVH 2NX5B 1X5IA 5E2VH 4ZS6C 5JLZA 2A74A 4C57C 1OGAE 4EIZC 2HRPL 1CGSL 1I9IL 4DOHE 3QH3A 5CINL 5C0BB 4J6RH 3BKMH 2CUIA 4XXDA 4OZHE 3GMOA 4RFNB 4F9LA 7CGTA 4WWKA 5HD8C 4XWOD 5ITBL 1WZLA 5GRWA 2YZ1A 4XNQB 3W9DA 4GRLA 4M93C 3BEWB 4O2FA 4M8QA 5L2JA 4KK9C 3X3FH 3AREC 2AP2A 1OAZH 4MD4A 3TH2T 1DCLA 4R9HA 1TENA 4BK5A 2Q86B 5HPMA 5DEGB 5C0FB 4Z7QE 4L4TA 3S36H 1U42A 3PGDB 2I60H 5KW9H 3U1SH 3MRDB 1KIUA 4MDIB 1ZV5A 1YEKH 5DK3A 3IRPX 4OCMC 4NKIH 5E8PA 1ZGLM 5CMAA 3VGHA 4BZ1L 3U4EA 3O6ML 2I5YH 3GMMA 1ZXQA 1G84A 5EO0A 4JFXB 3FCTB 4P57B 4TVPH 4YHIA 1VB9A 4XCFL 3MZTA 4NN5C 3MYJA 2COQA 2VDKL 3BO8B 3T0BA 1MEXH 2OR8A 5F88B 3DUSB 4KROB 1J05B 5BS0A 4GW4A 4PREA 1SY6H 5I8OL 1MIMH 3D85D 4JEGB 2V2TA 4P9ML 4LPXA 3G6DH 3IGAA 3O3EB 4O51A 4U6HB 3RJDA 4L8DA 4RSVA 3MJ7B 3EDFA 1YPZB 5JDSA 2CR6A 1YN7B 3ETBF 4LSVL 1JWSB 5ICZA 2R2EB 3G5ZB 4NOBA 4Y16A 1OF2B 3IFOB 3B2UC 3JBG7 3BPLB 2FHFA 3QFJB 2N4IA 4HZLB 1KV3A 3R0NA 4P2RD 5I8EA 2DYPD 1RULL 3GIVB 3UAJD 5E94A 5BO1L 5E8OA 2YBRA 3GHBL 4O00A 4LL9A 2VLLA 4XP1H 4YXKH 1QRNA 2YR3A 4O4YH 1ORSB 3QIWC 4FZ8H 4YE4H 2UZIL 4HKXB 5C0CA 2C4FT 2DKSA 4LHUD 4YGVB 4FQCH 4OLZL 3VFTA 1A6ZA 1CBVL 4A2MA 2VLKB 3PGCB 5C7XH 5JIKA 5HYIA 2C1OB 3WBDA 1AY1L 1UACH 2D4FA 3TESA 4OZIE 3G6JF 3QAZB 5E2TL 1MCOL 1NCAH 3HZVB 32C2A 5IESH 2GAZB 3ZL4H 1HH9A 4EI6A 4XPBL 2AV1A 2MPAL 2D7QA 1CXEA 1CG9A 1PY4A 5DXWA 2ZG1A 6FABL 4XP4L 3KPRD 1MHCA 3TCLB 3IDYB 5D8JL 4BH7A 3HFMH 2KZ1B 3RA7H 3VXME 5HY9B 3MV7B 1CFNB 3HA0A 1DQJB 1T22B 1P6FA 1GC1C 1T2XA 2MOVA 3G6JA 5TDPB 3CSGA 3Q6GH 1LEGA 4XCYA 4PJBE 2JJSC 3EW3B 3QXDB 4YO0A 3VXQA 3PWPD 4H1LA 2NY3C 3CDYA 4UIKH 3U0TB 1D5ZB 3VXTB 1AGFB 1IGCH 1YECL 4YHNB 4KMTH 5D7LB 1GGYA 1FZKA 3L7EA 1XIWD 1T89C 1ONQB 2MQCA 2ZP0T 3SE4C 3MV11 5ESVB 3O4LB 1IE5A 5DMIH 5HI5D 3ULUH 4K7PL 3B8SA 2NY6C 3T0WA 1OB1A 4KUZL 5IMMB 1CTNA 1T5XB 3RWFA 4D8PB 1BOGB 5LAXA 1RIHH 3P4NB 4V1DA 1KB5H 3NCYS 2XKSA 5DK2B 5C0BD 1NUDA 1CU4H 2EEBA 2PW2B 4YDJA 2EH7H 3O3BB 3TIDA 3QZWB 3WFDH 2DIAA 5IR1B 2ZG2A 3BZFB 3QQ3A 4XNZC 5JA8B 2WK2A 1ED3B 1EHXA 2BVTA 1ZLWH 5BQ7B 3MR9B 4BFGA 4TTDC 1IC7H 3UDWC 3VFOB 1A6TA 3P4MA 3F62A 5DSCA 3U7WH 3EO1A 4OI9A 3HLAB 4PJ7B 4R90H 5HHVH 5T3ZD 1RIVL 1CD9B 5E2VL 1JVKA 1XF4A 3FFDA 2ICWA 3IDIB 3GRWH 3RIFF 4GBXD 1IM9A 3MX0A 4E5XA 3D25A 2BVQA 4J6RL 1Y18B 2C7UB 5EIQA 2X4RB 3BKML 3QDHA 1S9WB 5T3XE 4C56A 1II4E 1ZS8B 2DL9A 1U58B 4BSVA 2YSSA 5B22A 1Y6KR 3KPLA 3DRTA 3FB8A 1BD2B 3UYPA 5KSVA 2Q6WB 2OJEB 2ICES 3X3FL 3KLHC 1RJLB 3BYYA 3N9GH 3OAUH 4JFQA 4IRSC 1OAZL 3RTQA 1WWAX 1UJ3B 3OTTA 5EOTA 4BUGA 1D5MB 5C9JA 2BERA 3BKJH 3UJIH 3S36L 1PSKH 5C3TA 1ZLVK 1KXQE 2I60L 5KW9L 3U1SL 2R1WA 2VZSA 2HT3C 3B3IB 1RHHA 1ZLSH 2BNUA 1YEKL 4H25B 4I13B 1J0YA 1AFVH 2EDEA 3MV8E 3C5ZC 1IC5H 4NKIL 4EUPA 3H9SE 3ARRA 2AJXH 4OGAC 1P1ZA 1RHFA 4HUNB 2I5YL 4HKBB 5H94B 3OKMA 3V2AR 2R2HB 1MLBB 1ZOXA 3QFJD 3GBMH 4YFDB 1XF5A 2ZOLA 1MEXL 4YIQA 3V5KA 4AIZB 1DQQB 5DQ9B 2IFFH 4B41A 3P73A 5DTFA 1KG0A 1BZQK 1SY6L 4NNYA 4CU7A 1MIML 5IKCB 1S7VA 4MX7B 1B9ZA 3G6DL 2GJ6A 4QWWC 3TBTA 1TQBC 3BPCB 1WT5A 5EPMA 1KB5B 1JK8A 3GMLB 4QYOB 2C4FU 1BJMA 1DN0B 1CDBA 1T4KA 4G43B 3A6BH 5TDNB 1VFAB 2AW2A 4NPYA 5DD1H 4DW2H 1FZOA 2VLKD 4KZDH 2GKIA 4N8VA 5EUOA 3UTZB 4DN3H 5HBBA 1SJHA 5JHDB 4JFHD 1RK1B 1IGTB 3HZYA 5FGCB 3T0EA 1GGIH 4L4VD 5C0GB 3CDGB 2V5RA 2QSQA 2FIKA 5IHZA 3ARVA 4MJ2A 3MNVA 4XP1L 4ZSOE 4YXKL 4O4YL 4HMCA 4LOUD 2KBGA 2FCBA 4LLWB 5C8JA 4FZ8L 1Q9LB 4YE4L 5JPNB 4DZBB 3MA7B 4FQ1H 4IMKC 4FQCL 4PJCB 4U1GB 2R2CA 1MVFA 1XGUB 5IW3A 2VQ1A 4GW5A 3FONA 5C7XL 4CNIB 4KGJA 1MHEA 1NDGA 3EAKA 1AKJB 5DMKA 4NUGH 3RL1A 2O61B 3H7BB 2HH0H 1HCVA 3OJDA 1UACL 4AH2A 5D7LD 4CVXB 1NCAL 2QQKH 5DZLA 5IESL 5D6DC 5EZLA 3ZL4L 5SX4I 4I9WD 3IDUA 1BGXH 4WUUD 4XNUH 2OZ4A 4X5LA 2VZ1A 1XZ0A 3HFML 2VAJA 3RA7L 3QFDB 1JV5B 3MJGX 5EBMB 3TJHD 5IB5A 4ZTOH 5HYSB 2W07A 1V8HA 4PJ9A 5M95B 3Q6GL 3TO4D 4KJWC 4R26H 3MFFA 3TN0B 2YUVA 1EUUA 4ETQB 3FB6A 4UIKL 3C60C 2HN7A 1QR1B 1XR8A 1G9NH 2XOTA 1IGCL 3CLFH 4GW1B 4KMTL 4YZFE 3TT3H 1A7NH 3X14A 5CD5C 4J3TA 4NQCD 5K9QI 4X7TA 4JVPA 4WTWA 4TUJA 1ZLWK 4PRHA 1I7ZB 2DI8A 4I0CC 3GUTB 1I1YB 4HCRA 2QKIA 5DMIL 3U4EB 3ULUL 4JRXA 3RWJB 2E9BA 3K3QA 2IC2A 1U8QB 1P84J 4D0DA 2CSPA 2VR4A 5T33H 1RIHL 1KB5L 4WI5A 1N3NB 4KDTA 4X5WA 1BX2B 4HK3N 4M5ZH 2BXYA 1CU4L 5I74B 1CDHA 5F1NB 3IVKA 3QPQD 1NC4D 2EH7L 4FQQA 5FYJD 1NGZA 3MZGB 3WFDL 1WWCA 2LV4A 5EBWB 5SWZB 1S7XA 5C0IB 2EYTA 1A1MA 4L8DB 3SY0B 1D5IH 1S5HB 5SX4H 3HZKA 3MNZA 3UTQB 5KANG 4TNWK 4WHTB 1IC7L 2R0KH 3U7WL 3LCYA 4RMWA 4R90L 5HHVL 1CZ8H 4X8JB 4Y16B 5CZXD 3W11D 4D2NA 5JNYA 4FQXB 3GRWL 1YPZE 1LE9B 2H26A 4F8QA 5ALCH 4IOFD 4KJQD 3KVQA 3T3ME 4L3ED 1IAOA 4PRBB 2QEJA 5J0BA 3KS0J 4MB5A 4RMTA 2VQTA 3N1PC 4PJAB 5F6HJ 1HN1A 4M7JH 3CUPB 3EYVA 3QUKB 5CKAA 2X4SA 4RFEA 2W65A 3N9GL 3OAUL 1DP0A 3QB7C 3VFTB 5IIEA 3CFBB 2BC4A 4KKAD 4D0CB 4NO2B 1QP1A 4L8SC 2ED8A 3G9AB 3BKJL 3UJIL 3KR3H 4PRNA 1PSKL 4LCUB 4HG4J 2IMNA 4HDIA 1F8TH 32C2B 3GJFK 1ZLSL 4NN7C 1FFOB 2AV1B 4RRPA 3GSNH 2DBLH 1AFVL 5IF0B 4G9DB 3VFMA 1IC5L 3EDKA 3S97C 3QIWA 5IGXH 1FGVH 1J88A 3MXWH 3QUXA 2JCCB 2AJXL 3VI4F 4YDIH 1L0QA 2B20A 1MCSA 5E6ZA 3WFHB 5F89A 3VGAC 1AC0A 1YY8A 4XCYB 4XCNA 2P24B 5EO1B 3GBML 3IXTB 1VFMA 1G7QA 3H3KA 3WL9B 1HOCB 4F7MA 3MV7E 2R15A 1J86A 2Y6SC 5C92A 3MUHL 2P8LA 3VXUD 2XZCH 4F7PA 5J1TC 1C7SA 5JXEA 4C59B 1JNLH 1NBYB 3JUZA 5GGVH 5LBSH 5MENE 3U30C 3L1OH 4BK4A 3Q5TA 4JFPA 4NIKB 4HKZB 4Z76A 4ZTPH 1NC2B 3A6BL 2JJSA 4MGXA 2NY1B 3ZO0A 4YDLB 4TVPE 4JFEB 5DD1L 4KZDL 3NN8A 2H32H 1Q9OB 3K7UA 1IAKA 3O4LE 3HE6A 5DLMH 4DN3L 2NY4B 4XHJC 4KAQH 3TIEA 1GGIL 4G8EB 1BAFH 1UYWH 2DQEH 4G9FA 3D39E 5HI4C 4HT1H 4GRLD 4Z0XB 5GGSA 4D9RD 3SE4A 2QL1A 2DOCA 1MFEH 4MCZA 5DHVB 2NW3B 2ZUQC 1SJVA 2XN9A 2FBOJ 2CLVA 5JW5B 4WTXA 4FQ1L 3E6FA 3N0PB 3LDBC 5ISZB 3SDXB 1I1RA 3H3PH 4L4TD 4E5XB 2A38A 4KJPC 4C58B 5FAAA 3TN0D 4NUGL 2XXCB 1UG9A 4OD1H 3RDTC 2HH0L 4PGCA 4PJ7E 5CEZD 5I1HH 3DRQB 2P8PA 3JTTB 2BDNH 4HK3J 4M61A 5JW3H 4PLKC 2QQKL 2YSSB 3H0TB 4IS6A 3DRTB 3FB8B 3OGOE 5DHXB 3RUGF 5HHXH 1BQSA 3UDWA 1BGXL 3BHBA 3MFGB 4XNUL 5KSVB 3HMXA 4RGOH 3NBNA 1HSAB 3O6FB 4ZTOL 5F3HA 1C16B 1BD2E 5FUCC 5IW1A 3T1FA 1T2QH 3D18B 4YXHH 3RUGA 4R26L 3QIBA 1K4CA 5J6GA 1G9NL 1OCWH 5TQ2H 3CLFL 1RHHB 3FT3B 3TT3L 1A7NL 1EEQA 4ZAKB 5GRYA 2NXZB 3VU2A 1IKNA 1ZVSB 2FHCA 1YJDH 4RISH 1U8HA 3ARDC 3VJ6A 4IRSA 4Y16D 2L0DA 1LQSR 1Z6JT 3GI9H 1IGMH 5EIIB 1CE1H 5SWQB 3C08H 3UBXI 3BP4A 2WP3T 5T33L 3TNNB 4G7VH 2RB8A 4M5ZL 1QLRA 3ZHDA 5J13C 3P73B 4UQ3A 3IAQA 4JQXC 5CBAB 2AXFB 2B8OT 2FLRT 1FRGH 4UT7H 3TBTB 5E1HB 1D5IL 2ICWJ 2VERN 4U6YA 3GSXB 1QRND 3RBGA 4H5SB 5BXFB 4LF3A 1QZ1A 5HHNB 2H32B 4JM2A 2R0KL 4QHKJ 3P77A 5C0CD 2HT4D 3ULUE 2HTKC 1CZ8L 2F54B 2FX8H 3NABH 3KLSA 4NPYB 1SEQH 3HRZA 1FZOB 2I07A 5DC0A 3AS0A 5EUOB 5ALCL 3MXVH 3KYOA 2X1PA 3T0EB 5EBLB 1A2YA 3RWDA 1MHHA 1JFQH 1XFPA 5EOCJ 1G7MA 3EJZC 1JTTA 3WMSA 2DWDA 5IHZB 4JAMA 3N85H 3IKCA 1ZA6A 4RZCB 1JGEA 3EDDA 4M7JL 5JHDE 3CXHJ 1RPQA 3QXTA 4XAKE 3OR6A 4UINH 3WJJA 3KNBB 3VDAA 4CVZB 1G7HB 4GW5B 2OSLA 4AYFA 1DBMH 2GW5A 4MDJB 3BKCH 4F8TA 3KR3L 3GO1H 1HHHB 4Z18A 1P69B 4FZEH 4HLZG 4PJCE 3GSWB 2VLRE 4JZOA 1F8TL 4LQFH 4YFLF 5HVFB 1QPPA 3GSNL 2DBLL 1TJIH 2YKLH 1RK0A 4NP4H 2YUZA 4R97B 2AJ3B 5IGXL 1XZ0B 4UOW1 3MXWL 3ZDXF 1BFOB 2B5IB 1ADQH 3JV6A 4GKNA 4YDIL 3FQUA 5IK3A 1OAXH 2NY1D 1D9KC 2Z93A 4CDGC 4V1DD 5B8CA 2E7HA 4GKSB 5E8NB 2QQNH 1FO0A 5E8EB 3FHAA 4IBLT 3E3QE 4Y4KC 3ARPA 4RGNC 3HAEH 4HIXH 3C6SB 4LMQE 5ESAA 5DUMH 4A2LA 2XZCL 2H9GB 4ONHA 1JNLL 1L7TH 1NANI 5LBSL 5GGVL 4TSBH 3WS6C 4MLIA 5DMGC 3L1OL 1CICC 2MCG1 2X09A 3WLBA 5D2LB 4ZTPL 4ZQKA 4I4WB 5DGQA 3SQBA 1SEBA 4XBGA 3CFKB 1T6VN 1IM9D 1OGTA 4TVSa 1JPGA 3PABB 5GRXG 2CO6B 5DLML 2VO5A 4WCYH 1FAKT 4XBEH 4KAQL 4C56D 4XB8A 1CE6A 3FOLB 1V05A 1BAFL 1UYWL 2DQEL 3SDDC 2EYTB 4KRMB 4HT1L 3VRLF 5I71B 5MI0C 1DBAH 1MFEL 5MHSD 2MQ0A 1ODAA 3DX6B 2DD8H 4Y19B 5B4MD 4F33B 3WUZA 2EDHA 5SWZE 5TDOA 2A1WH 2DTMH 4F15B 1W8NA 1QLFB 1UXWB 3RTQD 4LHQB 4UQ2B 2JB6B 3H3PL 2CKBA 3EOTH 3AY4C 3C8DA 4OD1L 4QRPB 5I1HL 4X4YB 2DQFB 3SDAC 1EAJA 2BDNL 5JW3L 2NR6C 4M02A 1YEFH 2QSCH 4ZAKD 5F9OH 3V0VB 2NXZD 5HHXL 3BIAX 3ARQA 3SJVB 4M9OA 3UTTB 1N0LA 1S7TB 2W60A 2EEDA 3EYVB 4RGOL 4ZO9A 3VCLA 1PQZA 2W65B 4CVWA 5FEBA 1WZKA 1AGDA 1C8PA 3PHQA 2R29H 4U1HA 1J0HA 5C3LD 4CADB 1EFXB 4MQXC 3NIDE 4PJXE 3R8BB 5DJ2B 4R7NB 3HHRB 2P8MA 1WK0A 2O5YH 4C55A 5AAWA 5ID1A 2ITDB 2IALB 4Z0BH 4YXHL 1JPSH 4GMTH 5DJ8A 1OCWL 1S7UA 2BOBB 5TQ2L 2VDQH 1OP9A 2GJ6D 3BP5B 4OD2A 1T80A 3O11A 5A3ID 4R7DA 2DLFH 1YJDL 1RZ8B 3KPPB 3OR7B 3OSKA 1J12A 3QUXB 4RISL 2Z8WC 1EXUA 2X4OA 3S5LA 2Z31A 2NTFB 4NQEA 3GI9L 4EI5A 2JLLA 1YY8B 3HAEB 2IANE 1IGML 4W70A 1CE1L 4NKDB 4XCNB 3CSPA 3FRUA 3C08L 4CL7A 4ZFZB 4DFHA 2FSEA 4G7VL 3T0ED 5CEYA 3I3DA 5LVEA 5DO2D 1QFUH 1JF6A 3V6ZB 1FRGL 2E8ZA 1BIIB 4UT7L 5DVKA 5F1IA 4TRPH 4Y5XC 3TYFA 3L3OB 1ITCA 4HUUB 5DT1H 1KYOK 3PQYE 1ZK9A 5AD0B 3AS1A 1A6PA 1NBQA 3Q3GA 4JFPB 1L9MA 4APQC 2JJWA 4LPTA 4Y5VB 1Z5LB 4JFOB 2FX8L 3NABL 1MUJB 1SEQL 2ADGB 4S1DD 5INCA 3C2AH 3HE6B 3P40A 1EA9C 3MXVL 3RNKA 3VMNA 4N9GA 1YEIH 3GSRB 3BP7A 4I3SH 4XVUD 1JFQL 4QOKA 4JFEE 4Q9BA 4TTGA 1CFQA 4NZRH 3ES6A 3N85L 5JOPE 5L2KB 5D1ZC 3IDNA 3PWVA 2JK5A 5C09A 4HS3B 1WZMA 4XP6H 2SEBA 5B3JF 3VI3F 3DGCR 2VABA 3HPJB 4RNRA 2ZNXA 4Z7VE 4UINL 3RVXD 5DI8A 4PJ9D 2LTQC 5LKNA 3QHFH 2XI9A 3MRCA 4FFYH 4OV5A 1DBML 5I1AB 1WAAF 5LXGH 1BVZA 3NFSH 3BKCL 4LP4A 3GO1L 5HD8D 4NWTH 4FZEL 2IQ9H 1TZHA 3UZVB 4CJ1A 5ISZE 4LQFL 3JXAA 3SDXE 1FC2D 4LKCB 4GXUN 4NT6A 1TJIL 2YKLL 3JTSA 4NP4L 4PRHD 5FKPB 5D1QB 5HDBF 4JRXD 1ADQL 4KK8C 1WAAA 3LQAC 4J8RB 4P2QA 4HS6B 1OAXL 4GXVH 3AC0A 5F3HB 1NKRA 5CFHA 2GY5A 2MTPA 3RDTA 4FS0A 3BZ4B 3TBSA 4J12A 2WWKT 2QQNL 4NO3A 3T3PE 1K4CB 2ICCA 4NQSA 5I0DA 4PGJA 5J6GB 1LE5B 1F3JA 2DM2A 5J89A 4HIXL 1MCWM 5DUML 4JDVB 1LK3H 3BPOB 5FYLD 1L7TL 3VFRA 1CN4A 1K8IA 3PP4H 4TSBL 1F2QA 3SDCB 3H3BC 1UH4A 4MXQD 3HPLB 4Z7WE 4FHBD 4PJHB 2XFXB 4JJ5B 1FZMA 2ZOKA 4QT5A 3H8NA 4Y88A 4MA1B 1KC5H 5KG9B 3VD3A 3MYZA 4OT1H 3BP4B 3ARUA 4QRPD 5MEPA 3MCLH 4WCYL 5CHNA 1XMWA 1L6ZA 4XBEL 4GOSA 3BQUB 2H2SD 3CFCH 2RIKA 4R0LA 1Z9OA 3MJ9A 4MJIA 3SJVD 3UTTD 1KIPB 1TETH 4KTYA 3ARDA 1I7RA 1DBAL 4CMMA 4JG1H 1Z9MA 4JM2B 4G6KH 5C0AE 4ERSH 3O2DH 4KI5E 4UTBH 1KCLA 4JREB 1WC7A 1KN4H 2JIXA 2HJLA 2A1WL 2DTML 1GOHA 5BVPH 3QCVH 4G6MH 2ILLA 1UGNA 3UJJH 1KIQB 2XRAH 1D5BB 3EOTL 5MEOB 5F6IB 3CCHB 1H3XA 2GUOB 3WXVH 2F54E 3CMOH 2J6EA 4RGMC 3L3GB 3VMPA 2QSCL 1MAMH 4YBLC 2ZJSH 5F9OL 4R4BA 4P2CG 1TTGA 3MQIA 2A6KA 1DL7H 1JGEB 5E6IB 3VFGH 3QUXD 1J8HE 5ILTH 4XXCC 1FYTA 1YUHB 4NO5B 2R29L 5F7DA 5DFVD 3F7RA 3VFPA 3VFNB 3BWUC 1T2JA 2H6PA 4H88H 5EULV 3AVEA 2O5YL 1CFSA 3ALPA 1I75A 4QRRB 2CRYA 4Z0BL 1JPSL 1S7QA 5D9SB 4GMTL 1H9VA 3TA3C 3T2PA 4WHYH 1EO8H 2VDQL 4NKOB 5JXED 1IJ9A 4U7MA 5E8DH 1GGBH 4KKNA 4JDZB 1T0NA 2R0WH 2KDGA 2DLFL 1QPXA 4MZ3A 3OKOB 3RAJH 3U6RB 3JV6B 3NOIA 1NPUA 1DQDL 1HZHH 4HIJB 1ZT7A 1ES0B 4NC0B 1AGCA 4G6FB 3QPXH 3HE6D 1RIUH 1FL6A 3MBEB 1FYHB 5CGYD 3IU3A 1BBJA 2CGRH 1QFUL 4FFWD 3DXAA 4G9FD 3HKFA 3NACH 4TRPL 4LASH 3CAFA 5HHPB 3QUMB 2BY3A 5DT1L 2IPTL 2VDPH 1I7TB 4NC1E 4YEEA 4YHYC 5DQJB 2XN9D 3RPKA 5F7YC 4UI2A 3AXLB 2R23A 3O9WA 1G6RA 1DANT 2DAVA 3L3DB 5EA0H 2VZUA 2CR3A 3SCMB 2F53B 4XBGB 5C07B 1FE8H 4U1MA 4DUVA 4BFEA 2XPGB 3LD8C 3AU1A 3C2AL 1EHLH 3QQ4A 4LLVB 1YEIL 4IMLB 4QRTA 1KGCD 5FOBA 4I3SL 4IDJH 5HJ3B 3QXWA 5FB8B 3H6JA 1MJUH 4TTDD 4NZRL 1D7FA 4L9LC 4BYHA 2ADIA 4ZNCD 5D1QD 4XP6L 1H15A 2DM7A 3DURA 3UTSA 3CD4A 2EH8H 2ED9A 4LLYA 1JWUB 4Z77B 5A40E 1I1AA 3MRBA 3IYLW 3T77A 2VZOA 3PNWB 3WUWB 4TOYH 5DJ0B 3QHFL 4FFYL 3ZE0F 1T21B 3ALXA 1F13A 2VN4A 5LXGL 5CILH 1OT1A 3NFSL 3QIBD 4P5KB 1N5YH 4Y19E 4X0KA 1U8LA 4NWTL 4EBQH 2IQ9L 3V4UH 1QEWB 3K8MA 5EU7C 1N2RA 3AAZA 3FT4B 3HZMA 2DWEA 1G7IB 3A6OA 5FO7A 4PLOB 1M4KA 5HHQB 4Y4HC 3CC5A 5I2IB 3FN9A 3V6BR 2YD3A 2B2XH 3O4OC 4ZO7A 2F15A 4DZ8B 5J9PB 4GXVL 2UVFA 4JRYB 2GT9A 4FXLA 4HHAA 1HNFA 1FNHA 3INUH 3D3VE 3PXHA 3BQUD 3W2DH 1FQ9C 5CWSB 2NZ9D 4NQDA 2HAZA 3WFBH 4QCIB 3HR6A 4ZOEA 1LK3L 1J11A 5ETUA 3PWNB 1IQDB 4YR6A 1LP9E 1JGLH 3QDJE 1JZ3A 3O11B 1V3MA 3PP4L 4PRPA 5JO5B 4JM2D 3RZCC 1BFSA 2J2ZA 1EXUB 2IG2H 4OLXH 3BFOA 1I8KA 2NY0B 4EI5B 3CH1B 3VD9A 1KC5L 2APBA 2W0FB 5F6HI 3UROR 1QHPA 4OT1L 1MREH 2W0PA 4IHOA 4JVWA 3MCLL 1YEGH 2OP4H 5CEYB 4GQPH 1RZIA 4FXKA 3CFCL 3SKJH 2CDEA 3WJLC 1FVCA 4CMHC 3X11A 4I18A 3T08A 1TETL 2NW2B 2X4NB 4Z95H 4NM8H 5D96B 5ACMA 1G1YA 4GAFB 4R96A 4JG1L 5F7LB 3SBWC 5IMKA 4G6KL 4ERSL 3O2DL 2P4AB 3BMWA 3RZWA 5L0QB 1KN4L 5BVPL 3BVNB 3QCVL 4G6ML 4QF1A 6CGTA 3RWCB 1LD9B 1NGPH 3OJMB 5EU6B 4N0UA 3UJJL 4QRRD 2XRAL 5D93C 4GKOA 4RAVA 4R2GB 2VTFA 2VE6A 3O8XC 4EIGB 5J11B 1I3RA 4QHUB 5T1LA 4OFPA 5FGBA 4UIMB 2CDFA 3D9AH 2NY5H 3CMOL 4JFDE 3WXVL 2QHRH 4WW2F 4Y5XA 5FHAH 2A83B 2HVKA 1MAML 3NIFE 2ZJSL 4PRDA 2DQDH 4P9HC 4Z6AT 2BRQA 2EE9A 2IAMC 3MGTA 3DSFH 3IDNB 1DL7L 4WO4B 2ICEA 3CDFA 2BCKB 3VFGL 2N7AA 2WSKA 1E4KA 2SEBB 2IPUK 3RVUD 2FECI 5ILTL 3MRQA 1WJ3A 3PWJB 2F74A 1OAKH 1OP3H 5DI8B 2BNQB 5ENWA 3SKNB 5L2KE 2Z4QB 3KS0H 4U1SB 4H88L 4WW2A 1P7QB 5DJYA 3VE0B 4X6DB 1F4HA 2X44D 5GJSH 4OBSA 2YZ8A 1R5IA 5CEZH 1EO8L 1YMMB 2YPKB 4PGDB 4PJGB 1JGVH 4JRWA 5D1ZA 5E8DL 1GGBL 1Q94B 3L3IA 2GJZB 2R0WL 4YBHA 3QWOA 2AK4E 1DANU 4LLQB 5C0DB 3RAJL 5EU3B 4O2EB 4OGYH 1W0WB 1W72A 1R24A 1HZHL 2OLDA 2WWMD 1QSEB 1KF9B 2HJKB 2M2DA 2P5EA 1YDPA 4N1HB 3S6CA 2DLTA 1S7RA 3QPXL 5CAYB 1RIUL 4EVNB 2AKRA 4RBPH 4NQSB 1FORH 3ISWA 3WHXB 2CGRL 4HC1H 1NCBH 2V7HA 4LVNC 1EVTC 3W39A 2WLYA 1U8OA 3NACL 4LASL 4U3XA 2R0ZH 5KSBA 1V5JA 5GGTA 2ESVB 2XZZA 2VDPL 1P9MA 1A4JA 3F7VA 1AGBB 3GSUA 5BVJB 5K33A 5F8QC 1AO7B 3VGDA 4DGYH 5EA0L 2J1KA 4D0BA 4P46C 5H35A 3ABZA 1X5GA 3LKPA 2WV3A 3G5VA 1QFHA 1FE8L 1Z9LA 2EDYA 2R1XB 1CLOH 1ETZB 1CDGA 2XZQL 1IEHA 3TPUB 4BFBD 5HGHA 3NPZB 5HYJA 1DUYB 5CHNB 1X6NA 4PJHE 3JV4A 3M17A 3WLWD 5KS9E 2RQ8A 5ITFB 4IDJL 1BZ7B 3RJQB 3BD5A 2YPLB 4N5ED 3RPIA 3QDMA 1MJUL 4WFFD 5K9KB 2D31A 2EH8L 3DWTA 3LKRA 1R5VA 4YC2B 1PEZA 1U8PB 2OL3H 2E6PA 1KJVA 2VITB 2DMKA 4K94C 5C6TH 1AHWC 3NPSB 2YD6A 4TOYL 3KPQB 5LGJB 4QO1A 5CILL 2VMFA 3PXJA 1X5JA 5DGRA 1N5YL 4Z78B 1T1ZA 3T65A 4EBQL 1I1FA 3V4UL 4LVHC 3QHZH 5IQ9B 2P45B 2H41A 2A6KB 1M7XA 1NQBA 5F7WC 5KAQG 2UUDH 1MJ7H 3C6LB 1INQB 3GSQA 1SYSB 5FDWA 3FB5A 2Z31D 3VWJC 2LAGB 5JOFA 3DV4A 4NQED 3GSVB 4EI5D 3VFPB 2B2XL 2A6JA 5FKAA 2E7LA 2ICWI 4U2ZA 4X6BA 4QHKI 5LGHL 1KFAH 3F5WB 3INUL 3QUYC 4LKXA 5DVOA 5FA4A 4MB4A 1YY9C 4WJ5B 3W2DL 4KK6C 5IJVA 4XVTL 4F7EA 1P84K 1CI5A 3V8OA 3WFBL 4TUOB 4Z7UF 3ZTNH 2LAAA 1JGLL 2QADB 4EOWH 2X2YA 5ICXB 1VEMA 2Z8RA 2PXYB 4YAQA 2IG2L 3GEWB 4OLXL 3FHQA 1CD0A 1N8ZA 3FN3A 1PBYA 3MC0A 4CUCA 4H26B 3GMRB 1C08B 2XQYK 3E2HC 3NIGE 2EIZB 1AGCB 1O7SA 3FTGA 1MREL 4KGLA 4R2GD 4DEPB 1YYLH 1FL6B 4Z7UA 3WIHH 5GGUB 4PG9B 2GTWB 1BBJB 2OP4L 3HNSH 3KYAA 2A6DA 3C09C 3SKJL 3L7FB 2VKXA 1WBYB 2B7DT 4ONOA 5J4MA 3X12B 1EGJH 1QACA 3NFNA 4HW6A 1X5FA 4DKEH 4Z95L 1ZHNA 4NM8L 3X17A 5F3BA 1TPXB 2ZCHH 4PP1D 1JI2A 3ZHKA 5D7KE 3TBWB 4XVSH 2UWEF 3LV3B 1NGPL 3MMEB 3NCBB 5GS1B 4NSKB 1A7PH 3LN4B 1LEIB 5F9WB 5L88H 3D9AL 2F53E 2NY5L 4XI5D 2QHRL 5C07E 4HJGB 5FHAL 2OL3B 4BSWB 1SHMA 3MLTA 2DQDL 3V4PH 1B0GB 5FYKD 3DSFL 4FNLH 4K9EH 3ZKNC 4MD0A 2UWEA 4X99B 4A6YA 4HG4K 1A7BA 4P2QD 3BRDA 5EOCH 1OAKL 1KJ2A 3K8LA 2A2QT 5C86A 1JTPA 3VH8G 3OG6B 5TGBB 4J4PC 3ILQC 4AENA 1AR1D 4I2XA 3FQTB 2D0FA 4FXGA 5GJSL 2Y5EA 4LHUG 3EO0A 2YWYA 1G7PA 1UWGH 1DBKH 2LFGA 3I6LE 2ZG3A 1FNGA 4L9LA 5BJTA 1JGVL 3GBLA 1HXYB 1SJEA 3DETD 3HZMB 2ESVD 2RHEA 2DWEB 2EC9T 1H3UA 1B4JH 2WQ8A 5A2FA 2FJFA 2H2PC 4MQSB 5DRXB 4OGYL 1AO7D 3UMTA 3W0WA 1ZE3C 1BF8A 3VXPB 3TT1H 5JHLH 4X9GA 1G9MH 5GSRB 4OLUH 3RGVB 2WINA 4QXTB 4PGBB 4F7TA 1EFQA 1BPVA 4QKXB 1FORL 2AJZA 3WEXB 4HC1L 1NCTA 3MRRA 1NCBL 4ODWA 4LNVA 3TVMB 3L5IA 4MJID 3DV6A 2J8HA 1FNEA 2R0ZL 1CXHA 4PRPB 2BVPA 4OZFH 4Y4HA 4PJEF 4WUUE 3BE1H 1DFBH 4DGYL 1RFDH 2FECL 2G5BB 1PZ5A 4R4FH 3VGEA 4FQPA 4BQ8A 5CBEA 3WDIA 3U46A 4HUMB 1WGOA 3G08A 3UZQA 5CGMA 2GCYB 3T0AA 1A3RH 1U3ZA 1AD0A 3DMMA 3LPFA 1KOAA 5K9OB 1EZVX 3ZDYF 4PJEA 4WFED 1HWGB 3TBVA 1OTSC 4KRNA 1FVCB 4I18B 5AG8A 3QEGL 1T7WA 3RZCA 2EYSA 1A1NA 5F1KC 4MD5B 4CN6A 1FYTD 4K7FA 5BV7H 5E9DB 1CGXA 1KTRL 5DJZB 1VKXA 2OL3L 3RWHA 3TZVB 5BZDB 3QUZC 4OF8A 3TLRA 1EHNA 5C6TL 4NM4H 2QQQA 1G0YR 1HHGA 1JPST 3VFVA 4BFIB 1NAMA 3SGJA 4Y5YC 4HIHB 2B1HH 5DJAA 4P2OC 3IDJB 3WJLA 4KWUA 2R1YA 3QHZL 5EU6E 4YK4B 5C9KA 1MHPH 4XP5H 2Y23A 1HDMA 2HLFC 1OSZB 2ICEB 4IIQC 5LG1A 3MRFA 1MJ7L 2X4TA 3ZE1E 3QWRA 1EAPA 2OZ4H 5FGSA 2VYRE 4WI8A 5IVZB 2HWZH 1AD9A 3O3AB 3VA6A 2Z8SA 3TV3H 4J3OC 3O8XA 3JWOC 1ZA3B 4Y4FB 4ZFFB 3MREB 3F12B 5IB2B 1KFAL 1K4DA 3E8UH 3CFJB 3DXAD 5HPOA 2ZWLT 3KJ4C 2D7PA 1S9VA 2BNQE 4MXWH 4L3EE 4P49A 3ZTNL 4X6DE 3QWOB 4EOWL 4W4OC 4U0RB 3O9WD 5BW7C 1T04A 1YMME 2BNRB 2VXVH 1CGYA 1FL5A 1RV6X 1FFRA 5DUBB 2XT1B 4ELMB 4XWOC 4MJ4A 4MMXC 1YDPB 5F9JB 3EJYD 4JQVC 2FEEL 4QY8A 4PR5A 1YYLL 3WIHL 2VRAA 5DS8A 4WV1C 4P3DB 1NAKH 1QBBA 5HYFA 3HNSL 1UVQB 1JUFA 5DK0A 3QI9C 5IFJB 1EGJL 4OGZA 3RVVD 4DKEL 3DVNB 4E41B 4WEUD 4OLYH 3UTSD 4QGTA 4C4KT 3F7VB 1DBBH 3GSUB 4LVOB 4K3EH 1U8MA 3RIFK 1CIUA 2ZCHL 1I1AD 3IAPA 4D0BB 3HB3D 3P30H 4LSPH 4XVSL 2KPNA 3G5VB 1WCQA 4HAFA 1V3LA 4BQCA 1JNJA 4BKLA 1A7PL 2VSCA 5ANME 5HYJB 3RY6A 1U95A 3VG0H 1DE4B 3JV4B 2GSGB 4OCSH 1GIGH 5BV7B 4LCIL 5L88L 3HC0A 4XCEB 4GG6B 4QRQA 2CIIB 2EC9U 4U1LB 3RPIB 3IFNH 4KVNH 4N90E 4WFHD 1D5XB 5D2NA 3UTOA 3V4PL 3ZT7A 4K9EL 4FNLL 4YPGA 8FABA 4U4BA 4ZUUA 3BIBX 4JZNA 4QHLA 4P46A 3I6KA 3LKRB 2BSSA 4X6CE 5EOCL 2YPLE 1KJVB 3QULA 2YEZB 4QHNA 3CJJA 1DVFA 2FWOB 4PTUB 3RHWK 4NFDA 3M45A 3UZEA 5C70A 1BMGA 5GSVA 5BOPA 3BUYA 4NDMA 4NQDD 1UWGL 1DBKL 2DDQH 3VDBA 3VRIB 2ZUTA 1NGYA 5INDB 4PB0H 5EC2B 2Q76B 4PRPD 1FFNA 4WI6A 2J5LC 1B4JL 2LQRA 2P5WB 2WM0A 1C12A 3LKSB 4TN9A 5CJXA 2C26A 2E8YA 5GIRB 1GRWA 3DV4B 3UAJC 3TT1L 5JHLL 1AGEA 4Q0XL 4XMLH 4ZUVB 5KZCB 5FKAB 3NA4A 2DBJA 1AHWA 3LH2H 1G9ML 2EIEA 5HVHC 3BZDA 4OLUL 3N1FC 4W6WB 3ORJA 4KDWA 4LEXH 2LVCA 1JI1A 5CEZE 4KRPD 4GO6B 2YUWA 4S0TD 1IGJB 3GMPA 4W6YB 4OCNC 2ZZUT 1NDMA 4MJ5B 4LCYA 1JIBA 4QGYA 3BE1L 3OMZA 3QZWG 1DFBL 1HWHB 1N64H 1RFDL 1GC1H 2ATPA 4R4FL 1VERA 3WNPA 1MCEA 3E6HA 2C3VA 3VXSB 4G8GA 1MI5A 1A3RL 4M7LH 2LVEA 5T1LD 5BS0E 2X7LB 2ADJB 3OPZH 2F8OA 2A6DB 1JBJA 1KPVB 3BWAA 5DJCA 2XTJC 4HK0B 2I9TB 2RJMA 4ISVB 1KLUB 1KXVC 3I6GA 5ALBH 3TBYB 5BV7L 3L5WA 5IJKC 4XBPA 4EXPX 5EORH 1U3HB 1OL0A 1WWBX 2Y72A 1T83A 3ILPB 5B39B 2XXMB 1XIWC 4NM4L 2BVOA 4P5TB 1UB6B 1P4IH 3G6AA 1B3JA 1NBZA 3OF6A 1EEYA 3MRMB 3PL6B 4Q6IC 4UAOC 2A9NH 2B1HL 5HI5C 1KNOB 2Y7QA 4X83A 1Q9WA 4ZUTB 5FCUH 5D1ZD 1HHKA 4X7DC 1G1CA 1A4KA 4QNPE 1MHPL 1ERNA 4XP5L 4YBQC 4GUPB 4OZHF 2GHWB 1IGYA 2YHGA 3VXRB 1YZZA 2OZ4L 1QRNE 1XCQA 3HMXH 3O0RH 3SKMA 1FNFA 4RFNC 2HWZL 1WIPA 1P7HL 1OGAA 2MSPA 3CH8A 1WCBB 3TV3L 1FP5A 1W0YT 1U3JA 1N26A 3V0AC 4I2XB 3K81A 5CS7A 3FFCA 5CEXA 5I16B 4FXGB 3DO7B 4WW1A 3H7LA 4OZHA 4N9OB 1L7IH 3E8UL 3VFSA 2I25N 5D5MF 1X5XA 4Z7QF 4UU9B 4U6XA 4MXWL 1LEKB 1A3QA 1VPOH 4AM0A 1Z3GH 4KK8D 1CDUA 3IDGA 2Y07H 2YA2A 3W9EA 2WZPD 2HJFA 3W0WB 1OW0C 2G5RA 3REWB 4GT7A 2VXVL 2W91A 4CVUA 1CD8A 4WDIB 4AG4H 1ZTXH 1K3ZA 2E9JA 4WU5A 3G6JE 3U2SB 1GZPB 1XF3B 5D6CB 4XPFH 4LCCC 5HYJD 5IWLC 1NAKL 4P59L 1F45A 1HHIA 4J1UA 5HYEA 1U91B 3QDMD 3ULSB 2BSRB 3BAEH 3FN0H 2IQAA 1NFKA 4OLYL 1S8DA 4JFFB 4L8BB 1A7OH 3KLAB 1DBBL 4K3EL 2V5TA 4KPHH 3OAYH 3P30L 4GRMA 1BF2A 2GITB 4LSPL 4YJZL 4ZOBA 3MODH 5CBEB 1OOAA 3KPOB 3HI1A 4YFLI 1NMAH 3NZ8A 4DK3A 5EUKB 3DMMB 1I85C 4KV5E 4PV9A 3VG0L 1PFCA 5TF0A 4OCSL 1GIGL 3VXOB 1JJUA 2NY6B 2QTEA 4ZODA 3TBVB 5K59E 3EYUH 3RNQA 3U9PH 5IEKA 3IFNL 4KVNL 2A0LD 1BJ8A 2RBLA 2QR0A 2X70B 3KWWB 5IVXB 3SO3C 5I1IH 5IBUG 1NKOA 1Q9KA 4OFVA 4HIIB 5KZCD 2YMXH 4LLMB 1TVBA 3EO9H 1HSBB 4M3JA 3MRLB 2KQMA 4X80H 4EN3B 4LRNH 3QDGA 5E9DE 1S78D 3QEUB 2FX9H 4JKLA 5HYSG 2AQ2A 2DDQL 3QT2A 1CFTB 4PB0L 4J3VA 3V4VH 4OZIF 2EKSA 1HHJB 4YH6A 1U6AH 2X4TB 3CFEA 3J8F7 9CGTA 4XH2B 3T4AA 2APTA 3QAZC 2P44B 1LNUB 5IM7B 4XMLL 3B5GA 3LH2L 4NNPH 4UNTA 3CPLB 1QFWI 4Y5YA 1IEAB 4J23A 2CLRB 3IDYC 2CRZA 4OZIA 4LOUC 2DI7A 1FO0H 4LEXL 1IC1A 5J1AB 4PJBF 4OAWB 3GGWB 2DQTH 1IARB 3TO2B 1HEZA 3GKWH 3ZKQD 4IIQA 4HUVB 3FB7B 2RGSA 4J7RA 4I8DA 2J8UB 2X89A 4FRWA 1U8KA 1I7UA 3S34L 1T04B 1N64L 4I5BA 1WBXA 1U3HD 1GC1L 1FL5B 2EC8A 5A2IH 4M43H 5TE7H 5KAQF 3MRKA 4JZJA 4PJBA 3ZKSD 2YRZA 3OGCA 3WNNA 4KKLD 4M1GH 4P5TD 3C5ZB 4QY8B 4HEME 5DS8B 2X6MA 5T1DH 4M7LL 2IH3B 4ZOAA 3S37H 2BNRE 5JUEH 1BECA 2Q8AH 2GK0A 3OPZL 4XT1C 4K8RD 1FN4A 3VMOA 3TJHC 2VLJB 1CL7L 3PP3H 4FQIH 4LBEB 1E28B 4F3FB 1QVOB 2PYEB 1QQDA 4NZTH 3ARFB 1T5WA 2XIDA 3ARBB 2VAAA 3SGEI 3T2QA 5ALBL 5H2BA 1MJJB 1T6WA 3R4DA 1XGTA 5EORL 1CDJA 4X9BA 1T20B 1TQBB 3H9HB 3TWCH 4WV1A 1P4IL 2CKBH 4AT6B 1QFWH 2A9NL 4Q7DA 3GMQB 2Z92B 4GS7C 1XEDA 2BHYA 3QI9A 1G7JA 1H3PH 1D6EB 1M7IB 2FO4A 5FCUL 1N6VA 3K1DA 4M62H 5D2NB 3W82A 2PO6A 5CUSH 3OKDA 4PTTA 5F9DC 4XMPH 1PG7H 3W0WD 3O0RL 3QRGH 2BSSB 3ARGA 4GG6E 1OP5K 3QPQC 1ZWIB 3U0PA 2AK1H 5E70A 3X13A 3ULVD 4EJ1C 1YC8A 3BH8A 4KHXH 1BFTA 3EGSA 5FYJU 4LAQH 1L7IL 1S9YA 1ZVYA 3LRSA 2ZSVB 2VR5A 4OFYA 5CZXC 3W11C 1RU9H 4KUCD 1VPOL 1CFBA 1UJ3C 2EZ0D 5DRWA 1LO2H 4H1LG 2R8SH 4Y4HD 4JFFD 5MERA 1Z3GL 3DIFB 1RUMH 2V7NA 2Y07L 4IOFC 5C08B 3D85A 4JFYB 4KJQC 3SGEH 1AGEB 1XR9A 4Z7OF 5ESQA 4AG4L 1ZTXL 4LLUA 3T09A 3CSYB 2P5WE 3O3DA 5ACZB 3DMMD 4XPFL 4LK4A 1JWSA 4LLDA 4PY7B 2BJMH 4I3GA 1Z0NA 4FFVD 1J18A 1WBZA 1OY3B 1K2DB 3V95A 4KKAC 3RZCD 3BAEL 4OZ4B 3FN0L 1T1XA 4P2RA 5IB4B 4D9LH 1A7OL 4KPHL 2MKLC 5I1GH 1FCCA 5IEHA 1YEDA 3MODL 3VH8A 3QIUA 3ROOB 1DJSA 2D7OA 4MQ7A 1DDHB 3MJ8A 3CU7A 4G8GB 4HKJA 4O02H 1NMAL 5JIPA 4L5FH 5IROC 3WS3A 3LQZA 1FDLH 2K7QA 5DEFA 1HQRA 1BVKA 2FEDD 3Q1SH 2UY6A 5BRZB 3EYUL 3HI5H 4NO0B 3U9PL 3VXSE 2AQ3A 2P43B 3QWRD 4UT9H 3LZFH 1FV1A 3I6GB 1NCWH 5I1IL 3L5WB 4LSDA 1UKSA 1EX0A 2K3TA 2YMXL 1MH5B 3IETB 5ERWB 3EO9L 3WIFB 3O8XD 4XHQA 1VENA 2DQCH 5JORA 5E95B 1X6LA 4OBRA 3KDMA 4LRNL 4NCC2 5DMJB 3UYRH 5LJYH 2FX9L 1FL3A 3P9WB 4PV8A 1AP2A 1KTLA 4XX1E 2GI7A 4U1GC 4DCQA 5FECB 4LGSB 4HFWA 4ZSOA 2W9EH 3V4VL 3C5JA 1X4ZA 1U6AL 3D6GA 5FYKH 2Z91B 3GIZH 2YD4A 4HIEA 4ZPVA 2VXQH 2WBJA 4F9LC 1NJ9A 4M7ZC 1UQSA 4NNPL 3GJEA 4GRLC 5T1MB 2VISB 3VXRE 4Q6IA 3PIQA 5HGBA 3VD7A 4D3CH 2NX5A 1FO0L 3VFSB 4BM7A 2IPKB 1G6VK 2DQTL 4DGVH 1JHLH 4JHZA 3HC4H 4DWHA 3GKWL 4PY8I 5F71A 3S7GA 3RL2B 1RZGB 1J0KA 2DJSA 2W38A 4L8SB 3ARFD 3TN0C 4YZFF 3O2VH 1NEZB 2VQUA 5GPRA 4BA8A 3M8OH 1W8OA 4MA3A 4XNQA 4M43L 5TE7L 3BEWA 4NN7B 4M48H 4M1GL 3WN5B 1F4WH 4PJFF 5T1DL 3HE7A 1I3GH 3S37L 4R4ND 5JUEL 1DQLH 4JHAH 4LNRB 4MMZC 4DKFH 2Q86A 5DEGA 5C0FA 3MJ9H 4FQIL 1A9EB 5KANI 3PGDA 5DURD 4NZTL 1EBAA 3FOMB 5GHWH 3MRDA 3DSNA 4MDIA 4R3SB 4XPGH 5HHOB 3J7HA 2CRIA 1DVFD 1KCVH 1I8LA 5J3HD 5GQBA 3TWCL 2VXUH 3KYNB 2CKBL 1QFWL 3IDXH 4PV9B 4G7YH 4JFXA 3FCTA 5BZWB 1N59A 1YPZF 4Y16C 1H3PL 2J6EH 4FP8H 3BO8A 3RNQB 4FQXC 4M62L 5F88A 5TJWK 1QKZH 3DUSA 1J05A 1UZ8B 5CUSL 1KEMH 3T3MF 2UZYB 4XMPL 4POZD 1PG7L 3SPVB 1UZ6E 1Q9KB 3QRGL 4UDTB 1LO0H 3O3EA 4U6HA 2AK1L 1JF1B 2A73B 3H9ZA 4PJ8A 3MJ7A 3Q48A 1R3HB 1YPZA 1BIHA 1BHGA 3GB7B 5T5FH 1TJGH 4EQ3A 3KPSB 4KHXL 1YN7A 5IVXE 2VLME 2R2EA 3G5ZA 2ZUQB 2CO7B 1Z2KA 4QXWA 4LAQL 2HT4C 1OF2A 4KTEH 1C5CH 3QFJA 4AQOA 4HZLA 1RU9L 1IGIH 2OCFD 5FM4A 1LO2L 2R8SL 4HMEA 3LS5H 3O41B 3D69B 1A3LL 1RUML 5GZND 3T4AB 4OFKA 2FYYB 3OV6A 3F6LA 4JCLA 1E27B 1BBDH 3WO4B 3EYFA 4G8GD 1X5YA 1ORSA 2X4UB 1UKQA 2BMKB 4KKBD 2C9AA 4HKXA 3RUGE 4ZD3H 1CT8B 1D6VH 2IEPA 4YGVA 2BJML 2CDGB 4PJDF 2DQUH 2VLKA 4D9QE 1QLEH 2ARWA 3PGCA 2C1OA 2O5XH 5DJXB 4OKVB 3VXMB 4D9LL 1FFQA 3HZVA 1G6RH 2GAZA 5I1GL 2DJUA 1CR9H 4NN6C 3TCLA 2FNBA 4MXVE 3OF6D 1KLFA 4GRWH 4O02L 3MV7A 4L5FL 1CFNA 1DQJA 1T22A 1AQDB 1FDLL 5TDPA 2G60H 3Q1SL 3QXDA 3VW3H 2NY1C 4YDLC 3HI5L 3T1WA 2MHAB 1HNGA 1QSFE 2DL2A 3U0TA 1HILB 1T5WB 1CLCA 3LZFL 4FTVE 1D5ZA 4UT9L 3U36B 1AGFA 1NCWL 3VXTA 5J13B 1JN6A 4YHNA 1OGAD 2VLJE 4ENED 1KPUA 3U83A 3EOBA 3HI6H 4FQ2H 5GGRY 1ONQA 2CUMA 2PYEE 3UJTH 2JJTA 4KQ3H 2DQCL 1A6VH 1FBIH 1MWAH 5ESVA 3O4LA 4D94A 3GK8H 1XCTA 4DFIA 2HTLD 2LU3A 1SY6A 5EIVA 3UYRL 5IMMA 5GISL 1T5XA 4BZYA 3P4LA 1VGKB 3ZKND 1BOGA 4D8PA 1Y0LB 3P4NA 3FO2B 4PJ7F 2WLZA 4AEFA 3OKDB 2W9EL 2PW2A 3SE8H 3GIZL 5C6PB 2FHBA 1TVDA 1U9KA 3O3BA 3QZWA 4RDQG 5GS2H 2OMNA 1BJ1J 2VXQL 4KTDH 4TULH 4BELD 5L8LB 3LSOA 2XKNB 5IR1A 3BZFA 1OPGH 4WNQB 1WSST 4HGKC 3CFDB 4B0MM 5BQ7A 3MR9A 4XMKH 3VFOA 4PLNC 3WIIH 5JXAH 2BSTB 4PJ7A 3HLAA 2R2BB 1RI8A 4D3CL 3Q0HA 4U1JA 5B4MC 3HAEG 3SKOB 4DGVL 3IDIA 1JHLL 3HC4L 4LCWB 5DRWB 3EYQD 2CH8A 4HQQH 4ONGH 1Y18A 2C7UA 4WI3A 2X4RA 3P0YH 1N6UA 1S9WA 2DQGH 4XWGH 3O2VL 1ZS8A 1U58A 2ATKB 4MNQE 3M8OL 1BD2A 3K0WA 4OIIH 4ZAKC 2UYLB 2C5DC 2LU4A 2NXZC 4M48L 1F4WL 2OJEA 5C08E 1RJLA 1NCNA 5C0JB 3GM8A 1I3GL 1F11B 2AJUH 1DQLL 4HX1B 4JHAL 1WBZB 1J0ZA 2QQLH 4DKFL 1D9KB 5IHBA 1D5MA 3GSOB 3MV8B 1F3DJ 1Q1JL 2PYFB 1OLLA 3H9SB 3L6FB 4GRWB 5GHWL 1JWMB 5BOZG 3B3IA 4S10A 4YPJA 4XPGL 4H25A 2JELH 4Y4KB 3L5JA 1YEDB 1P4BH 2J8OA 1KCVL 3PWUB 1X5KA 2VC2H 3ULUF 1JYWA 1WT5C 4JO3H 2VXUL 4M1DH 5A3IC 5I17B 3QDGD 3IDXL 4HKBA 5H94A 4G7YL 4PGEB 2R2HA 4AL8H 1MLBA 2NY2B 1TJHH 3FO1B 2VL5B 3RWGB 2J6EL 4FP8L 1H8OA 3I2CH 1QKZL 4AIZA 4NHUB 1DQQA 2ZUVA 1KEML 5DQ9A 2YWZA 1MWAB 5F1SA 5CJQH 4Y1AE 3T0EC 5IKCA 4OZGB 4MX7A 1X7QB 1PGRB 5DO2C 1LO0L 5BRZE 2PUQT 4OF6A 3BPCA 3SDDB 2AI0H 3WNOA 1KB5A 3NFPB 5T5FL 1TJGL 3GMLA 5JORB 4QYOA 5IROA 1DN0A 2FJHB 3GNMH 5MEQB 3VRLE 5TDNA 4ODVH 1VFAA 1ZHBB 2FATH 4KTEL 1C5CL 1ORQB 1HQ4A 1IGIL 1JYNA 4L1DA 2X89D 4S1DC 3UTZA 5ID0B 3C5JB 5JHDA 4PJCF 1CVSC 1RK1A 1IGTA 2R56H 3VXMD 5E24E 3LS5L 3LRGA 4F7CA 2O93L 5H8DA 5C0GA 3VFWB 3CDGA 3C9NB 3GFUA 3DX9B 3SDAB 3UX9B 4XVUC 4UBDD 3HCVB 3GRWA 1BBDL 1FFPB 2C3WA 4NBZB 4NJ9H 4FMFA 4M7LT 3EIFA 4LLWA 3OHXA 1Q9LA 1VESA 4U1IB 4ZD3L 5JPNA 1A6UH 2XWTB 5HDOA 1D6VL 3MA7A 4DZBA 4GFTB 4PJCA 4I1NB 2VLRA 1XGUA 2DQUL 3BPNC 2GFBB 5AYQA 1QLEL 3RVXC 1RZ7H 4CNIA 4PJ9C 1AKJA 1KULA 3DYMA 4NCC1 2O61A 4EZMA 3H7BA 2O5XL 1X4XA 2VDRH 1YQVH 1FZJB 2X40A 3I75B 4PRAB 4CVXA 4OF3A 3LQAH 5JZ7D 3HG1B 1G6RL 2DICA 3D1MC 4MA3B 5JMRA 4JPWH 5EZJB 2NQCA 1T1YB 1CR9L 3O45B 2FD6H 2D0GA 1YMHA 4PJIB 3QFDA 3HE7B 5EH1A 1JV5A 3KG5A 5EBMA 1D3CA 5HYSA 3QI9D 4HLZH 3SO5A 2G60L 5CJOH 3VW3L 2PO6D 1CGWA 3BW9B 4WHCA 3TN0A 4KDTC 3BN9D 4ETQA 1QR1A 4HWUA 5FK9A 5EOQH 4GW1A 3ARGD 3QO1B 2OTUB 1QD0A 5AWNH 4NC2B 3HI6L 4FQ2L 4OUOA 1U41A 3UJTL 4MJ6B 1I7ZA 2HVJB 5I71C 1A6VL 3GUTA 1FBIL 1MWAL 3SE9H 1I1YA 3GK8L 3ZDZF 3MLSH 3RWJA 5T3XD 4MXQC 4N1EA 2MFNA 4APQB 1FHGA 1U8QA 3GZKA 5HHOE 2HMID 4OFYD 1N59B 4F15C 2G75B 1WWWX 4LPCA 3BZEA 4QOKE 1N3NA 4I48B 1BX2A 1T66D 4NRYB 4YDVB 5D7JB 1ZLVH 5F1NA 4GMSH 5C09E 3SE8L 3GKZA 3IB4A 1WTLA 3DVFA 3P9LB 4KTDL 4TULL 5EBWA 5IBLD 2OR9H 5SWZA 2H2SC 3EZ8A 5C0IA 1OPGL 3SY0A 4PJ8B 1S5HA 4JPVH 3UTQA 4XMKL 4WHTA 5JPMA 2C3HA 1NEUA 3WIIL 5JXAL 1PEWA 3QO0B 2OTWB 4X8JA 1RJYB 1OWRM 3NH7H 3NIDF 1U8NB 1F4YH 1X3DA 3CFIC 1MRCH 4JN2B 1PYWB 4PJAF 4FQXA 5IHUH 1LE9A 3BJLA 5B3JE 3VI3E 3JZ7A 3STLA 4E0RB 3KPSE 4X7EC 5CKGA 1M7DB 5C0EB 4LPUA 4HQQL 4ONGL 3H9SD 5FYKE 3P0YL 2DQGL 4XWGL 2R9HC 3M1BB 4L3CB 1PG7W 3DX7B 4PRBA 1WAAE 2W9LA 4UDUB 4XC3H 3QIUD 4PJXA 3TC9A 4OIIL 3EYFB 4PJAA 2APXA 3CUPA 3NCYP 2NXYD 4JN1H 3QUKA 2ZPKH 3QUXC 3I3EA 1MY5A 2DI9A 4ZUWB 1YC7A 1E6JH 1NMCB 2AJUL 2NY2D 2QBWA 3CFBA 3U4BH 4D0CA 4NO2A 2QQLL 5DFVC 5HDBE 3DHJA 5DDHB 2JCCF 2FH6A 3LKQB 2XKUA 1SBSH 2MNUA 3MACH 2YC1A 3JWNC 4LCUA 4FABH 2DLGA 3DECA 2XTLA 5E2UH 1FFOA 2JELL 3BGFC 5IF0A 4G9DA 5JXEC 1P4BL 2IBGA 1UWXH 5FUCE 3REVB 4DVRH 3IS0X 1WITA 2HFEB 2VC2L 5FF6B 2CXGA 4M1DL 4JO3L 2DMCA 2JCCA 1PKOA 3OG4B 4X9FA 3WFHA 3VGFA 1YEHH 4YLQT 4AL8L 2XTJD 1TJHL 2P24A 5EO1A 3WUWG 3IXTA 1DEDA 4X98B 4RMUA 2NYYD 3I2CL 5MENB 2DF3A 4MJIE 3WL9A 1HOCA 1WVZA 1HH6B 3HE6C 3VRJB 4NHCH 5CJQL 3VGGA 5CGYC 1JN6B 3H2WA 3B6SB 2WBJD 1KPUB 4U1NB 3EOBB 4FFWC 1NBYA 1KJ2H 2AI0L 5IB1B 4OCRH 1A47A 1XCTB 4HKZA 4L9DA 3GNML 3AM8C 2NX5D 1NC2A 4CW1B 4ODVL 4JFEA 2FATL 1LMKA 3D39B 4YBQD 3D0VB 1J1OH 4LLAA 2ORBH 4ZDHB 1Q9OA 5DFTA 4F2MB 4KH2A 2H3NB 5BCAA 1QHOA 2R56L 3NGBC 1CIDA 1MFDH 4KMLB 4G8EA 1HXMB 3SDXF 4JQIH 5F7MC 4M1CD 1QG3A 4ZYKB 3LSOB 1FYTE 4Z0XA 3B8YA 5IG7B 1C5DB 4YBLB 5DHVA 4NJ9L 2NW3A 5FIEA 5JW5A 3HE7D 4JKWA 5D1QC 5EC1B 3S5LG 3SE3A 3MV9B 4U1JB 1A6UL 1MCPH 4CN1A 2EDLA 5ISZA 3SDXA 4K07A 4N0FB 1RZ7L 3DOSA 2V2XB 4LSRH 3S35X 1FPTH 3FQNB 4HULB 2VDRL 1YQVL 3DRQA 1XAUA 1A7RH 3IJYA 1RVFH 3JTTA 5C0ND 3QIBC 2EDWA 3TA3B 3LQAL 3H0TA 1IT9H 1JPTH 3IJHB 4JPWL 1CGVA 3AUVA 4LCWE 5I9QB 1OD7A 3BPOC 3L3KB 4ZXBA 1IKNC 2FD6L 1HSAA 3O6FA 4ZFOB 1YN6B 3OJVC 1K5NB 5IB3A 1NFDB 2DMBA 4R6UA 5KVFH 1C16A 3I9GH 3UPRA 4ODSH 5CJOL 3GSNA 3QQ9D 4KROD 4YDKH 3D18A 4PYGA 1SBBA 4HBQA 5IQ7H 1GJIA 3QXAB 2X1QA 3EUUA 3QJHB 3MJ6A 3RHWF 1A8JH 5EOQL 3TP4A 3BQUC 3FT3A 4LFHD 5KSAB 4ZAKA 5AWNL 2NZ9C 4PJ8D 1ZVSA 3UCRA 1M05B 4KI5F 4GRWE 3SE9L 3MLSL 3BDXA 3U7AA 3V6FB 4YHYB 4JM2C 4G80B 4JHBA 1NAMH 4JREC 4RGNE 4RA0C 5EIIA 4TVPL 4OCLC 5SWQA 2JKXA 5BMFH 5CSGA 4X4ME 2UZXB 1ZGLP 1GZQB 3TNNA 4OQTH 5F6IC 4GMSL 5CBAA 2AXFA 3GJFH 3UTSE 5GRVK 4Y7MA 2UY7A 2OR9L 3HMWH 5EUOF 4JPVL 4UV4H 3GSXA 5BXFA 4H5SA 5HHNA 2H32A 4G6JH 2YUXA 5E6IC 2EXYD 4OZGE 2H45A 2F54A 1AE6H 3NH7L 1IQWH 1F4YL 3OX8B 3EOAB 1MRCL 3WJJC 2BVUA 3V8CA 1HQ4B 4WHDA 4P9HH 5IHUL 4DVBB 3W5NA 2DLEA 43CAB 2AXGB 1J8HA 1RD6A 4F7CB 5EBLA 3BYTA 1LO3H 2E7BA 5GRVL 2DRUA 2Y36H 5E2WH 3MRIB 4HXBH 5C0RH 1K8DB 4V2BA 1T7ZA 4XC3L 1R0AH 4RZCA 4K3JH 1UWXK 1AH1A 1J8KA 2MKWA 2WAHA 1XH3A 4JN1L 5JDJA 1NUNB 5D7IB 3MV7D 5AAMA 3OHXB 1S7WB 2ZPKL 2Y4SA 1PLGH 4JO4H 4XNYH 3RVUC 3KNBA 4NQXB 1E6JL 2VLRB 4CVZA 3U4BL 1G7HA 3O4OB 5I18H 5B8CC 1SBSL 3MACL 4MDJA 1HHHA 3ECBB 4ZFOL 3MBEC 1A1OB 5HGAB 5CP3A 3BD4A 3GSWA 4Y8DC 2N1KA 5E2UL 4HGMA 1FVEB 1WFTA 1OTTC 3OB0H 4K71C 4DVRL 4ZPTB 2AJ3A 3LEXB 3IFPB 3O4LD 1M71B 4GG8B 1YMHB 2DTSA 3MLRH 1BFOA 1HIMH 2GYSA 2GJJA 3STZB 4BUHA 2FH8A 3MTRA 2KQNA 3ARTA 3HG1E 3PWLB 3FO9B 1YEHL 3D39D 5E5RB 4GKSA 5E8NA 3QEQB 1PKQB 2WWMC 3L3HB 5D2LF 2WIMA 4PJIE 1XT5A 2P49B 5FK9B 5E8EA 1TIUA 4ELKB 4NHCL 1UKTA 3C6SA 4O2CB 2H9GA 1NH6A 3Q6FB 4QTHB 3ALWA 1KJ2L 4CMHB 3SHSA 2D9CA 1B0WA 2FLBT 4OCRL 4N0UE 2AJYH 5D2LA 4PBWD 4I4WA 1W2KT 3GJFB 3CFKA 3BZEB 1J1OL 3PABA 4G5ZH 4UTAH 1BQHB 2IADB 2ORBL 3P9MB 1OAQH 5D93B 35C8H 2NCMA 1MFDL 3FOLA 3B43A 3ZYOA 4F58H 3OKLB 1P5VA 1VADB 1IAMA 1T1WB 2XV6B 3WLWC 3F6IA 1BD2D 4JR9H 5DRNA 4K94H 2G2RB 1Y6MR 2A6IB 4N5EC 5JPMB 1H5BB 2IAMB 2N7BA 4C54A 1ZHLB 1IZJA 2GTZB 3DX6A 2X4PA 4Y19A 4F33A 3KXFB 2CLZB 1MCPL 1QLFA 1UXWA 5B3NA 4UQ2A 5E5UB 2JB6A 1CXFA 3R06B 3STLB 3ET9F 1JHKH 4QRPA 5I8CB 4LSRL 4TSAH 1FPTL 1N0XH 4PBVC 4ONFH 2OTPA 4X4YA 1A7RL 1RVFL 2DQFA 3OKNB 4V2CB 1IT9L 1JPTL 5F21B 3V0VA 4PJXB 4K7PX 3SJVA 3UTTA 5DUPH 4XNMA 5JR1H 1S7TA 4RDQF 2P5EE 5IOPB 3D3VA 2VDLH 4NGHH 3BESR 3MSPA 4PBXA 5CD3B 2Z31C 3WE6B 3QG7H 3DYOA 4LGRB 4CADA 4B7LA 2E6QA 1EFXA 4EI5C 5KVFL 5DC9B 3I9GL 5DJ2A 4ODSL 4R7NA 3PG2A 2AERT 2WP3O 4YDKL 2HFTA 2ITDA 2IALA 5IQ7L 1JNNH 2YC1B 4HGWB 5DRZA 3ULUD 4DTGH 2EEAA 2BOBA 2ERJC 2R4SH 4N68A 3BP5A 1UCBH 2IANB 3S9DB 1S9XB 3RWIB 4YX2H 2XNAB 4OGXH 4QRUB 1RZ8A 3KPPA 3OR7A 1IAIM 5D96C 1EUTA 3T04D 3PHSA 2NTFA 1NAML 4Q97A 3HAEA 1FG2B 4NKDA 3UC0H 5BMFL 4ZFZA 3PQYB 4F57H 1VFBA 5JHDD 4NKMA 2IFFL 4OQTL 4R2GC 4DAGH 4XAKD 1VDGA 3NIFF 3V6ZA 1BIIA 5GRUH 3HMWL 3VWKB 2XICA 2XY2A 3L3OA 5J8OA 4HUUA 4Q2ZB 4UV4L 5AD0A 4G6JL 5B21A 3DVGB 1G9EA 3KPMB 4S0SD 3MRGA 4Y5VA 2VLRD 3S36X 1L6XA 1NFIB 1Z5LA 4JFDA 1IQWL 2X9YA 4JFOA 3V0WH 3MRHB 4PP1C 1MUJA 2ADGA 5SV3A 4DW2L 2BRRH 1F5WA 1FAIH 1LO5B 4JPKH 1AKJD 4P9HL 4FFZH 2CMRH 3V5HB 1CXIA 1F6FB 3GSRA 2VN7A 2RCSH 4G3YH 1U8IB 4RIRA 1FLTX 1LO3L 3WKMH 4Z7VB 4X6FA 2Y36L 3BH9B 4HXBL 1F90H 4M6OH 1MVUB 1NL0H 4LSTH 4XI5C 5C0RL 4LVHB 5L2KA 1F6AB 5D1XA 5I1DB 3OB0K 4K3JL 4HS3A 1NGXB 4O5LH 3AM8A 2XY1A 5I66B 1O7VA 1NMBH 1JZ8A 3LAFA 3HPJA 1PLGL 1PD6A 2Y5TB 4JO4L 3F7QA 4XNYL 1LDPH 1M6OB 3VWJB 1MCJA 4IOSD 1ZT4B 5FYKU 4X7SH 4MVBD 5I1AA 4KVCH 5I18L 4XGZB 2IH1B 3MCKB 1AR1C 5KTEH 2BHUA 3MV9E 2R4RH 2W9DH 3TNMB 3IJYB 3QUYB 2VJXA 3HUJB 1KN2H 4LKCA 5TH2B 3MBXH 5FKPA 5IBTH 2RAMA 4ZXBB 5D1QA 3DETC 4CN4A 3D48R 3MLRL 3LS4H 1HIML 5CJBA 1JZ5A 4NOFA 2OI9C 4Z7UE 3NMEA 4J8RA 5IB3B 4HS6A 4GH7B 3UPRB 3H42H 1J5OH 3GSNB 3WNLA 3BZ4A 3E2HB 1U8JB 4PJHF 1MPAH 4NZUH 5FM5O 4PRIB 1LE5A 4Z7WB 1A22B 1NFDE 4P99A 5SWZD 2X1XR 3FAXA 1KXTB 4JDVA 4R0LC 4ODUB 2YD5A 1IM3A 3C09B 1Z9SA 3SDCA 2X1WL 3HPLA 5KN5B 2AJYL 3BIKB 3BXNB 4PJHA 2XFXA 4JJ5A 5B38B 4MSWA 1WIOA 5KS9A 2C4XA 4FQXD 5CP7A 5KG9A 4JM2F 2AEIT 4G5ZL 2ED7A 3B9DA 4UTAL 1F6LL 4RQQA 5CSZB 1OAQL 35C8L 5C0AB 3BQUA 2Q1EA 2J88H 4F58L 3PJSA 4X9IA 1REIA 4GKZB 1ROWA 3MROB 4BH8B 4OD3H 4JR9L 1KIPA 3U82B 4S2SA 4K94L 1X44A 2WUBH 1BP3B 3IS1X 3FT2B 3C6LC 3F7YB 2OQJB 2BOCB 1BJ1H 5F7KC 1YNKH 4PIRF 4H20H 3CZFB 1KIQA 1D5BA 1T3FB 5MEOA 3CCHA 1JHKL 4TSAL 1N0XL 1J8HB 4IJ3C 5D5MB 2GUOA 4ONFL 4LSUH 2WNGA 3L3GA 2IAND 3LHPH 1EIBA 4JG0H 5DUPL 4U6VH 3JWOH 5E6IA 1XH3B 1QA9A 5JR1L 5FA3B 4AEEA 5I1LB 2VDLL 4NGHL 2PXYC 2UVEA 1YUHA 3WD5H 4NO5A 3VFNA 1UEYA 3QG7L 5FO9B 4LRIA 43C9B 1UXSB 5EU7E 5E0QA 3PQYD 4QRRA 1KTDB 3DUHA 5D7IE 1JNNL 4DEPC 5D9SA 5EFIB 3ME0A 5I6XC 4PJ5B 4DTGL 1MFNA 2R4SL 5IVNA 2B39A 4NKOA 3VWKD 4LEOA 1UCBL 3R0MA 1WEJH 1JHTB 4JDZA 2VNCA 3QISA 4JANB 3D87B 4YX2L 1K6QH 4OGXL 2AEQH 1VACB 1F3DH 1FGVL 3OKOA 1NCCH 3CMGA 3S98A 1NC2D 3U6RA 3MUGB 4WFGD 1U2CA 5E03A 3O9WC 3QG6A 1TPXC 4HIJA 2WUCH 4GJTB 2DM3A 4JFED 1ES0A 4R8WH 1ZT1A 2QHLA 3UC0L 2FB4H 3S3JA 5JOPD 1BQUA 1ITBB 2EYRB 3S35H 1PW3A 4Y89A 3MBEA 4F57L 2NY4D 4NZJA 2PETA 5GS1C 4PUBH 3EJYC 4F37K 2HLAB 1HCFX 4JY4B 4YHZH 4DAGL 5C1MB 2BY0A 5EN2B 1TXKA 3WDJA 1EV2E 3LN5B 1R5WA 1VFOA 5GRUL 4WI7A 2FJGA 1B2WH 4AMKH 5HHPA 1OARH 3QEQE 1PKQE 3QUMA 5GZOD 2J7LA 1I7TA 2RFXA 4EDXB 2Q7YB 5DQJA 5FM8A 3CXDH 5AG9A 4ESKA 3AXLA 3RVVC 3L3DA 4M6AA 1GGUA 3SCMA 5HI3C 3V0WL 2F53A 5ISZD 2PTUA 4OF0A 1I1AC 5C07A 3UPAA 3HB3C 4WU7B 2BRRL 3D2UB 1FAIL 2XPGA 4JPKL 3ESUF 3K4ZA 5E6YA 2Z35B 1FJ1B 4LLVA 4FFZL 2CMRL 1WLHA 4IMLA 2RCSL 3O2DA 4G3YL 3WKML 5SWSB 5HJ3A 4YHLH 5I75C 1H8NA 4TNVK 4P2OB 1F90L 1JGDB 5FB8A 3DX8B 4M6OL 1NL0L 4LSTL 4ALAH 3B9KB 5DRNB 1B0RB 4ZXBD 5HDLA 4W68A 2JJUA 4O5LL 3EHBD 1MCRA 1JWUA 3O6FD 2X4PB 3LRHA 1NMBL 4Z77A 4NQVA 5DJDB 1LDPL 1MELA 1OD9A 4OCWH 5GGSY 1UH2A 3PNWA 3WUWA 5DJ0A 4X7SL 1T21A 1P4LB 2WWKO 2CKNA 4KVCL 2BP3A 4P5KA 5KTEL 4X4XB 3JVGA 3KXFE 2R4RL 2W9DL 2WW8A 2M8XA 2HRLA 1QEWA 2FIRT 2X4QB 1KN2L 1SVCP 4BQ6A 3HR5B 3FT4A 3MBXL 3RFZC 3WNMA 1A14H 1DBJH 4XNMB 1NANH 5IBTL 4O9HH 1G7IA 5E00B 3UBXB 1GVIA 5IW6B 1A0QH 3D3VB 3LS4L 3QDAA 2FDBP 5HHQA 5I2IA 5D7SH 4DZ8A 5J9PA 3BGMB 4JRYA 2EXWD 5EU5B 5B39G 3H42L 1J5OL 1LP9B 2D03H 3QDJB 5DD6B 1T2QL 2HP4A 2C1PB 1MPAL 4NZUL 4KI5D 5DRZB 1MNUH 5CWSA 3A67H 4YHPB 1K9TA 4PG2A 4XRCA 4QCIA 4KRPC 3PWNA 1IQDA 3DYPA 4I18C 5JO5A 3M07A 4XCFH 5EZOH 4L29B 5FHBH 4HUWA 3W81A 2F54D 4HWBH 4K55A 3TJEH 3N1QC 1TDQA 1KLGB 3CH1A 2W0FA 7FABH 2P48B 5AUMA 3KYMB 3UTPE 1VFBB 1J8HD 4NKMB 3L95B 1X5LA 2J88L 5I1KH 5FGBC 2B1AH 1XGPB 4OKDA 4OD3L 2GQHA 3ZE1F 5CIPH 2NW2A 3DI3B 2X4NA 2ARJB 1DEEB 3EFFB 2WUBL 3QBTB 1N5AB 1E4KC 5E5MB 3MRGB 2P47B 3VXNB 1FNLA 1Q0YH 4JFDB 3MOAH 1YNKL 3BVNA 2XWBB 1LD9A 4N8CH 5EU6A 3RWCA 2VWEC 4H20L 1TNNA 4WW2C 5T5NG 4QHUA 3V6OC 3CLEH 2DKMA 4HWZB 4RIRB 4UIMA 4LSUL 2V9TA 3DROB 4X6FB 2A83A 4X6DF 4MAYB 3LHPL 5D1XB 4QRSB 4WO4A 4JG0L 4NNXA 3JWOL 2BCKA 4I0KA 4U6VL 1TZIB 5KOMC 5KOVC 2D9QB 4PJGF 2J5LB 1T0MB 3WD5L 3PWJA 2F8XC 1TMCB 5JMOC 1O0VA 1CD1A 2DYPB 5T3ZH 2BNQA 3SKNA 2Z4QA 4U1SA 4LQ1A 3LB6D 4FA8A 5IMLB 1R3JB 4U2YA 2EE2A 1P7QA 3VE0A 3DBXB 4X6DA 1N6QH 2AK4B 3T0XA 3RRQA 5CJ8A 4YHMH 1BM3H 2ITCB 2YPKA 1YMMA 4ODBD 4PGDA 3MA9H 4PJGA 3MLWH 1ZHKB 4X6EB 3ZLQC 1Q94A 1WEJL 4JY6B 4LHUB 2GJZA 1JF5A 1K6QL 3EYOB 2AEQL 4LLQA 5C0DA 5FO8B 5EU3A 1NCCL 4O2EA 1P9MC 4KKCD 3MLUH 5GGRB 1W0WA 2F8VA 4MAUH 4LVOC 1MI5E 2XWJB 3ZHLA 1VSCA 1ZANH 3HUJE 2WUCL 4JDTH 3STBA 1A6WH 4R8WL 1IMHC 1JPFA 1QSEA 2HJKA 2FB4L 5GRJH 4EVNA 4OQ1A 4PUBL 3UYOD 3WHXA 5JW4N 4YHZL 1L0YA 1IEBB 1JNHB 5FGRA 2EO1A 4OM0H 4G8IB 3T8XB 2WIIB 1IM3B 3B9KD 3THMH 4MA7H 1B2WL 4AMKL 1OARL 1EMTH 2ESVA 4L8CB 4UT6H 3CXDL 4PRIE 1AGBA 4Y19D 5BVJA 5ANMA 1J9CT 1AO7A 3GI8H 3PWPB 2YXMA 4MSWB 5CSBA 5KS9B 5CP7B 2GIYA 2R1XA 1KIRA 2OJZH 1ETZA 1UWEH 1XGQB 4OM1H 3VDCA 1EVUA 4HV8B 4AEIH 4UUJB 3TPUA 5CIPB 4RQQB 1XIWB 3VG9B 4M4PA 1DUYA 1YNTB 1FC1A 5ITFA 3MV01 1MOEA 3PJSB 1Y6NR 1BZ7A 2OS7A 4YHLL 4NUJB 2YPLA 1GAFH 4XVJH 4ALAL 2Z9TA 4G6AD 5FM5M 5A16B 1CTOA 2YD1A 5IMOB 4KQ4H 4S2SB 2EDDA 4OCXH 5K9KA 2BY2A 3D3VD 2A0LC 2DD8L 3UXFA 1GPOH 3FFCE 4HJ0C 1U8PA 3OXRB 1EFXD 4X9HA 1KJMB 4OCWL 2VITA 4P4KB 1I8MB 2M1KA 2E7LC 3QDJD 5KJRH 3FZUD 4YNYB 3KPQA 5LGJA 3QA3B 2R9HD 1TCRB 4Z78A 3OB8A 1JZ4A 4MCYB 2ENYA 3QJFB 4QHMB 1YEFL 5IQ9A 1S78C 3LQMA 4ORGB 2Y06H 4NYLB 1R3KB 4RWHA 1A14L 1DBJL 3AMLA 3IDMB 4O9HL 1QA9B 4LDOB 3C6LA 1INQA 1IL1B 1SYSA 5D5ME 5J1SC 4GBXB 1A0QL 3GSVA 3FRPG 5D7SL 2ID5A 1DQTA 3TFKC 1AXSB 4KDVA 4PJFB 5HVGB 1OQOA 2D03L 2I9LB 3F5WA 1MCQA 1MCIA 2VIRB 5I19H 4WJ5A 2VH5H 1MNUL 3A6CH 3A67L 4LCCB 4M6NH 4HSQA 4LEOB 3RX8A 4TUOA 1Q8MA 3OKKA 1EZVY 4CJ0A 3SQOH 5JQ6H 3ZYIA 1QNZH 5ICXA 2PXYA 5E1AB 5EZOL 1ZLUK 4PJ5E 1G7LB 1EPFA 5FHBL 2AV7B 1CXLA 3QG6B 4HWBL 4JFDD 3I84A 4HC1A 4AQ1B 3TJEL 2HFGH 4H26A 3GMRA 1C08A 4OLWH 3I02B 1ZT1B 1U3HC 2EIZA 7FABL 1KT2B 3ZE2F 5J6HB 3B9AA 5DA4A 5GGUA 3OAZH 2GTWA 4PG9A 4KKLC 4P5TC 1MQ8A 3ROLB 4OUUB 3PL6C 2BXZA 1CQKA 2V2WB 5I1KL 2PTTB 4QNPF 1R5WB 3L7FA 1WBYA 2B1AL 4MAYD 4RX4D 2FJGB 5L2KD 3MRNB 4K8RC 5D1XD 3X12A 1U0QA 4MHHG 2RFXB 4Y2DB 3C5SB 1H0DB 1KEGH 3SO3B 3UP1A 3TBWA 1Q0YL 1AIFB 3QDGE 1W0VB 2P7TB 3MOAL 3LV3A 4N8CL 3MNWB 3MMEA 2EDRA 5GS1A 2CQVA 4NSKA 1EO5A 3SN6N 4WEMB 2AK4D 3LN4A 4GAJH 1FSKB 1LEIA 1V7MH 4H8WC 4BQBA 2J4WH 3CLEL 3G5XA 5I73C 5HHME 5ECJE 2LU7A 4HJGA 3P3YA 2OL3A 5FYJH 4KJYB 2W0LA 4BSWA 1U93B 1B0GA 3FQWB 1DN2A 1RZKC 2G9HB 3QNYB 1I4FB 4BQ9A 4JHWH 2DKUA 4X99A 1MCDA 3QNXB 4FQHB 1LHZA 5SWSE 4MWFB 4MNGE 4NQVB 5T3ZL 4MS8D 4L4VB 5HYQB 5TGBA 1R3LB 3IF1B 3ULVC 3IJSA 3FQTA 3U9UB 2ZUXA 3CVIH 3DTXB 3KLDA 1N6QL 1KPRA 4PJDB 1NGWB 4JB9H 3RKDD 5I76B 4YHML 1BM3L 3T2NH 5I8KH 4G42B 1I9JH 1J1PH 4WWID 2ZSWA 1T7XA 2Q3ZA 3MA9L 3MLWL 1HXYA 3SDCD 2FZ3B 3VFUB 1KUMA 2EZ0C 5DRXA 1GXEA 3MLUL 3VXPA 1F58H 4MAUL 4Q9RH 1ZANL 2NNAA 5GRZA 4JDTL 1A6WL 5GSRA 3RGVA 4QXTA 3C8KB 4PGBA 5GRJL 2VL4A 3QEHB 4KV5F 1RJZB 1P2CB 4WUUB 1TQCC 4I0PB 1MCFA 3WEXA 5K59F 3DMMC 2D3VA 4XRCB 1I9RH 3TVMA 3V52H 4OM0L 2EDJA 1FH5H 3CX5K 4FFVC 1MFCH 3THML 4MA7L 3MO1A 3T2OA 1EMTL 1RQ5A 3EDJA 4UT6L 3TO4B 3WIHA 4HUWB 3GI8L 2G5BA 1EEZB 4G8FB 2HT2D 4LMQI 4P4KD 4DQOH 2OJZL 4YUEH 5AUMB 1UWEL 2HFFB 1EGJA 4OM1L 1UB5B 1MSPA 4AEIL 2GCYA 4NQCB 2CIKB 4Z5RB 1AJ7H 4EN3C 3V5DB 3SGJC 1IFHH 2XYCA 5K9OA 3F58H 3JWDC 1WIUA 3CVHH 4GS7B 3OXSB 1GAFL 1PY9A 4XVJL 2FEDC 4JJHA 3RWEB 5ICYB 1BZ9B 2PW1B 5E6ID 4KQ4L 3EJJX 5IV2B 2PR4H 2ADFH 3BISA 4MD5A 4OCXL 1NCDH 4X8XA 5HGDB 1NEZG 4UTBL 2IWGA 1GPOL 1J7VR 5E9DA 3VA2C 4QEGA 2NY7H 5DJZA 3ZYZA 4P23B 3WFEH 4XP9H 3BRFA 4POUB 1RY7B 3TZVA 5BZDA 1NC4B 3QYCA 4BFIA 2IGFH 5KJRL 4WEBH 4CDHA 4HIHA 3VGBA 1ZSDB 3IDJA 3FQXB 4HUXB 1INEH 5C71A 2B4CC 2VZ3A 2J3SA 2AEPH 2Y06L 1OSZA 1VGEH 4NNXB 3L9RA 3ZSTA 4Z8FH 5DYOB 3N50A 5DJ6B 5IVZA 5CZKA 1M1SA 1AC6A 1CD1B 3O3AA 1JZ6A 4Z7NF 5GS0C 1NLDH 3AB0B 4G6FD 4L3EB 3CGTA 3DUUB 1ZA3A 3PDOB 4Y4FA 4ZFFA 3MREA 3MBED 1BLNB 3V6OA 3F12A 4ACPA 5IB2A 3OAZK 5F1OB 4Z7OE