3THML

Crystal structure of fas receptor extracellular domain in complex with fab ep6b_b01
Total Genus 45
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
45
sequence length
214
structure length
214
Chain Sequence
QSVLTQPPSVSEAPRQTVTISCSGNSSNIGRYPVNWYQQLPGKAPKLLIYSDNLRFSGVPDRFSGSKSGTTASLAIRDLLSEDEADYYCSTWDDTLEGWVFGGGTKVTVLGQPKAAPSVTLFPPSSEELQANKATLVCLISDFYPGAVTVAWKADSSPVKAGVETTTPSKQSNNKYAASSYLSLTPEQWKSHRSYSCQVTHEGSTVEKTVAPTE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Immune system
molecule keywords Fab EP6b_B01, light chain
publication title A series of Fas receptor agonist antibodies that demonstrate an inverse correlation between affinity and potency.
pubmed doi rcsb
source organism Homo sapiens
total genus 45
structure length 214
sequence length 214
ec nomenclature
pdb deposition date 2011-08-19
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3thmL02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3thmL01
4POZD 2GFBA 3TNNA 4XHJD 2P5WB 3HG1D 3QPQC 3WO4C 4R3SA 4U6HA 3MRNB 5CWSA 1B0RB 4CU7A 3ULVL 4HMCA 5HGBB 3WCYA 4JFYB 5IFHL 2YR3A 5IMMA 1E6JL 1G7QA 2XG4A 4GXUM 3REWA 4OUUB 4WUUB 4YHPA 4M61A 3ZDZF 3AXLA 4OZHF 2F53A 3OAYH 4P2QE 4QHKI 2LQRA 1WUNT 1G6RA 5E08L 1C5DB 5CMAB 4HQQL 1CGVA 3KAAA 3ES6B 3AROA 5GGVL 4MDJB 1MI5E 1UVQA 2G2RB 4PJ5E 3TZVA 4HMEA 2ZCHL 1H8SA 3OKOB 1FNSH 5DJZA 2NTSP 3P3YA 4TSBL 4Y2DA 5FYJH 1WCBB 4U31A 1JWMA 4HEPG 2LU3A 5CCKL 1J5OL 5EZIH 3WEXA 4JO2L 2OS7A 3VFTB 1EMTH 4XMKH 3NBNA 4LDLB 4GW1B 5TQ2H 1FIGH 2AJYH 4X7EC 1FFNB 5AAWA 5KANG 4FXGA 2D0HA 2FX7L 5CZVH 3BX7C 4HKZB 1J1PL 2DM4A 4NIKB 3WXWL 4I48A 4Q9QH 4E41D 1F3DH 3RNKB 1L0QA 1BZ9A 1QSFA 1S7QB 5JO5B 3VG9B 1LO0L 2FEDD 1NMBL 4ZUVA 5AZ2H 3U83A 1ZS8A 3PV6A 1ZA3B 1ZOXA 2X09A 5ICYB 1QTYT 5DVNA 3VFMB 4NNPH 3TP4A 1EFQA 5IESL 5HPOA 1N5AB 4LVEA 4S1RL 1QACA 2H2SD 3MJ8A 5L2KD 1EEZA 3WXVL 4YHZH 5GGTL 4HX1A 4G7YH 3QP3A 5BVPH 4AL8L 4NRYA 2P5EB 4PTTB 4CMMA 3CFCL 4TSCL 4OZIE 4UT9H 2ZWLT 4HS8H 1P4LB 3ZTJH 3FB8B 2IQAA 2Y07H 3O4OC 3MLWH 4KPHL 1BM3H 2J3SA 4U3HA 5LGHH 1TLKA 1PAMA 3KPOB 2FGWH 1NCDH 1T7VA 3WIIL 4IOSD 3D5OF 1G6RH 5DFTA 2J6EL 1R3KA 1NC4A 4QHKJ 5C0CA 4DGIH 1JBJA 3QXAA 1T7YA 3PQYE 3MUZ1 1KJ3L 4CVXA 1YEFH 1RQ5A 2XWTA 5IKCB 2WQ8A 3GMMA 3CIQA 4V1DD 3EGSA 2IAND 5TH2A 2A6JA 3O41A 3U0PB 5I0DA 4ONHB 4DN4L 2ADIB 4JZOA 2AV1A 3B6SA 1GZQA 4P46C 4UTAH 5HD8D 5D5MB 1WJ3A 4JRXB 2FHBA 5HGGS 4BH7A 1IAIM 1VGKB 2YEZA 4M3JA 5JOFA 3MR9A 4NHCL 3ARDA 1EEUA 3ZHKA 2FO1A 1LK3L 4HAFA 4RFNB 4MX7B 3VGBA 1XGRA 5JQ6H 2F58L 5C0DB 1YDPA 5IW6B 4NUJA 2I60H 1Q9KA 2BXZA 1MHHA 3MC0A 1DBKH 2D0GA 3BD3A 1EUUA 5DYOA 3RVXD 3B2UC 3NIDF 1MFCL 2DWEA 4P2QA 5GGRB 2CUIA 4NQCE 5IVOA 4F7TB 3UX9B 5F3HA 3BIBX 2Z92B 4OI7A 4GS7C 3UTTE 4X7TA 4PB9L 2NXYD 4P4KB 3UTSD 1C5CH 3QUYB 2G60L 1MI5A 3QDMD 1DN0B 4XC3L 4PJ5A 3RVVD 4KROC 3H9SA 3LS4H 5D7IB 1CFVL 5CP7A 5DRWA 4X9IA 3P11H 5D2NB 5GGUB 4AM0A 1G7JA 3BPCB 3ZKXC 5JQHC 2N7BA 1JK8A 4FP8L 1U92B 1FRGL 4ZUUB 2P47B 1XH3B 4XNXL 4Z7WA 3DXAA 1A7OL 2AABL 4RGMC 5EH1A 4XB7A 2Q6WB 2YK1H 1QD0A 1KSRA 4YHIA 1P7KA 2OL3B 1CDBA 4RGOL 1SY6A 1AH1A 3MTRA 4LCUA 4GSDH 4BKLB 3FO2A 2X4TA 3IRZA 2A83B 4ODTL 4O02L 1UM4L 2W92A 3VD3A 4F3FB 1NANI 1ZHLB 2V5SA 4LSTH 3VXUE 2IPKA 3DVGB 2I27N 3G04A 3HPLA 2YMXH 1JYWA 4P3WA 4ODHL 3RZCD 3P73B 3WD5L 1Y18B 2J2ZA 3LN5B 3FQTA 4UIMA 4ZYKB 2HVJB 3L3IA 4K71B 3NACL 1EHLH 1U8KA 2NY5L 4MMZC 3TVMB 5CJXC 1UJ3C 1ZHBA 2NLJA 1A6ZB 2XTJB 4V2BA 3QDGD 2H9GB 3TNMA 4I8DA 4P9HL 1CD9B 4TSAL 3LPFA 5T1KD 3OJDA 1FL6A 2W60A 4Y1AA 4LAQL 4BK5A 4QRUA 3FT4B 3VXOA 2VSDA 3SEPA 4MGXA 3O6ML 3RDTB 4TUJA 1B0GB 3HMXL 3WN5C 3W82A 3PWVB 4FQHA 4LLDA 1S7TA 2R56L 5HHPA 4JKPL 4Y4KA 1D5BB 1EEYB 1Q1JH 1JF5A 1QEWB 4IRSC 1EFXA 1FYTB 2DOCA 2VWEE 1AO7D 2DL9A 2EDFA 4MQXD 4OLZL 5FYLH 3FFCD 4Y8DC 4R26H 3V7AG 3VD9A 2JJUA 1YZZA 2R0KL 4OF3A 4YUEL 3RL1B 3PP4H 4U1KA 4F58L 4K7PH 2Z93A 1AQDA 4XTRC 4WHCA 1MCLA 5GZOD 1S7SA 3IAQA 4KZDL 5K9KA 4X98B 1GIGH 1W0YT 5ANMB 3SCMD 1A7RH 3QFJD 1J05A 3QHZL 4R7DB 3WKML 3E2HB 3BZDA 5E00B 5I1EH 4EBQH 1RJZB 2BSSA 5F44A 1SY6H 3SKNA 1VFOA 1OAQL 4JFFE 2XZQH 4ZUSB 4L8SB 3EOBA 2AK1L 4YGVB 1UKSA 3DO3A 1BIIA 3LN4B 4KK9C 1UEYA 3QAZC 4HC1A 4GMSL 4L4VA 2IAMC 4JN1H 4M93B 1ZHNA 4G8EA 4DUXA 5JW5B 2Z4QA 4OJFH 4Z7WF 2R69L 2ICWA 1JGLH 2H6PB 2PKDA 5JXEC 3F58H 3UTTA 2NY6D 5B38B 2W38A 5JHDD 1M6OB 1F4HA 4PJDA 3T1FB 4HHAB 3DHMA 4PRPB 3MFFB 2OJEB 3AM8C 5GGRY 4HUKB 1VFUA 4UOW0 3GSUB 4PJFA 5GRZA 4BH8A 3T8XB 2L4OA 4FABH 5KW9H 1A7BA 1EHAA 2YSSA 3WUWG 4EUPA 5J06A 5B39G 5AYQA 3VH8B 5B3JE 1I3RA 1AHWA 3VXSA 3MRHA 4NM4H 4YX2L 4IDJH 1UJTA 5IEHB 1KTLB 5KVDL 1JMXA 2NNAA 4TTDD 1UEMA 2YZ8A 4QRTB 1JPGB 1XR8A 3LIZL 1IGYB 2P5WE 3U4EB 1A7QH 2EDTA 5IVZA 4LSPH 1V3JA 3GM0A 2I9TB 3TT3L 2D4FA 3KNBA 2XN9A 2KBGA 1E4JA 4XBGA 3MLTA 1U36A 4EI5C 5IEKB 2WWMC 3GO1H 4YNYB 5D70H 5C3TA 2XG5A 3WLBB 4QHMB 3HC4L 1N4XH 1MJ8L 4IRZH 1KIQB 4EJ1C 1MEXL 4WUUE 1G0YR 4M4PA 1RK0B 2AJZB 1Q94A 1U8QA 1UB6B 1DDHA 3OKEA 5GRUL 3I3EA 3IDJB 5DC4B 4ZTOL 1ODAA 4FS0A 3H0TA 1MCRA 2HH0L 1S78D 4JQIL 4XNYH 3CFIC 3VRJA 4MCYA 3IFLL 4WWKC 1I7RB 1OTSC 3FFDB 1PBYA 3KS0H 1WVZA 1X5ZA 1BFVH 4K8RD 1MCNA 5FF6B 5HTSA 4U1LA 3CNKA 3IDGA 3P0YH 3WDJA 4OLYH 2FSEB 4UDUB 1A6PA 2O5ZH 5BVJB 1Q9OB 2BERA 4NDMB 3KPPB 5ADOL 4IS6B 2BHZA 4MSWA 5EBGA 4X99A 1BQLH 3B3IA 3BHBB 4EUPH 1QLFB 4M7LT 3TPKA 2ZJSH 4JFDA 3I75A 3MRCA 3LRGA 3ZZ1A 1BP3B 3MRKA 3RWCB 3RIAK 2B4CL 5K9JH 3PL6D 3QNYB 3NTCH 4PJDF 3FT2A 2VC2H 2J5LB 1F6AB 5C92A 1IFHH 3X3GH 4YXKL 3TZVC 4QRRB 4L9LB 3BN9C 1NAML 2HJFB 1FZJB 5D4QA 4LIQH 4PJFF 4RIRA 2OJZL 4Y2DC 5E5RB 1D5XB 2YN5A 1EPFA 1KPUB 3U0TA 3LRSA 2NY1D 1O0VA 1Z9LA 3T77A 2P5EE 2HFGL 5DI8A 3HI1A 4HS6B 3NCCB 2Y23A 3EOTL 2LV4A 1MNUL 2AW2A 5T1LB 1L0YA 4R90H 3FHQA 5CHNB 3GUTB 3BQUA 1JL8A 1K2DA 2UYLA 3ZKND 3V0AC 3TN0A 4LBEB 5EZOH 4YDIL 5K9OA 5FO7A 1KPVB 5FGSA 1LO5A 3U36B 1G7MA 3FQNA 4QXGL 3TYGH 3BDBA 2B1AH 3C9NB 3WFDH 2JE8A 3DVNA 5I1IL 2FL5A 4GW5B 2ZUQB 5E9DB 4JR9H 3UMTA 4WGVB 5GS1A 1CT8B 5J1SC 3HAEB 1HN1A 4H1LB 4S1DC 5HY9A 4JREB 3GI8H 4RMRA 1G0DA 4YZFE 1XGYL 4N8CH 3B9KB 5D5ME 4M6MH 4JRXE 5F7FA 2Y6SD 1NAKH 2B5IC 3C87A 3MBXL 3TPUB 1Z0NA 5F1IA 5CIPA 1P4BH 3NMEA 2X4QA 5TGBB 1GSMA 5DD5H 3CPLA 2O5YL 1SMAA 4YGAB 1B2WL 1I9IH 1UB5A 5ACZA 5I1DA 4HZLA 3BP7A 3N1PC 1JHTA 1LEKA 3VMPA 4HFWB 5I73C 3H3PH 4PUBH 4V2CB 5LAXA 3W9DA 5FO8B 5HHXH 2HT4C 5EORH 5JUEL 3EYQC 3LQZA 5DD3H 2VXVL 1CXKA 3LKSB 2YHGA 3ES6A 5FDYA 2K1MA 4MDJA 1MJJA 4WWID 1CVSC 2G2RA 3GMQA 1C5BL 1YY9D 4AENB 1H3VA 4GW4B 3RL2A 4KTDH 5D7IE 1GGTA 1I7TB 4EDXA 5D2NE 3GMRA 4YXHL 3UTZB 3V5KB 4AEIH 1PLGH 1KJMA 2F54A 2XY2A 4WHYG 1BZ7B 3NFNA 3ARDC 4PJGB 1G9ML 2F74A 3VFTA 4M8QA 5IG7B 5D1ZB 2ICES 1U8HA 5LGJA 3VE0A 3QXDA 1JUFA 3FRUB 2A73A 2FJGA 3HE7A 3SDDC 1FFNA 2DQFB 3O2WH 4CJ0A 3D9AL 1PDKA 4TUOA 1FL3B 4HJGA 4JGUA 2O61B 2X4OB 3GNML 3FAWA 1RZKH 3IDNB 3WNOA 1P7QB 1CTOA 2PXYD 3ARBD 3VXNB 1U3JA 3Q3GA 3EZJB 4CNIB 4JPVH 3VFGH 4B41A 4Y4HA 1X5HA 3AS0A 1K4DA 2OX5A 3CFBA 3QUXD 2CD0A 2J8OA 4UILL 1CWVA 3EHBD 3D39B 4DQOH 5BV7L 3ULUH 5T1DH 5EOTB 4O5LL 1DBJH 5GISL 2XTJE 4X5WB 5MERB 4YDKH 4A6YA 5CIPH 4MNQB 5DQDL 4HUUB 2VN4A 4ALAH 4BFBD 2Q3AA 2BX5A 4D94A 4DGVH 3V79C 5T5NG 1I9RH 2R1XB 1IMHC 1GZPA 1XF1A 4WJ5A 1YEGL 3F12B 5IWLA 3LD8C 5DEGB 4Z7QE 2PCPA 1ADQA 4NWUH 3T65B 3A6BL 1QA9B 4F7CB 1CDHA 1LEGB 2QKIB 4ZFOL 3ULUF 1R5IA 1FYTE 2FH6A 3M1BB 1ZKAA 1CFNA 2C3VA 1MCIA 2X44D 3DETC 4JRWA 4GQ9H 3RWIA 2Y9RT 3MA7B 3NFPB 4JFQA 2EDRA 5FYKD 2VDMH 3DHJA 4U6YB 3PHOA 4LRNH 4CAGA 4QYOB 3BKJL 3TT1H 3RTQB 4HULB 1X5KA 1K4CA 4ERSH 3MXWL 4ETQA 3BP5A 2JJVA 2DIBA 3LKQA 4KUCF 2HT2C 2WWKT 5EFIA 3IJHA 2DDQH 4DN3H 5C6PB 3HZYB 4C83B 1LILA 5ANME 5DDHA 3KYMB 1OGAB 1WISA 3QCTH 3HE6B 4XPFL 4ZPVB 2A6IB 3D0VA 5CUSH 1NGWA 5IW6A 4PPTA 1YEEL 1N59A 1O5DT 2BSTB 1SMOA 1EXUB 5F8RC 5EA0H 3O9WA 4Y4KC 5HDLA 4NO0B 1JZ6A 4X7DC 1WSST 3ZSSA 1OAZL 4NOFA 5KVEL 5CS7A 1CLYH 3J7HA 4XP4H 1DUZB 1ZT4B 4QRPB 2GUOA 1T0NB 3PWJA 3QG6A 5EZLB 2ARJB 2EDKA 1OGTA 4RWYL 2JB6A 3TO4B 2BVQA 2IADA 2LAGB 3UZQA 2Q8BH 4LCWB 1HH9B 4WO4B 1NGZA 5T5FL 1IGIL 3K2UH 3MLVL 4PRNA 3V6OE 4GRLA 4WY7H 2PYFB 4PRPE 4XVSL 4A6YH 2X4PB 4JPWL 3Q6FA 2OI9C 3QQNA 4XNZC 3KXFD 3L5WA 1WIUA 2MCPL 3WFHB 3V4UL 4XWGH 1XH3A 3OKYA 3CFDA 3BH9B 5IQ9A 1KB5A 1I8MA 4LHUA 3MACL 1OB1B 3ZT7A 5IB3A 5FFLA 1ADQH 1CCZA 2FIKB 4WW1B 1A4KA 1R3IL 4L8CB 2Q7YA 3IDXL 3B5HA 4HKBA 3IAGC 1IAIL 1DBMH 5LQBH 3OMZA 1HNGA 4OLUL 5HDBF 4GRWB 3MRBB 5E6IB 1HQRB 5D9SB 2F5BH 3QDJA 4TVPH 1WEJH 1QLEH 1Y18A 3LN5A 3RGHA 5C0FB 1I1RA 4X4ME 1IQDA 3X13B 2Q3ZA 4PV8B 4P3CL 3ZDYF 4P9ML 4NC1E 3QPQD 3D2UB 1A6ZA 3IFOA 1MCJA 1MWAL 3VFVB 3WS3A 3AREA 3OB0K 3CSYB 1LO4L 5BS0D 5KVMC 1U3HB 1FAIL 3WFCH 4BK4A 1DUYB 4BSWA 1VCAA 4JY6A 4NJAL 3AB0C 5BO1L 5HYQB 1LNUB 1AKJD 4FG6C 2AXFA 4XMLL 4KGLA 2FHFA 3RDTA 2JK5A 2DQCL 4AZ8A 1B0GA 1NFDB 1A1OB 3G6JB 1NMAL 3PGDA 5DMKB 4K8RL 4J3XA 1D5BA 1FVCB 4U7KA 4K3DL 2WBJA 3OQ3B 1FYTA 1WC7B 3L1OL 4BYHA 1QR4A 2R9HC 5DJXB 4OCYH 2DB8A 1MHCB 1S3KH 3QUZD 4KJQC 4UINH 5TF1L 1I3GL 4P0DA 5LKNA 3I9GL 1YYML 1CL7L 1JGDA 3U9UB 2H2PC 5GS0D 5JW4M 4KXZI 5DJ2B 3DUUB 2RFXA 1B3JA 3S96A 3VD4A 3O3BB 3KPTA 4Z95H 3C08L 4OF8A 5KSAB 1KB5H 4DCQA 1FO0A 5I18H 4R7DA 2DIJA 2D4DA 4I9WE 3MRLA 4KUZL 1H8NA 3O4LD 2CK2A 3PHQA 5CEZE 3B2VH 3FO9B 1PD6A 2IJ0C 5CSGA 3RPIB 2VLRA 2Y25A 3PG2A 1TZIB 1D5IH 3MBEB 4JY4A 3TA3B 1S9YB 4QRRE 3GKWL 4G42A 1FVEA 4JAMA 1JNNL 2X4RA 4YFLF 2EH8L 2DWDB 4KI5D 5I15H 4ZS6D 1KLUB 1PKQB 2CDFA 1KTRL 4P2CG 3IYLW 4L3EB 3JTTB 4HBCH 1RIHH 2MTPA 1CD0A 3QWOB 3OBAA 4I77L 43CAA 1NC2B 4OZ4B 5J4MA 1M7DA 3LHPH 3BUYB 5KSUB 4JFZL 1S5IH 3V6OA 1YMMD 4FTVD 5H35B 3ZE2F 2VQUA 4RBPK 3GSUA 5C0BB 2OZ4L 5F9OH 4F33B 4XVJL 2CDGA 1KBGH 4B0MM 4W6WB 1NFKA 4ZOEA 4JHAL 4XCCH 5SWZB 5DUMH 4Z0XB 4WTWA 2W1NA 1MFBH 3SDYH 1RJYA 5DD0H 5E9DE 1RZ8B 4WI8A 4YPJA 2M26A 2QQLH 1ZT7A 3VFPB 2CKBB 4CKVX 1FYHB 4QRTA 1U95B 4QWWC 4Z7OF 4P48A 4O2FA 3TH3T 1X4YA 4KQ3L 1JI1A 1F90H 3MA9H 1BQSA 5IT2H 1JHLL 1IAOB 2R29H 5J6HA 3NA9H 4HH8A 4JHWH 3S5LA 4GLRI 1CTNA 5DURD 5HHOE 4X4MA 2GSIA 5I66A 4NPYA 1DVFB 2AJVL 3BQUC 5BZDB 1TJHH 3AU1B 3TN0C 1A2YA 4YHNB 4P46D 4YIQB 1FO0H 3EW3B 3ZSTA 3QR2A 3V6ZA 3LEYH 4FFYH 5FDWB 4GXUN 5E2WH 2G5RA 3LV3B 4GT7A 2X1XR 2AGJH 2ZUUA 2Z35A 1RZKC 5F72S 3OGCB 3H3KA 1NSNH 5L9DL 5GIRA 1U8NB 4OCRH 3T4YB 5KG9B 2GJ6D 1H15A 3QWRA 1IBGL 4HPYL 4R4FH 1HCFX 4DK3A 2VITA 4MS8C 3S34H 1KLFA 1MF2H 5FUCE 3ULUC 2MPAH 1CBVL 2K7QA 4XVUC 2FSEA 5FO9B 4GUPB 4G9FB 1EJOL 1KIPA 3MROB 4PJGE 4DW2H 2VLKB 3FQXB 3KPMB 3TJEL 4TTGA 2F19L 4IS6A 5E2TH 4X8XA 1T4KB 3O6FB 5BMFH 3D18B 3QUKB 3BHBA 2VL5B 5IUSA 4LOUC 2PYEB 4XXCC 4X6EB 4CVZB 2RBLA 4ZPTA 1I3UA 4JFED 1XCQA 5L8LB 4EXPX 4X5XA 4R8WH 2W0LA 1MIMH 1ZWIA 1QBLH 4G80A 3D85A 2VDNH 2FECL 3MLUL 2EXWD 2FIRT 1FNGB 4P59H 4GKOA 4X4XA 1H5BA 1II4E 3TM6A 3O3EA 1J9CT 3LB6C 5HHVH 5GGSY 4BZ1L 3BDYH 3M07A 4IIQB 4BUGA 2FJFA 1F4WL 4G6MH 3TF7C 5C0EA 2V5YA 4RAUB 3D39E 1XF3A 4NJ9L 2LU7A 4PTUB 2Y7QB 5T3XD 1AQKH 3OKKA 5C2BL 1D5XA 2DICA 2DLIA 2YPVH 4Q9RH 1YPZA 1S7XB 5F7WC 1MAMH 4ZFZA 4ODWA 1TJIH 4F15C 5A16B 3R8BB 3SGEI 3IDMA 5H8DA 1NQBA 2DS4A 5LWYH 1YYLL 3EO0A 3BJ91 2EDXA 2Q76B 5DJDB 4NZUL 3G5VA 5D8JL 3A67L 4Q0XH 5F1NA 1MLBB 2Z31A 3HI6H 3HE7C 1K6QL 3P4MA 3MLXL 3ARRA 5CLTA 3EZ8A 2FX9H 3VFWB 2MHAA 4N90D 1Z0MA 2VDPH 2V17L 1VFBB 1QNZL 4XMPH 4Y4HC 3ZKMC 4CRPA 4HUWB 5D93B 3HMWL 4U0RB 4Y16B 2DBJA 4FZ8H 3I85A 2BVPA 2FJHB 1YECL 5ESVB 5LBSL 1YY8A 5I71C 4WU5B 4IRSD 3FO0H 4MJ2A 4U1GB 4UNTA 4OBRA 4HIEB 2CPCA 5KSVB 3T0DA 3IDYC 5D7JB 2WP3T 3MCLH 4G3YH 4Q6IA 3TPUA 5HHOA 1OGAE 1ZLVH 3LKRB 4OLXL 1F13A 5IFAH 3V5HB 2F8XC 4L8BB 3ZKSD 2MFNA 3MGOA 4OFIA 5CJ8A 4OZFB 4PRID 5DK2B 1TITA 1S9WB 4P23B 5IWLC 5LXGH 1HHJB 1N5YH 4MCZB 1U6AH 4AIZB 2DLHA 3KR3L 4LLWA 3L7FB 3F7RA 4OT1L 3C5ZB 4P5MB 1MJUL 4D3CL 3DTXA 3FB5A 1S7UA 4Y5VB 1IT9H 5C07B 2ED8A 3FQWA 3I6GB 3QEGH 1KF9B 3MXVH 1KENL 4QRPE 2E27H 3MODL 2HYMA 1AI1L 4GJTB 5C8JA 4U3XA 4LCWE 3OKNA 4X6CA 1YN7A 2KH2B 4D0BB 4LQFH 4OIAA 4WV1B 3CLFH 4AENA 1S5HA 2EDBA 2HJLB 4GW4A 4KK9D 3HRPA 1I7TA 1MLCB 4LLQB 3H7BB 1EGJL 1HI6B 1GAFH 1BLNB 2ZNWA 1ZVSB 2PR4H 4XPAL 3OR6A 4R96B 2GSGA 5JXED 1BZ7A 1U8OA 3QEQB 4RA0C 2NY0D 2FB4H 4IRJB 3ROOB 1TPXB 5HVHC 4OLVL 5F9DC 1QRNB 3C09B 4ISVB 5IG7A 1A6AA 1WWBX 1FL5A 3EYSH 2E3VA 5L0QB 5FUOH 5B38G 1EHXA 3O9WC 1N2RA 2FDBP 3ZT6A 4JY5L 4P99A 4QY8A 4PRBA 4ODSH 2O61A 2X4OA 3RX5A 3IXAB 1TJGL 5GHWH 1YPZF 3VGDA 4TOYL 1J8HD 1IQWH 1XCTB 5HGDB 4GRWE 4FXKA 5IW3A 3DROB 3GSNL 4MDIB 4YHOL 3MNZA 1TCRB 5IHZB 4U1SA 1XGTA 7FABL 4APQB 3VH8G 3GJEA 4GRLC 3K0WA 4UZGA 3ULVH 3CK0H 4HXAL 3SQOL 3KLAB 4GAYB 3MRIB 4PP1C 5IFHH 4YO0A 3QG7L 4IJ3C 1OAYL 1E6JH 2VZ1A 3V0VA 1OHQA 3I2CH 4EQ3A 5FYJD 1NBZA 5TDNA 4HUUA 3NFSL 4JRYA 4HD9A 2IH1B 3JVGC 4MB3A 3F65A 2H8PA 1WF5A 5EU4B 5JIHA 4HIJB 4P5TD 2YPLD 1JP5A 5E08H 3WLWD 4YAQB 4M62L 1NFDE 2E5EA 3G6JE 4J23A 5DRXA 3L5HA 4U1IA 5CD3A 3ULVF 4C56B 5C09D 1F3JA 5GGVH 3V5DB 1KPRB 1OVZA 5ISZA 4DVBA 3U82B 2DYPB 1F58L 2BNRA 3BO8B 2W9LA 4TSBH 5CCKH 2ENSA 5KTEL 4ZTPL 1BFOA 4HWEL 3PP3K 4NBXB 1J5OH 4J7RA 1OTSD 1UC6A 1UT9A 5EWIL 5SWSB 5GS0L 3RTQA 5IMOA 5MI0C 4JO2H 4NKOB 4OFYA 4KRPC 2LU4A 1HINL 3AREC 5MENA 5I17A 4QTHB 1CR9L 1OSPL 3CH1A 3N1QC 4JANA 3M8OH 3L3HA 4MYWB 5F6IC 3HE6A 2FX7H 3BRGC 4DK6A 3BKCL 4X6CF 2DKMA 1W72L 4F9PA 1YUHA 5TE7L 2GK0A 3FTGB 5INCB 3QI9A 1MVFA 2YPKB 5J3HC 2E6QA 1D6EA 1LO0H 2AJUH 4PP2A 1NMBH 5HVWA 2HJKA 1LK2A 2WBJC 4JGJA 4W4NA 3LQMA 1IC4L 3C6SA 5KSBB 1OWRM 4OD2B 2V2TB 2WQRA 5A1AA 1ERNA 1PKQE 5IESH 4S1RH 4QCIB 4L3EE 4PLKC 1WIPA 4HIHA 1HH9A 3WXVH 3UPCA 1KG0A 5GGTH 1I1FA 1UWEL 3X12A 1NCAL 2NW3A 1JCKA 3ECBA 4AL8H 3NCMA 4K23L 2PYFA 3CFCH 4TSCH 3ARZA 5F93C 3U0WL 5C0BE 1CGYA 1Z3GL 2DTSA 2DF3A 3KPQA 1G7HA 4KPHH 3TBTA 4X7SL 5BZWA 1FFOA 5C08A 3RWGB 3BH9A 3WIIH 3OJ2C 2FRGP 4X0KB 3HZMB 3O11B 1P4IL 2MKLC 1MQKL 4HFUL 4JB9L 5D72L 1KJ3H 2Z0BA 2BSED 4GG6B 1Z5LB 5DJ0B 4LF3A 4I0KA 4LDOB 5H94B 4Y5XB 4Z78B 1RZIA 4DVRH 4PGJA 5JOEA 1KJVB 3LKOA 3KPSD 3UZEA 3G5XB 4GKZA 3HC0B 5F6HI 1FC1A 4NN6C 3V6OC 5K9QI 5FHAH 5TPWL 3X13A 5JPNB 4JM4L 4NHCH 2PW1B 1LK3H 2F58H 1ORQA 2K3TA 4R2GC 4R97C 4Y89A 3HAEG 3R8QA 1PEZA 4H1LG 2XA8L 2Y72A 4XPBL 4F7PA 1XZ0A 3GSQA 3IF1B 3WIHL 1BX2A 1HXMB 3QXWA 3G9VA 1MFCH 3E6FA 5JZ7D 2NXZC 2V2XB 2ZG2A 4YDVB 3RWEA 2J8UE 4HMDA 4QTIL 3P4LA 4QHNA 4Y88A 3TH4T 3BPOB 1M71B 4JZNB 4PB9H 1NC4D 5C0CD 1ZA6B 1BOGB 3OB8A 4NQDB 3MLRL 4XC3H 3RRQA 2HMID 3LDBB 1O7VA 5F71A 1CFVH 2M1KA 2HT4D 2IALA 1SYVA 3W11C 5JPMB 5A2LH 2NY3C 4G9FE 4FP8H 1FRGH 2VLKE 1RJLA 3KWWA 1A7OH 2H3NA 2AABH 4CU6A 2R23B 5EU6E 1C12B 2DLEA 1MCSA 3STLA 2PYEE 2JIXB 3RWDA 4WU7B 3O3BA 1IAII 5KSAA 3D6GA 4RGOH 3ARDD 1GL4B 1NBVL 4H26B 2R1YA 4G6FD 4O02H 4ODTH 1UM4H 4MNGE 2CGRL 4GBXA 3PIQB 1R0AL 2LTQB 3C2AL 4J4PD 3RFZC 2JCCA 5FGRA 2R2BB 4IMLA 4WNQA 2X4SA 5CD5C 5C86A 3HPJB 2AK4A 4ODHH 5T3XL 4OQTL 1ZGLA 1YNLL 4P2QD 3WD5H 1F4XL 5GSRA 3UC0H 4ODXA 4OGXL 3NACH 4NN7C 1FIEA 5L2JB 4TNVF 1Z9OA 2NY5H 3CC5B 5CEYB 1Y6KR 1MH5B 4E9LA 1CQYA 4L3EA 1KCRH 3ZE1F 3QULA 1MI5D 4D9LL 2VOTA 5E2UL 4PJ5D 1D5ZA 1NDMA 4ETYA 1TDQA 3H9SD 5AD0A 4P9HH 3TH2T 1R6VA 3ILQC 4PJEF 5L6YH 1MCDA 4NKIL 1WV7T 1ZMYA 2XPGB 2ARWA 3V6FA 4YHYB 3VXRB 1IGFL 4LAQH 3D3VB 1MFDL 3O6MH 3EOAB 3HMXH 1W0WB 5HI4C 3CVHL 2R56H 1H5BC 1DBAL 1RK1B 3B9AA 5HVFB 1PVHA 5J12B 2NW2B 3P4NB 4OLZH 5C7XH 2ZUSA 4TQEL 2LVCA 4NO5A 3I6KA 2ESVB 4F58H 4LCIL 3RA7H 3DETD 5D2LB 4XI5D 1EVTC 2QHRL 1A0QL 4RDQG 1CGSL 5DJAB 1J7VR 4KZDH 3HUJA 2F8OA 3JTSA 4UQ3B 5CEXB 2Z31C 1DVFA 3WKMH 3MLPA 2AEPL 1EZVY 1D5MA 2IBZY 2YBRA 5JOPE 3S3JA 2XYCA 3BYYA 3UJIL 1AC6A 3LQAL 2Q86B 2V2WB 1OAQH 4UV4L 3V4VL 2HFEB 1AIFA 4S10A 4U6XB 2AK1H 5IK3B 4D8PA 5C07E 3VA6A 1MVUA 5HI5D 4GMSH 4RGNB 2HWZL 5DGQA 1I4FB 4OKVA 2J8UA 3U2SB 2R69H 1UZ6E 4JREC 1BZQK 5BMFL 3NABL 3BRDA 1HHIA 1P69B 3FONA 4K7PX 3ULVC 4ONFL 3PQYD 4KV5F 2A74A 2VZTA 3OKLA 3W39B 3PGCA 1T21B 4HIXL 3JV0A 4Q6IC 4PJHA 32C2B 3QEQE 4G9FA 2D31A 4XPGL 3MROA 3O3AA 3SO3C 2OMNA 1T80A 3SDCD 3SPVA 1QRNE 2UUDK 2JCCF 5JDJA 3LPGA 3CSPA 5MEPB 5EU6A 1J0HA 3MYJB 4NNXB 4LDEB 4ZSOB 4E41A 4UQ2B 4ZS7L 1EO7A 4NQEB 4ENEC 5K33A 3N1GC 5C9JB 4DUVA 5E2VH 1T1WB 4YX2H 1TZHB 3GK8L 1N3NB 3P77A 4IHOA 5J13C 3BAEH 5KVDH 2NR6C 4NO2A 4EXKA 4Z18A 5DSCA 4MNGA 1YEJL 5DRZA 1WWAX 3OXRA 1DQQA 25C8H 1FFPB 1NAMA 4OF5A 2EZ0C 4UU9A 3TBSA 4XC1L 2XKNA 3TT3H 3WHE1 4DFIA 2Z8SA 1F2XK 3MRGB 1FNSL 2ITDB 3O3DA 1YEDA 3DSFL 3CFJB 3EDFA 3F8UB 3HC4H 3UTTD 1MJ8H 2QSCL 1A7PL 1MEXH 4R0LB 1A47A 3BMWA 3KLDA 5ALCL 1SQ2N 4PGCA 1KN2H 1T1YB 4QRSB 3SGEH 5GRUH 5HGAB 4ZTOH 1KXVC 2VQ1A 3MLYL 4JVWA 3QA3B 1MHEA 1Q9WA 4PLJD 3ROLB 3RUGF 5MEQB 4MA3B 2HH0H 4JQIH 5TE6H 4Z76B 1Q38A 2EC9U 3B8YA 3T0AA 4C56E 3IFLH 3NH7L 2P24A 1VFBA 5TF0A 5CGYC 3BPNB 1JWUB 2B1HH 3WNKA 1J10A 3VG0L 3EYVA 3BN3B 3HUJF 1AGDB 4KTYA 5AZ2L 3MRRA 3JV5A 2JTDA 5BJTA 3VXUD 4NM8L 5GJTL 1S9VA 1RHHA 3L3DA 3PWPB 4LNVA 4U6VL 2R9HD 4HIEA 2W0KA 4KJQD 1I3VA 3ABZA 4GG8B 1HQ4B 4Q2ZB 3TCLA 2AQ2A 3PABB 1JZ7A 5CINL 5GRVL 4MA8L 2FECI 3LKRA 1BVLB 1W0VB 4JJ5A 2EYTA 3RGVB 3E0GA 4MCZA 2H2PD 1MCKA 4H8WL 4N9GB 2B4CH 5I75B 1G6RL 4NQXA 4XP6L 3TJHC 3DOSA 3HZKA 1JVKA 3UTSA 4N8PA 4YDJB 4YXKH 3IFPA 5C07A 5KSBE 1NAMH 3FQUA 1XGUB 4PJHF 5I1LB 5DZOA 1ONQB 3T3PF 1SJEA 5B8CB 2OJZH 3MGAA 3P9WB 2YD8A 4Z0BH 4G43A 3RX8A 1I9JL 2BOCA 1G7LA 4GAGL 2X9WA 2AVGA 4KWUA 1YC7A 4ZUTB 4X9BA 2HFGH 4LLQA 4XCFL 2RB8A 1YA5A 3EOTH 5J57B 5KJRL 4WFGD 2ADJA 5J6GA 4ZODA 3HE6C 2ATPB 1JN6B 5HYSA 1GRWA 4YDIH 2MMXA 35C8L 5ETUA 4F9PC 3NIFF 1F6FB 5INDB 4Z7VB 5T1MB 3G9AB 5I74B 4QXGH 1EV2E 1QFUL 5IMKA 3QI9C 4XXDA 4I2XA 1T20B 3GKZA 4JFDD 3PGFL 5I1IH 4GG6E 4O2CA 1AGBB 3RZCA 3X11B 5GSVA 4LLYB 1AXTL 1HILA 4S0SD 2YD7A 3FMGL 1HYSC 4CGTA 2A9ML 5FCUL 4HWZB 5HHQB 1Q9LB 3DROA 1G9NL 4JFFD 4MDIA 1YN6B 1XGYH 4UIKL 2ERJC 3BZFA 2BRRL 3QDGA 4HUVA 2NY2B 3TIEA 2AEWA 2G75B 3MBXH 3NOIA 5T1KA 2BC4A 3ZTNL 4QWWD 5IR1B 4NFCA 4LSUL 5CJOL 1CG9A 5LVEA 3ZO0A 1A3RL 2CLRA 2O5YH 1EO8L 2R0ZL 2DBLL 1U58A 4MXVF 4TYUA 3S3PA 3W0WB 1VHPA 1B2WH 4I0PD 2FGZA 2IH1A 2APBA 4LVOB 1D9KA 1JHKL 5ICXA 2CIIA 3BQUD 3EO9L 1ROWA 1F11B 5DQJA 3TN0D 1XT5A 5JUEH 1CICB 3FFCA 3HFML 3OAZK 3KJ4B 3BYTA 3HRZA 1PYWB 5E8NA 3LN9A 3QIUB 2VXVH 5D7SL 2IF7A 3V5DA 1KPRA 4NQDE 1VACB 3FKUS 3EYUL 1C5BH 3QB7C 3BEVA 3L9RA 5I16A 5CSZA 5I1CL 3NPSB 4YXHH 2XRAL 1LE5A 2X89D 4JPIA 2NY7L 4OIIL 1EHLL 2V7HB 2J88L 3ORJA 4P9HC 1G9MH 1OQOA 3FCTB 1C16A 1JGEA 1BQUA 2FZ3B 2AJXH 3RNQA 3VFUB 5ID0A 3VCLB 3AGVA 2BK8A 3EIFA 5C0IA 2NTFB 4BSVA 4X8JA 1UH2A 3VFSB 2E9BA 4G7VL 5EU7E 3V6BR 3D9AH 2RIKA 2VABB 4G8GB 2DLTA 1E28A 3GNMH 5EIIA 4P2RA 1IC7L 4X7FC 1L4IA 5INCA 4LOUD 3PWUA 5E1AA 5EO9B 1CFBA 5I76A 3GMPB 2OP4L 4YHML 5TJWK 1B4JL 3DIFA 4YQXL 5JHDA 4UILH 4QXTA 1KGCE 4M43H 1XIWB 5BV7H 5E8OA 1OTTC 4UI2A 4O5LH 3UTQA 2UVFA 3LB6D 4KJWD 3PP4L 4H20L 4MXQC 4URTB 2HTLC 4M7ZB 4YHKH 5DQDH 1ZEAH 4OGAD 5GQBA 2CH8A 4PJEB 1F45A 2F8VA 1U8JB 3BXNB 1A3QA 4EIGB 2HG5A 2C5DC 3VXRE 4HK0A 3D3VE 2KDGA 2F54D 1YEGH 4R4BA 1X7QA 1F8TH 4GBXC 4EBQL 4X0KA 1VKXA 3O11A 2RAMA 2QQKH 1A64A 3ZYOA 5DRNA 3HC3L 1KJ2B 4ZOCA 1FH5H 2ESVE 2R2HB 3UROR 5BXFA 4Z78A 4TUKL 4Y5XA 1UGNA 1AE6L 5EPMA 1ZLWK 3BKJH 5C3LD 4OF0A 5D2LE 1MRDH 3MXWH 3F58L 6CGTA 3EO1A 4HK3N 1CDGA 1JWSB 3MREA 5D7LB 1J1OL 3OV6A 1HSAA 4XPFH 4XNQB 1KTDA 3RWJB 2CK0L 4P2OB 4Z7UB 4HDIA 5KW9L 4UAOB 1YEEH 2XXCB 5I1JL 2P5ED 1QUNA 3LCYA 3O8XA 1G0XA 1U9KA 3T0EB 3UYOD 2IFFL 4ONOA 4U1JA 1OAZH 3HZVA 5BCAA 4XHJC 2R0WL 3GJFA 2EYRB 3KPRB 4RGNE 4EN3B 3VI4E 2D7TL 2GJZB 2WINA 2VDRL 4CJ1A 4RWYH 1HHKB 1T5XA 1HH6B 1M71A 4KKAD 4OZFG 3STBA 2GJJA 2A0LD 2IH3B 5T5FH 2UWEA 1IEHA 1IGIH 4NQDA 5I1GL 3DI2B 3MLVH 2VR5A 2BHUA 1J0IA 2P8LA 3BZEB 4EVNA 4XVSH 2L7JA 2J4WL 4JPWH 1BBJB 2GAZA 2YXMA 4AMKL 2MCPH 2FATH 3V4UH 4NN5C 5DJCA 3JUZA 1NGYA 4HLZH 3VI3E 2E9WA 3LY6A 1DLHB 2WIMA 4ZSOE 4G9DA 1A6VL 1T0MA 4NQEE 5IHUL 1DSFL 3MACH 1DEEB 4JRXD 2HLAA 4WU7A 1NUGA 1QFOA 3PUCA 3PL6A 1RFDL 3REVB 1IILE 1DBBL 1R3IH 1Y0LB 2P42B 4PV9A 4RNRB 4LKXB 1GH7A 3FT3B 3IDXH 1G7PA 4XCNA 2P7TB 4FOMA 3G6DL 1IAIH 3PE9A 4JM2B 4OLUH 4L3AA 2R2BA 3O9WD 2HAZA 4HC1L 2FYYB 4UUJB 3QO1B 4BQ6A 1QYGL 1LHZA 4N8VA 1H0DB 1KLGB 3CFKB 5DHVB 3P0YL 2AI0H 4LNRA 1JF1A 3CC5A 3HR6A 4P9MH 1LO3L 2VKXA 5F9WB 5EUOA 3GEWB 1OD9A 1MWAH 3L3KB 3K1DA 2H26A 1M4KA 1LO4H 4PBVC 2OZ4A 3HG1B 3STZB 1FAIH 2YA2A 3GSXB 4P4RB 2A6DA 3PF2A 4GAJL 4NJAH 2Y06L 3EJJX 4XMLH 3SDXA 2Q87A 2FEDC 2ZJSL 3CD4A 3ESUF 3DMMA 4PJ8B 2DQCH 2C3WA 3DGGA 2V9RA 3C5SA 4JFHE 1NMAH 3GJFH 3KDMB 4K8RH 4LHUD 2LE9A 3E6HB 5IB5A 3VGAB 1RK1A 1BBDL 1JRHL 4UB0L 2H2SC 3BUTA 3JWOC 4JKLA 4K3DH 4AG4H 3L1OH 3SDAB 4OZGE 3MNWA 3JWDL 2GHWB 3Q1SL 3WO3B 5TF1H 1I3GH 3C60A 1AGFA 3I9GH 3PWPE 4WI7A 1YYMH 1CL7H 1SHMA 5BQ7B 4U05A 2AEQH 3C08H 1BEYH 4R90L 2EC9T 2XFXA 2EIBA 4JJHA 1EBPA 5EU3B 4CADA 4KUZH 1L7IL 4NC0B 2DLFL 2Q86A 2UWEF 3NCFB 1RUQL 5J11B 3BPLC 4NNYA 2NY4C 3CZFB 2E6PA 4PJIB 3GKWH 2DLGA 4OAWB 1JPFB 4F7MB 2I9LB 1KYOK 5KANI 1JNNH 1NKOA 2CRMA 4OCSL 3RDTD 4JR9L 5K9QG 4WTZG 3BFOA 4CVWA 2C7UB 4AEFA 2FR4B 1FYTD 5EB9A 2OYPA 4JFZH 1K8IA 2ITCA 4I3RL 1JI2A 3SGKA 3S37L 3QISA 32C2A 2OZ4H 2Q7NA 4XVJH 3V95A 1P7HL 4PD4J 5HHMD 2E7LA 4Z7VE 5L2KB 3MYJA 1TQBB 4DUWA 2PXYA 3ARBA 4ZAKB 3MO1A 2BVEA 3HNTL 4NQEA 4AYFA 1HHGB 5DMIL 3TC9A 5MEOA 1PKOA 3L3JA 4FQIL 3H3PL 3RVVC 3HNVH 4PUBL 5EUOF 1EAPB 5F96L 4BELD 3IJSA 2VB5A 3F7VA 1J12A 5A3IC 3HB3D 3VD7A 3EFFA 1JHLH 4NCC1 4WFEE 3D87B 2WK2A 2WMPA 5E7BA 3RVTD 3HLAA 4MQ7B 2X1WL 4ZFFB 3SDXF 5A2IH 5IOPB 1YNTB 1G9MC 1WTLA 4CBPA 3BIKB 4NO3A 3GGWA 1NJ9A 1I8KB 2AJVH 3VGHA 4QLRA 4AEIL 1I8LA 4V1DB 2IANB 3F7YA 5DEZA 1DE4A 1Z9SA 3W0WE 2WAHA 3E8UL 3VXPB 1WWCA 1FFRA 1EO5A 1EHNA 4X9HA 4PRPD 3OWEA 3VRLE 4L4TA 5HGAA 5JIPA 4MMXC 1K5NA 5EZJB 3WDHA 5D1QB 3RJDA 1CDCA 4S1QL 3RZCC 4W6XB 4IOIB 4ZQKB 1MCHA 3GMOB 3PXHA 4JVPA 1XEDA 2VZ3A 1IBGH 4HPYH 1Q72L 2SEBA 1XF4B 5CBEA 4JFPA 5KOVC 4OZGA 5DTFB 5BV7C 2AV7B 3LVEA 4KRMB 3QFDB 1CBVH 2HN7A 1JZ4A 5ENWB 3WNPA 3QJFA 4P49A 3BWUC 4LP5A 1EJOH 3R06A 5ITBL 4MAYB 4FQLL 3PWPA 2F19H 3L5XL 2ADFL 1G7IB 5FK9B 3PABA 1D9KC 3FB6A 5E1HB 3ARPA 2VL4A 4S0TD 1H9VA 4G8GE 3IU4L 3FO1A 3LKPA 2X4NA 3FB7A 4ZNEA 3RGVA 2GY7B 4LVHC 3MRFA 1T03L 4S2SB 4JO3L 3MLUH 5BOZG 4FRWA 3U30B 2HLFD 4M1GL 2ZP0T 4OBSA 1DR9A 3GSOA 4BZ1H 1CE1L 5GRXG 2VZUA 4YDJA 3QRFM 3B9DA 1F4WH 4DFHA 1CXIA 2FBJL 3GSWA 3O3UN 1HK6A 1E6OL 4NJ9H 5B8CA 5IB4A 3DX7A 5C2BH 4MJ6B 3S88H 2GYSA 3TV3L 3KXFA 3DECA 1YQVL 43C9B 1LDSA 4MWFB 5I0ZA 1M05A 4PYGA 5E0QA 1YYLH 4X6FB 3BW9B 4NZUH 5ACLA 5D8JH 3A67H 5ADPL 1MJ7L 1AC0A 1CFQA 4KDWA 1K6QH 4NKDB 3MLXH 1UH4A 3DURA 2VRAA 4WW2B 5EC2B 4HKJA 3T08A 4PJAF 2VISA 2GTWB 2MKWA 4YJZL 3ILQD 3EJYD 2BY3A 2OCFD 5INDA 2UZYB 4CUCA 2V17H 1KN4L 4WEUD 1QVOA 1QNZH 2QSTA 4NQTA 5DJ8A 2FNBA 1LQSR 3HMWH 3V0WL 4I9WD 3D85D 4YDLC 5HI4D 1GC1L 3L7EA 5LBSH 4Z5RA 5HYJB 1Q9LA 3EDDA 2VUOA 5C70A 4OUOA 5E8EA 2R2CA 2PW2B 3CMOL 4Q9CA 3RHWK 4QHLA 4QRRD 1K9TA 4JLRB 5D7LE 5BS0A 4WY7L 4WHDA 1AO7B 4PJCB 4A6YL 4ZFOB 4LRIA 4HK3J 4Z7UE 5EULV 1T3FB 2BNUA 1K3ZA 4M6AA 4ZG1A 4F7EB 1OSZB 3NCEB 3KR3H 4TTDC 4OT1H 4OV5B 2XZCL 3T0EE 5T1LD 4D3CH 2H32B 1HEZA 1E4WL 2FEEI 2KL6A 5K59F 1IAMA 3KPRE 2DQHL 1KENH 5F7LB 3MODH 4B50A 1AI1H 3SCMB 4JKMA 3QFJB 1PYWA 2HRLA 4KJYA 5I8CA 1LD9A 4OD3L 2XWJA 3BKYL 4LEXH 1QFHA 4XP1L 5E95B 4HKXB 2E8YA 3OG6B 1FNFA 1INDL 1EGJH 4H5SB 4X6DB 5E9DD 4PRDA 3UEZA 3ZYZA 4N1HB 4HWBL 4I4WB 4FZEL 4XPAH 3PHSA 1A6WL 5SWQB 4BZ2L 2OR8A 5I9QC 2OTWA 1FVDB 1IARB 1GVIA 3QNXB 4OLVH 5L88L 3RWFA 1IKNC 3VCLA 2NPLX 2NY6B 4PREA 3O8XC 3BGMA 2UVEA 4J3SA 1MCOL 5EO1A 5HHOD 3P9LA 4JY5H 3G5ZA 1W72A 3B8SA 4NQVA 5FOBB 4K8RC 1QHPA 2ICEB 1TJGH 3OJMB 4LCYB 3BMVA 3IDIB 4TOYH 3VD5A 5JA8B 1U93B 4YHOH 3OR7B 3VDCA 1FJ1B 3QT2A 5TDPB 7FABH 1G1YA 3DUSA 5F7NC 1KEGH 2GCYA 5IMLA 5FXCH 4FMFA 3RBSA 4HXAH 3SQOH 3QQ4A 2NYYC 1XIWA 4FTVA 1OAYH 2OM5A 2EZ0D 3S97C 3GSRB 4R7NB 1A6TB 5BRZB 1A9EA 1DQJA 4ZNCD 1U8MB 3NFSH 1T22B 3SGDH 3HG1E 3MRJA 2ADGA 1A3LL 1LP9B 3ARFB 3MRQA 4AK1A 1FQ9C 1N0LA 5FKPB 3PL6C 3UBXB 4NCDA 3ALXA 1QSEB 3IKCB 4X6BB 3QJHA 3CUPB 4PY8J 5E4IA 2EE2A 4K7FA 2OL3L 2VXQL 5D1ZD 5DD6B 5EBWA 3SQBA 2YD3A 3S4SA 1T1ZB 2F9BT 4PJXB 1D5IL 1PEWA 2AKRA 4KZEL 5DS8A 1F58H 1MWAB 2NY1C 5ITFB 4KDTA 1FZOA 4MJIA 2R1WB 2I26N 1XF5B 1I7ZA 4JG1L 3CX2A 5KTEH 1P7QD 3IJYB 4ZTPH 4HWEH 4XZUA 4P3DB 5DQ9B 1NKRA 5EWIH 1AFVL 1OTUC 5GS0H 1S7WA 4O00A 1AP2B 2AXGA 1HINH 2IEPA 1KB9J 4RFEB 1G6VK 3O6LL 1OSPH 5IHLB 1XGPA 2CLVA 1S5IL 3D39D 2NCMA 1NGXA 1WWWX 1U41A 2XIDA 1SYSA 3BKCH 1B4RA 4PGDB 3DMMC 2HVKA 1N7ML 1W72H 1NLDL 2CMRL 3U48A 4HF5L 1KC5L 2GJ6A 1OM3L 4QT5A 4C57C 5DUML 4PJIE 6FABL 1IC4H 2J8HA 5HDQH 5A2FA 1CDYA 2Y6SC 5JHLL 3C60C 1HHKA 1X6NA 3TJHD 2XNAB 2O93L 5ISZD 1UWEH 1NCAH 4ONGL 1IVLA 4CW1B 4GKNB 2R2EA 4LGRB 3VMOA 4Q7DA 3U0WH 3I6LD 3UBXI 4RSVA 5C1MB 4X7SH 3RTQD 4KI5F 2E7BA 1VADA 3MMEA 4HIIB 1ZSDB 1TJHL 2R4RL 5KS9B 2EDDA 1RMFL 4PGBB 4FFYL 1P4IH 3ISWA 5I8OL 5D71L 3NZ8A 4J8RB 1ED3B 1MQKH 4HFUH 4JB9H 3JV6B 4E0RA 1RUAH 1OGAD 4LVNB 5D72H 3HE6D 2BOBA 3FJTA 5HGHB 1YY9C 3PWLB 4Y4FA 3H6JA 4RQQB 1U3YA 4G8IB 4HGWA 3P4OB 4NHUB 4PG2A 1V3KA 4KQ4H 1I7UB 1G84A 2YD5A 4NO0D 4LSRL 1S7VA 4R4FL 4UUJA 3ELAT 4LSQL 5ALBL 3IVKB 4U3CA 1XGQB 1H0DA 4QRPD 4LLMA 4CMHC 3WHXB 4J1UB 5TPWH 1VPOL 4JM4H 3TO4D 2VTFA 2A38A 3SGKC 4Y8AA 5DK0A 4V1DE 3RI5F 1U8LB 2FO4B 2IANE 4WO4D 3SE4C 5IF0A 3VXMB 3MV8B 4W81A 3VFNA 2E7LC 3QQ3A 2XA8H 2N1KA 3STZA 1HDMA 1GGIH 2PXYC 3ARBC 5DUBA 4I13B 5DHXB 3RWHA 1N0XL 1Z9MA 4JKWA 2OQJB 3D0LA 5EN2B 4QTIH 1MY5A 2ZOKB 5L7XH 3EHBC 3KLHD 3E6HA 2DIAA 3DV4A 1AGEA 4N0UA 4NT6A 2BHYA 3MOAL 5TE4L 5KN5B 2QR0B 2ILLA 5DC9B 1LDPL 2YC1B 4ELMB 4JDZB 3H9HB 1UM6L 5E6ID 1I8LC 3DX9B 1TJIL 4WI6A 4PRIA 3EJZD 1T2QL 4LLVB 4LSDA 5ESQA 5TFSL 1NUDA 2X7LA 3MOQA 3JXAA 5ERWA 4OCMC 4RAVB 3D2UD 1ND0B 3MJ7A 3I3DA 2CGRH 3NN8A 4YC2C 1R0AH 3C2AH 4RX4A 4KK8D 2EE3A 4JZJA 3PNWA 5EIVA 3VWJB 1TVHA 5DMJB 5DR5H 3D69B 4PJ9A 1HCVA 5T3XH 3ARTA 3OAZH 4XAWL 3QZWB 4U2ZA 1YNLH 3WBDA 1UXWA 1GCFA 4OTXL 1F4XH 2BNQB 1M7IB 4OGXH 1NEZB 3JZ7A 2IPUK 1CLCA 4FZ8L 4XP9L 2P8PA 2PO6A 5GGQL 2J12B 2C7UA 3FHAA 2KKQA 4D9LH 4LSSL 1K8DB 4F37F 4RAHA 2W0FB 5E6ZA 2A6KA 4NKIH 1Q0YL 1OTTD 4AT6A 1IGFH 3QUXB 3B5GA 4A2MA 4MNHA 2HTLD 1MFDH 1BQHB 1IAKB 3CGTA 4EI6A 4X4YA 1JRHI 3O6KL 3RGVC 2JB5L 3CFEA 5LXGL 4O2EA 1N5YL 4AQ1B 1J8HA 2CIKA 1DBAH 4P57A 3WDIA 5KSAD 3HI5L 2V5TA 3ARGA 3DBXB 3TBYB 3VXTA 5CEZL 1X5AA 2P44B 1IKFL 3ARSA 4D0CB 4FQCL 1MREL 5B8CC 3K8MA 5HYJE 5FB8A 3RIFK 3NIGE 1TVBA 1QFWI 4LCIH 1WTGT 5HPMB 3MBED 3TA3D 4BFGA 4NQSB 1VFMA 3B83A 4LQFL 2QHRH 1HOCA 3SKUD 2WIIB 1A0QH 1CGSH 1UQSB 1XF2A 3LRHA 4MQ7A 3C5JA 1AGCB 4ZFFA 1AO7E 4PJCE 5DA4A 5EDXA 4TPRL 1C08B 3NPZB 4YK4C 4PGEB 2DTML 3G5YA 4L3ED 4Z8FL 2AEPH 4P5TA 2YPLA 1H3PH 1ETZA 1S8DB 4DKFL 1NC2D 4HH9A 3UJIH 2FB4L 3F5WA 4KJPC 1FSKB 3LQAH 4U1NB 3GBML 5I1AA 1A02N 3GB7B 5EBLB 5IGXL 1XR9A 3IGAB 1WIOA 3V4VH 4NSKA 3CXHK 4ZO8A 1JYXA 3GFUA 3SJVB 2WANA 5C0BD 5JW4Q 4ZQKA 4IOIA 3QFJE 4JQXA 3SY0B 4F2MB 3GMOA 2HA1A 1PZ5A 1R5WA 3NABH 3MNVB 4PJBB 1XF4A 2L0DA 4MHHI 4Y5YB 4YBLB 5IIEB 4ONFH 4X6DE 4D0DA 5GJSL 4C58B 5EOCL 3U46B 4MAUL 4HIXH 3CK0L 5DO2D 4L3CA 4XPGH 3C6LA 1R3JB 4WDIA 4UOW1 3L6FA 1JNHA 2BCKB 1CFSB 3I2CL 1RU9L 4J3TA 1X5JA 5C0AB 1CFTA 4JHZA 4ZS7H 4J3WA 2M2DA 4LVOC 4M02A 3WE6A 4Z7NE 1L0XA 3GSVB 1DVFD 4LCCB 1CQKA 3GK8H 2R4SL 1IM3B 4KMQA 5A2JH 3QUZC 1YEJH 2AQ1A 3D1MC 1JGUL 4JE4B 4PRHB 3MJGX 3QUMB 1AD0B 2D7PA 4L29B 4X9GA 4PY7A 4XC1H 4KVNL 1A5FL 3QIWA 3BP4A 5E03A 5FYKU 3KJ6L 4L4JA 4I18A 4K55A 5GS0C 3DSFH 3CCHB 2WBWB 2BMKB 4RA3A 2VR4A 5BRZE 1A9BB 4NUGL 2QSCH 1A7PH 4OQ1A 1NFIB 1EVUA 3HR5B 2ORBL 5ALCH 4X6FA 3M17B 1LP9E 3KYOA 3GSNB 3HS0A 4G9FD 1QR1B 1QSEE 3MLYH 1BVKB 2C1PA 3TCXA 3BGFB 1QO3B 3M8OL 1I85A 2VLKD 2AAVA 3DO7B 4O51B 4L1HA 1IGJA 3OKDB 3O6FD 4XCEB 5EU6D 3WO4B 4KI5C 5F7HA 5DGRA 3OAUL 3VRIA 3NH7H 4ZS6C 4PJXE 1UACL 2PYED 4NYLB 4AH2B 3GMNA 3ZDXE 3VG0H 1A1MB 2AJUL 3KPSA 2Z91A 1PY4A 1IEBA 4ELKB 3DPBA 3BISA 5IQ7H 3QPXL 3MPCA 2NZ9C 2VDQH 2Y1VA 1URLA 1AKJB 3WUWA 5B39A 2QQQA 4NM8H 2KUTA 5GJTH 2PTVA 3ILPB 1FFQA 3QSKB 3W9EB 4U6VH 3IETA 3ZE0E 2BVTA 2GW5A 1OP9A 3VDAA 5CINH 2EDJA 3OHXB 4MA8H 2F15A 2BVOA 3NAAL 2M8XA 1TQCC 5DEFA 1OAXL 1F5WA 3FOMB 2RCSL 5DFVD 2GTZB 5EUKB 4XB8A 2Q1EA 4H8WH 4Z77A 3IU3B 4XP6H 1R3LB 3OX8A 1QLRA 4GRMA 4K94L 5FKAA 5M95B 1T83A 4KDTC 1DP0A 1PQZA 4XNMB 4YEFA 3BGAA 4EKXA 3LEXA 1LEIA 1UM5L 3X14B 4ZXBA 5C6TL 3OL2A 1I9JH 1PX3A 1MAJA 4GAGH 2NY4D 4NZTL 3O4LB 2AERT 5FCSH 5IBLC 4DVRL 2AJ3B 4MZ2A 1F3RB 1GGCH 4XCFH 3UPRA 4Y16D 5KJRH 2EE6A 5I2IB 1EDQA 5DD1L 4WHTA 1BD2B 4KK6D 4MD0A 5FHAL 4WGWB 1HHHA 1RURL 5KS9E 3A6CL 1FZMB 4X83A 3QNXA 5J9PA 1RZFH 35C8H 4UDTB 4OF7A 4DZ8A 1WBXB 5C0GB 1S9XB 5DVOA 1QFUH 4NGHH 4J4PA 4K2UH 3ME0A 5J0BA 3PGFH 1T1XB 4JO4H 1YMMB 4BFEA 1AR1D 3U7WL 3FN3A 1R24B 1AXTH 2XQYK 5JOPD 3FMGH 1QQDB 2A9MH 4G6JL 5FCUH 1R3HA 1IGTB 2XV6B 3MRPA 1G9NH 4MB4A 2JJSA 2YXFA 4UIKH 1WAAE 2BRRH 1RIUL 3ZL4H 1H8OA 5C07D 3O45B 1GGYA 3RAJH 1EH9A 3AMLA 2AJSL 3KPLB 1AD9A 3RKPA 4ODUA 3O4OB 3ZTNH 2CUMA 4LSUH 5EC1B 5CJOH 2K7PA 5A3ID 3OPZH 1A3RH 5BRZA 3VXME 1EO8H 2R0ZH 3DRQB 2DBLH 2VZSA 2XWBB 3MV8E 1L9MA 3DRTA 1OQXA 5DJ6A 4EZMA 5E99H 1AXSB 4HV8A 5EU5B 3MUGB 2CDEB 5F89A 1SJHB 2EXWC 1FLRL 4QF1B 1U8PB 2CRYA 1JHKH 1ORSA 4KKLD 3VJ6A 1AXIB 1P2CB 3EO9H 3U6RB 4KHXL 3QEQD 4TN9A 1OPGL 4IRJD 2VDKL 4Y4FC 3WIFB 1MUJB 1OLLA 3HFMH 5F1OB 1QRND 4WFHE 4MB5A 5D7SH 2XZZA 4PG2C 5HJ3A 3L3GA 4HWUA 4PJXA 2GKIA 4P46B 3EYUH 1U0QA 4DZBB 4NKMA 1LO2L 5I1HL 1RZGA 5F7DA 1OP5H 5ITFA 5I1CH 3MLSH 5E8PB 1DFBL 3GMLA 2XRAH 3QIBA 3UC0L 1QHOA 2NY7H 4OIIH 4ELME 2J88H 1PG7L 4YPGB 3OAYK 1OARL 4Y19B 5IVXB 1ES0A 1KCRL 1L7TH 4APQD 3D25A 8FABB 4LFHG 3SKOB 2C3GA 5L6YL 3CDGB 3G6AB 4G7VH 4NRZB 4OZIA 1HWHB 1E27B 2E9JA 4GS7B 1IC7H 3FOLB 3RP1A 1IL1A 2B39A 2DI7A 1L9NA 1D9KD 4KROB 2OP4H 4YHMH 1B4JH 3AFLA 4YQXH 5FA3B 3LSOA 3BP6A 4U1HA 5H2BB 2BNQE 3ZKXB 5D1XA 1REIA 2CLZA 3PQYA 3T3ME 4PJ7B 5C7XL 2NX5B 4JFEB 1TNNA 1MRFL 4OKDA 3B9EA 3OKMB 4H20H 4LLUB 1T66D 2OTUA 3KVQA 1EERB 1WFOA 2EIZA 5IW1B 3RA7L 3SDCA 2EH7L 3FRPG 1R5VB 2DYPD 1T7WA 2MSPA 3IRPX 2XY1A 1CXLA 3LQAC 4NFBA 3D48R 1NGQL 2EYSB 4HIIA 1ZSDA 4ACPA 2GITA 4PGBA 3I02B 2E9IA 1T04B 2G9HA 1QPXA 4YH6A 4JZJC 3K4ZA 1FG2A 3WFEL 1UA6H 1ED3A 4PJ9C 1CDJA 3QNZA 3HC3H 2KZ1B 2CJUH 4W68A 3TBWB 1IGCH 1V3MA 1BJ1J 4P2RD 5DHYA 3OSKA 4NRXB 1A22B 4G8IA 4FQJL 4L8DB 4TUKH 4XBPB 1GYAA 1UJ3B 4NQCA 1AE6H 4MZ3A 3P4OA 2PO6C 2OR7A 3EYFB 5DJYA 1T2JA 2OR9L 4RRPG 1BOYA 2NY0C 1ZLUH 4NOBA 1A4JA 5A40E 3VMNA 3CVHB 1FBIL 1J1OH 4FNLL 3E3QE 4JFOB 3H9ZA 1U8LA 4ZUWB 5FYKE 3WN5B 2CK0H 3LKNB 3NGBC 4U1MB 3LS5L 5ID1A 1CDIA 3MV8A 5I1JH 4A2LA 4IRSB 3CAFA 3SJVE 4LPUA 5AYUL 2HFTA 4AY0A 2IFFH 5IFJB 2R0WH 3ARGC 2V5MA 2D7TH 4G6AD 5E2VL 3KYNA 2VDRH 4PG9A 5I6XB 5CBAA 5EN2A 3BAEL 5I8EA 5IB2B 1WCQA 4I5BA 3C8KB 4PJBE 2HFFA 3VXUA 25C8L 3VGFA 5AUMA 1BJMA 2P43B 3TBVA 3FL7A 1FGNL 5I1GH 2CKBL 2W65B 3T04D 3VFOB 3BWAA 3H42L 4BFIA 4OZIF 2J4WH 3EYOB 3CSBA 1KNOB 4AMKH 4PR5B 1YEHL 4P5KB 1I8IB 2VLME 1MFEL 5IB1B 4RMWA 2R15A 4P5TC 1TXKA 4GFTB 5C0AE 1CD1A 5F70A 1RV6X 3T4AB 4DAGL 3WLWC 1A6VH 3RY6A 5IHUH 1DSFH 1KIRB 1VFAB 3QAZB 1I1CA 1NCTA 1KN2L 1RFDH 4K3JL 2Y5TA 3QO0A 1U91A 1DBBH 4OZHB 3AAZA 2IAMB 5IVNA 5CGMA 1FNEA 4EEEA 1RULH 3OXSA 3UJTL 3G6DH 4OCXL 3P9MA 2VIRA 4PRHE 2NMSA 4JQXC 1AY1L 1NGPL 5TE6L 3O8XD 4XH2A 2D3VA 4WHYH 3DX8B 1HSBB 1WBZA 4HWNA 4HC1H 1FN4B 3ALPA 3BH8A 3T0WA 2PETA 1LE9B 4TRPL 2B1HL 5B4MC 1QYGH 3PDOB 4OSUL 1YJDC 2J7LA 1M7IA 1WITA 1KACB 4LKCB 3L3OB 5FUZL 4N0FB 1LO3H 4I1NB 3C6LC 3MRDB 1RIVL 3C8DA 4NQDD 3FQRA 4XGZA 5TQ0L 1XAUA 1ZT1B 2NYYD 1RVFL 2WW8A 4GAJH 3S9DB 2Y06H 1L6XA 3MV7B 4ORGB 1L6ZA 1IAKA 4H8WC 1BIHA 1EAJA 5DFWH 4HUMB 2ZG1A 2DQGL 1ZK9A 3DVFA 1INQB 2VE6B 4G8FA 4EDWL 3RQ3A 1BBDH 1JRHH 4UB0H 4PRAA 4JFFA 3QIWC 3JWDH 3S35L 4FFZL 4EI5B 3Q1SH 4LU5L 4MD4B 4DKEL 2AEIT 4I18C 4YHLH 4HG4K 4KKBC 3JWOL 2X05A 2JLLA 1I1YB 3G08B 3UBXG 2X1QA 4Z0BL 3T0VA 4YE4L 4F9LA 1FV1A 4UOJA 2EIEA 3T2PA 2OSLB 2V7NB 4PGZA 5C09B 1UQSA 4I0PA 3MYZA 3KPNB 2HRPH 2GT9B 5EBMA 2APFA 1OTUD 4E5XA 1CE6B 4NC2B 1ULVA 2D7QA 5IBUB 1I85C 1L7IH 1UXSA 3O2VH 1E4XI 3NVQA 2DLFH 4WWKB 3HN3A 1F6LL 1P1ZB 4U1NA 2FX8H 1RUQH 3IGAA 3H9YA 4R3SB 5T5NF 3D3VD 3ULSA 2ZSWA 1VEOA 5CWSB 1PFCA 3TO2A 3DMMD 1X44A 4OCSH 1NMCC 1G9NC 4ZOAA 3IXTB 1BMGA 5IMMB 3SY0A 1TENA 1CGUA 1IEAB 2X89A 3O4LE 2KQNA 3REWB 3AC0A 2P5WA 3TFKD 2YD1A 2ED9A 2YOCA 4YHPB 1U8IB 4M61B 4I3RH 3AXLB 1BD2E 4XP5L 3MRNA 5KAQF 2CKNA 2F53B 1B0RA 3C60D 3S37H 1G6RB 1NCNA 2BJML 3I84A 5FYJU 5HGBA 4FQXB 4JFYA 5JZ7C 2BCKA 1CFSA 5JORB 1BVZA 5AG9A 3UO1L 4OCNC 4OUUA 2CO7B 8CGTA 3HNTH 1UVQB 4WUUA 3TZVB 5DMIH 4OM0L 4NCC2 3GSVA 4X80L 1YMME 4B7IA 4FQIH 1DQLL 4Y2DB 4FQQB 1JWMB 5T3ZE 1T83C 1C5DA 1JPTL 2HMIC 4JPKL 5CMAA 5F96H 1V3LA 4ZXBC 3WEXB 2YUXA 3QUMA 2QSQA 1MCFA 4RGND 3OKOA 3ARWA 2IBBA 4P2YA 4FXGB 1WCBA 2BMKA 1A9BA 4I48B 1NFIA 5F1KC 1BZ9B 1QSFB 3E8UH 1SEQL 2AJXL 4GW1A 4ZUVB 2LFGA 3DYMA 4J4PC 1ZS8B 3PV6B 4DEPC 5L8JB 4RISL 3V4PL 1P84K 3V7MA 5HSFA 4S1QH 4HKZA 3MJ8B 3N0PB 1EEZB 5DZNA 5AAMA 3RNKA 4NQED 1Q72H 4HX1B 1S7QA 5JO5A 2ZCKH 4NRYB 2JJSC 2B5IB 4CMMB 3OG4B 1UYWL 4OB5L 1ZA3A 2IQAB 3BSZH 5ICYA 2DJUA 3VFMA 4M43L 4U7MA 1N5AA 3AS1A 4Y19E 5ITBH 1OP3K 5IVXE 4FQLH 2GY5A 4QNPF 3L5XH 2ADFH 4YHKL 1R3KB 1NC4B 5C0CB 5B3JF 1ZEAL 2P5EA 3L5JA 5I73B 3ZLQC 4E42B 3K8KA 4PTTA 2EDEA 1A8JH 1P4LA 3FB8A 4CVXB 1OCWL 2XWTB 3IU4H 3EGSB 1QP1A 3O41B 5JDSB 1T03H 4IOFC 4JO3H 3KPOA 1F8TL 4M1GH 12E8L 4M5ZL 1UENA 1LMKA 2AV1B 1CE1H 4L4TD 1GZQB 2HTKC 2QQKL 4BH7B 2FBJH 4XI5C 2YEZB 4PJ7E 1E6OH 2NX5E 4JFEE 5SX5H 3ARDB 4DTGL 5IKCA 3AY4A 1FH5L 2BVYA 3DNKA 3QIBC 4JFHD 3U0PA 1DANT 4G6FB 5AZEH 3TV3H 1YQVH 3ETBF 4ONHA 1Q8MA 2R8SL 3BI9X 5ICZB 4NUJB 4HWBA 1Q9KB 2ADIA 1MHHB 1MRDL 3TESA 3WFBH 3SDDB 5D5MA 5ADPH 3AUVA 4JRXA 1MJ7H 4P2QB 1VGKA 5C0ND 3QZWG 5F3HB 4MX7A 3LAFA 1FZMA 1NEZG 3PWPD 5HI5C 5C0DA 1J1XL 4X7TB 1P6AB 1EBAA 1KN4H 5DUPH 5DVKA 4WI4A 4MJ5B 5GRWA 3H9SB 4MHHG 5CP7B 1T1XA 1YEKL 1MAKA 4YEEA 5DRWB 4QKXB 1CLZL 3RGVD 4AM0B 1G7JB 5GGRA 3V0WH 5D1XC 4JG0L 5D96B 1GC1H 5JNYB 1JK8B 1QQDA 4F7TA 5EOCJ 1YQ2A 1BPVA 2Z92A 3BE1L 4Z7WB 3UTPE 2CXKA 2ZPKL 3DXAB 4N90E 4I3GA 3CMOH 4GO6B 4P4KA 3QUYA 4IEFB 4XWOC 3SDCC 1DN0A 4JHBA 4YHIB 1P7KB 5D7IA 2MOVA 4CU8A 4DKDC 3RU8L 1QOKA 4PB0L 2VDLL 5D2NA 4YFEA 3LD8B 5GGUA 3BPCA 3FO2B 2X4TB 1NUFA 2FATL 2ZUXA 1U92A 4ZUUA 2IPKB 4HXBL 3S36H 3NCBB 1AXSA 2Q6WA 2XZCH 3HPLB 4N0RA 5JXAL 5IHBA 5B3NA 1E4WH 3MOBL 2OL3A 1P2CA 3FQTB 4UIMB 1JGVL 2DQHH 1U8KB 4KJPD 3WIFA 1VESA 3V8OA 4BKLA 2X4UB 2A83A 2HKFH 1OF2B 2VLJB 4F3FA 3QXVA 1ZHLA 3QQ9C 1ZHBB 2NLJB 4MVBC 4OD3H 5C0RL 3DVGA 4PBXA 3BKYH 4XP1H 3TNMB 3NZHL 1INDH 1NANH 1BJ1H 4OLWL 3P73A 5E8PA 2D2OA 1UFUA 1X4ZA 2W60B 4HWBH 4Y1AB 4F8TA 1ZGLM 4FZEH 4ZYKA 2HVJA 4QRUB 5A2KH 1A6WH 3VXOB 4BZ2H 1YEIL 1EIBA 2AI0L 4YPGA 5E5MB 1UWXH 4M9PA 4TUJB 3TVMA 2I5YL 4PLJC 5L88H 4LLDB 1S7TB 5HHPB 3P30L 4Y4KB 2H9GA 5M94B 2NY2D 4WFED 1G9EA 3W5NA 1JMZA 2F5AL 5SV3A 3HA0A 1EFXB 1MCOH 3ZDZE 4OZHE 1AHWC 1DEDA 4XRCB 1E27A 5L8KB 1HIML 1MELA 2H1PL 3FT4A 4M00A 3W0WD 3DGCR 1MRCH 2Z93B 1D6VL 1W8NA 1AQDB 3PWVA 1TTUA 3JWDC 5T3ZH 1EEYA 4YZFF 1QEWA 3MJ9L 5D5MF 4AG4L 1CLOL 5K9KB 4XNZB 2OI9B 1CICD 4Q58C 4RMTA 1ZXQA 3QIUD 4WFFD 5I8KL 3RL1A 3P0GB 2BSSB 4HJJL 1XFPA 3SKNB 5GPRA 3QDHA 3BIAX 1A3LH 2W0PA 5GGSB 2ZNXA 2IGFL 3RY6C 4RZCB 1BIIB 3O0RL 3MV7E 4X98A 1VENA 2AEQL 4L4VB 1BEYL 1BHGA 5ANMA 1ZHNB 4G8EB 3GM8A 5E00A 2ICWB 2OL3H 2VXQH 1RJZA 1NCUA 5FYJE 1QG3A 4PJDB 4ZUSA 4KZEH 5D7KE 4L8SA 5D7IF 4YGVA 4HG4J 3LN4A 4G8GD 3VFRB 2VWEC 1D7FA 2JELL 4JG1H 2W91A 4L8DA 4PJFB 4BH8B 1UJ3A 4RMUA 5JIKA 5JW5A 3C2SA 2D03L 1AFVH 2YSSB 4EUPB 2H6PA 5F7KC 4AIOA 5B38A 5C09E 1I3RB 2GI7A 1M6OA 3VXSB 4U6TA 3O6LH 1O7SA 1OAKL 3MRHB 2NZ9D 3AB0B 3QXUA 4K7PY 2A2QT 3T1FA 5D6CB 1XIWD 4HHAA 4PRPA 3MFFA 2OJEA 2NNAB 1T0PB 2P45B 2OXHA 1FLTX 4KFZC 4KU1A 3CDFA 3T8XA 1XR8B 1N7MH 1BF8A 1NLDH 2CMRH 2IPUG 4HF5H 1KC5H 5IVZB 3JBG7 3R4DA 1OM3H 3VH8A 4FFWD 3KNBB 2XN9B 2I25N 2LAAA 1VSCA 4BSJA 6FABH 3NCYP 4XBGB 1X5XA 4Q74A 1RUKL 1KTLA 5IEHA 3HNVL 3RBGA 5JHLH 1JPGA 1IGYA 2DQEL 4JO1L 1N6VA 2CR6A 4F9LC 3U4EA 4ONGH 2DM2A 2B2XL 2I9TA 4MJID 4N0YL 1Q94B 4HT1H 4KKNA 4LPYA 1C1EL 1U8QB 3OKEB 1DDHB 2F53E 4I0PC 4KKCC 4U49A 5EOQL 4BQ8A 1KFAL 3BOVA 3X3FL 1PG7W 4JDTL 5IEKA 2K9UA 4YNYA 5IB1A 5IBLD 4B5EA 4Z7QF 4QHMA 3WLBA 2ICWI 2R4RH 3VRJB 5EO0B 4MCYB 1KIQA 4LHJB 1RMFH 2R0LL 5E6YA 4QHUB 3N85L 1CF8H 3LH2L 5D7LD 5I8OH 5D71H 5E4EC 3NIDE 1RK0A 2AJZA 4U1LB 1UB6A 4OZHA 4JN2B 3IDJA 4P2OD 1UKTA 2D7NA 1WBYB 5GS1C 4O58L 3DX8A 1OD7A 1HSBA 3DWTA 3F6LA 1JV5B 1FN4A 4MSWB 1I7RA 4X99B 4F57L 4LSRH 5CZXC 1N26A 3FFDA 1LE9A 3B3IB 3KPRD 4LSQH 5ALBH 5FF6A 1GOHA 2Z9TA 3IFNL 4JFDB 3I75B 1VPOH 5F3BB 4UDUA 3T0XA 1VA9A 5BVJA 1Q9OA 1ZE3C 3MRKB 1QSFE 4NDMA 3KPPA 1E4KA 3FT2B 1CDUA 1MCWM 2DMKA 3JV4B 1N0XH 1QLFA 1T7ZA 4RIRB 2CUHA 4WIQA 3RWCA 3LRSB 4KC3B 3T77B 2DQTL 3QNYA 2OBGA 4KJWC 3HI1B 5FM8A 4J12A 1F6AA 2WUBH 2EEDA 4Y4FD 4QRRA 3MOAH 5CILL 5TE4H 4OGAC 4L9LA 1KCKA 2WLYA 2HJFA 1N6QL 1FZJA 1HZHH 1K2DB 2UYLB 1JNLL 4JM2D 2L7UA 1LDPH 1SM3L 3AS3A 1UM6H 3S88L 5FO7B 2Q20A 3VXQB 1LO5B 1KPUA 4MNQE 1T2QH 3FQNB 1JFQL 5HHNB 3CVIL 1AR2A 1GHFL 3WS6A 1IC5H 4HS6A 2VR9A 1TMCB 5TFSH 3ZKQD 2FL5B 3KS0J 5T1LA 5CHNA 3GUTA 1WFTA 1BFSA 4LBEA 5HY9B 4NKQB 2Q8AL 4KI1A 1KPVA 3U36A 3BD4A 1E4XH 3VG9C 3C9NA 1CYGA 4QOKB 4XAWH 2DMCA 1GC1C 2XQBL 4OTXH 3IT8D 4GW5A 3DV6B 4PJ8D 5CIPB 5F1IB 5H37G 5E9DA 4ZDHB 2X4QB 3IXTA 4KRNA 4XP9H 2DQJL 5GRYA 1CT8A 5GGQH 1IEAA 3CPLB 3HAEA 4LGPB 4XHQA 4H1LA 4RFOL 1HKLL 3NCJL 1UB5B 3KLSA 4LSSH 3SDAD 5ACZB 5I1DB 4HZLB 3BP7B 5KBNC 1U8IA 1X5IA 3B9KA 4ODBD 4MXWL 4C4KO 1JHTB 1LEKB 3RZWA 3W81A 1Q0YH 3U4AA 4WI5A 4FQXA 5LAXB 3W9DB 2DRUA 5TGBA 4N5UA 3MV9B 3VGGA 3O6KH 3LQZB 2JB5H 5JORA 5FYLE 3EKCA 1MJJB 1CN4A 3GMQB 3VDBA 3GHBH 3H9SE 3RL2B 3HI5H 1I1AB 4EDXB 3BKML 4KKAC 2BDNH 2A0LC 5CEZH 4HFWA 3GMRB 1TNMA 4FQQA 1NEUA 1IKFH 2CO6B 4J3VA 1KJMB 2F54B 1MREH 4FQCH 5FO8A 3NFNB 4F15B 4L5FL 2EO1A 4RX4D 3AY4C 4Z7WE 4Y0GA 2DQDH 3DXAE 2QEJA 5GRJL 2F74B 3F7PC 4M8QB 3LKSA 5CKGA 4PJ9D 1U8HB 5LGJB 3VE0B 4LEXL 3QXDB 4D9RE 1JUFB 2W59A 4NZJA 2A73B 2FJGB 1J88A 3HE7B 1DQML 4TPRH 4JQVA 4TUOB 2PO6D 3U7AA 3UTZA 3V5KA 4HJGB 2DTMH 4Z8FH 2WSKA 4DKFH 4RFNC 4CDHA 4PJGA 3GBMH 3Q3GB 2JJTA 5D1ZA 5IGXH 2ID5A 4Y4HB 3UYPA 3FRUA 4J6RL 1K4DB 3CFBB 2DQFA 5GZNC 3O2DL 1FL3A 5I71B 2VLJE 5DLML 3A0OA 3EAKA 3IDNA 1P7QA 1F97A 4ZAKD 3THML 1NCWL 4A6YB 3VXNA 4UT7L 4CNIA 1TTGA 3IDYB 4P4KC 3ARGD 5B21A 3HAEH 5C71A 3QUYC 4H1LH 4LL9A 4UT6H 4Y1AE 5T33L 5GJSH 2AXJA 5EOCH 5JR1L 1KEGL 1A14L 4MAUH 2FCBA 3VA2C 1GZPB 2EDLA 3D39A 4WJ5B 5D2NC 5D6DA 1B0WA 2PCPB 1FG9C 5EOTA 3MLZL 4X5WA 2GQHA 5MERA 1RU9H 4MNQA 4LMQI 2XQYG 2QADB 3EDJA 1FORL 5IJKA 1MFNA 1R5IB 4FMKA 5ECJE 1T7XA 3Q6GL 4E42A 1RUML 1BF2A 1CFNB 2C3VB 3RJQB 4XCYB 1J8KA 2QLVB 3RWIB 2R4SH 4JFQB 2R1XA 3DVIA 1FZKB 5JDSA 3F12A 3PHOB 5DEGA 1RJCA 1JGUH 4NBZB 3ZHDA 3T65A 4B53A 1QA9A 4F7CA 1H3UA 1K4CB 4ETQB 3BP5B 4Q6YA 1LEGA 3LKQB 2QKIA 4KVNH 1A5FH 3WNLA 5EFIB 5D1QD 3M1BA 3KJ6H 3IJHB 5DDHB 3I50L 3MA7A 3NFPA 4X7CC 3B4NA 4K71C 1YMHB 3D0VB 4U6YA 4U4BA 5HVHB 1NGWB 4NUGH 4QYOA 4LFHD 4AQOA 5ICZA 3TVMC 1N59B 5B4MD 2XTJC 2ORBH 3P40A 3O9WB 4M5YL 3SDDA 2ZKHL 1E0OB 3OZ9L 4JDVB 3HZYA 4L4VE 2XICA 4C83A 3C6LD 4KK5C 2YWZA 1OGAA 3KYMA 2GUOB 3PWJB 3QG6B 4MAYD 1OGTB 4ZPVA 2A6IA 2JB6B 2BVQB 2IADB 3EFDL 4WEBH 3RDTC 2IG2L 1JZ8A 1OAUL 1NGZB 3OAUH 1UACH 2BSTA 4M6OL 4PJDE 1EXUA 4MJ5A 4PRNB 1U3ZA 1FE8L 4GRLB 4NO0A 3DJ9A 1WFUA 2DJSA 4C59B 2UY6A 1KEML 4IJ3B 1DUZA 1ZT4A 3Q6FB 3QPXH 4PJFE 3L5WB 5JNYA 4QRPA 1CXEA 1T0NA 5EZLA 4CL7A 2ARJA 5HDQL 3TO4A 4PJGF 4CN6A 3CFDB 5FM4A 1ZGLP 4LCWA 3QIWD 4WO4A 1KB5B 2KQMA 5IQ9B 1I8MB 4LHUB 1OOAA 3VXSE 3MJ6A 5IB3B 1Z2KA 5KOMC 4KKBD 3T2OA 1A4KB 2X4PA 3NAAH 2Q7YB 2WM0A 3N1MC 4HKBB 1OAXH 3WFHA 2RCSH 3E2HC 3CXDL 3INUL 3TLRA 3IKKA 4LIQE 5SWZE 3QDJB 2DQIL 2XN9E 1OB1A 4S1SL 1JTOA 3HB3C 4K94H 2FIKA 4L8SC 1CK0L 4WW1A 1RUAL 4FQPA 1IQDB 4L8CA 1UM5H 2X4UA 3WSQL 3RVTC 2WNGA 5C6TH 3R1GL 5MI0B 1OF2A 2VLJA 4M93C 2WUCL 3IFOB 1ZLVK 1KJ2L 3IDUA 4KRPB 4NZTH 3AREB 5IBUG 3WS3B 1SBSL 5E6IA 3MRBA 1HQRA 2A1WL 4KQ4L 5CP3A 5D9SA 3PWNB 2RHEA 2HT3D 4BSWB 5C0FA 4JY6B 5F6IB 5DD1H 2AXFB 5HYJD 4PV8A 2JK5B 5E5MA 1RURH 3IAPA 3A6CH 3D2UA 3PGDB 4LARH 3VFVA 3BD5A 4RDQF 5M7QA 3RIAF 3CSYA 2WBJB 3ZTJG 2XZAL 1BAFL 1U3HA 5F9JB 1GGIL 1DUYA 4UV7L 4XRCA 4WFGE 2YKLL 5HYQA 1LNUA 3U7WH 4YFLI 5I6XC 1QBAA 1MSPA 4G6JH 1NFDA 1A1OA 3G6JA 4WCYL 5L7XL 5DMKA 5HHMB 1JGDB 5J89A 1FVCA 1RIUH 2RFXB 1WC7A 3S96B 2AJSH 2YUWA 3O81A 5DJXA 4JFDE 1MHCA 4ZXBD 1FO0B 4GH7B 4DCQB 1KXTB 3UPAA 3GHEL 3MRLB 2ZCLL 4LSVL 3PHQB 4NC1C 2VLRB 2W9EL 5CGTA 2ZSVB 3U9UA 1IM9B 5GGSA 4JY4B 5EG6C 1FLRH 4RZCA 5DJ2A 3DUUA 4G42B 2HLFC 1VB9A 1FVEB 4JAMB 5AWNL 5F7MC 2X4RB 4KHXH 5DMYA 1JYNA 1A7NL 1OPGH 1P6FA 4KXZH 2VDKH 2CDFB 3FAXA 1DQTA 3FO9A 43CAB 5MP6L 4MD5B 3RPIA 1QFWM 1TZIA 1M7DB 5DR5L 1LO2H 5I1HH 3MBEA 3LPWA 4M48L 4NN6B 4OIBA 1S9YA 5CJQL 3TA3A 2ARJQ 5LG1A 5I19L 3VFRA 4M1CD 1DFBH 3MCKB 4GRWH 2I24N 5CP3H 4RMSA 2DWDA 1Q0XL 4J3UA 2CDGB 4R2GB 1KLUA 1PKQA 1PG7H 4R97B 3IS1X 2C9AA 3JTTA 1OARH 2V9QA 4QNPE 3QWOA 3SGJA 5F6HJ 1NC2A 4OZ4A 1FHGA 1TFHA 4MA1B 4RCAA 4H25B 3BUYA 5KSUA 1E4KC 3EJYC 1RJYB 5D6CA 2NXZB 4DOHB 5H35A 4R6UA 5C0BA 1N64L 2B0SL 1ZT7B 5BRZD 4F33A 15C8L 1MPAH 4O2FB 2HKHL 1DCLA 4GRWF 5IROA 4LPTA 3ARFD 5SWZA 3ULUE 5J6HB 4Z0XA 1INEL 4QOKE 1MHPL 3SBWA 3WJLA 3QYCA 3S5LB 1EA9C 1QSED 2J5LC 2NY3B 2GSIB 1RZ8A 3MGTB 5I66B 4IOFD 4QGYA 2VDOL 4L9LC 4NPYB 2VKWA 1MRFH 3VFPA 2CKBA <