3THML

Crystal structure of fas receptor extracellular domain in complex with fab ep6b_b01
Total Genus 45
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
45
sequence length
214
structure length
214
Chain Sequence
QSVLTQPPSVSEAPRQTVTISCSGNSSNIGRYPVNWYQQLPGKAPKLLIYSDNLRFSGVPDRFSGSKSGTTASLAIRDLLSEDEADYYCSTWDDTLEGWVFGGGTKVTVLGQPKAAPSVTLFPPSSEELQANKATLVCLISDFYPGAVTVAWKADSSPVKAGVETTTPSKQSNNKYAASSYLSLTPEQWKSHRSYSCQVTHEGSTVEKTVAPTE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Fab EP6b_B01, light chain
publication title A series of Fas receptor agonist antibodies that demonstrate an inverse correlation between affinity and potency.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system
total genus 45
structure length 214
sequence length 214
ec nomenclature
pdb deposition date 2011-08-19
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3thmL02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3thmL01
4XB7A 4QRTA 2NY2C 5DMYA 1MI5D 2NY2D 3SKMA 4X6CF 5LCVL 4HXBH 2R29L 2WK2A 4B41A 1WVZA 1FIGL 2X09A 4LSQH 2BVOA 1A3LL 2WBJB 4LLMB 3V6BR 2KPNA 4OM0H 5KJRH 3VXOB 4Z7UE 4L4TB 3HPLB 2Q8AH 5JOFB 1QEWA 1OVZA 2QSCL 5I18L 3OV6A 1J86A 5IB5A 2CK2A 5DK2A 1AO7A 5EBMA 1JWMA 3BP6B 1A9BB 5FOBA 1NFDA 1EIBA 4N1HB 3RUGF 5HHME 1A7PH 3HRPA 4S1RL 5DT1H 3GJFH 4TNVK 4WI5A 2X70B 3H6JA 1MCRA 2WINA 5SX5K 5SWSD 3LEVH 4L3CA 4BQBA 2QQKL 1ROWA 3MUGA 1KNOA 2F54E 1AFVL 1NC4D 2AK4B 1RZFH 3MLYL 4JPWH 3RZCB 1J8HA 1C5CL 4WNQB 4YEFA 2BNQA 1YYMH 3K2MC 5A2IH 2G60L 3QCVH 1KCVL 4HKZB 4XPHL 3IDIA 3V0WH 3FFCE 3HUJE 4PV9B 3S98A 4N0YL 1BZ9A 1HIMH 1CXEA 3OWEA 4P23A 4D0BA 5BQ7A 1GYAA 2DMBA 4DGYL 5HHNA 2R4RH 3MLXH 1SBBA 2I07B 3ROOB 4MA7H 1EEUA 4YXKH 5CCKH 4ISVA 4D9QE 3DYOA 1IC7L 2VLRE 4XT1C 5E2WL 1FO0A 1KCUL 2BFVH 3GMOB 1JHLL 2R0ZH 3U79A 2R2HB 1CF8L 2IF7A 4X0KB 4X6EB 3RL1B 1IARB 4RFNC 3ZKMC 4ELKB 1FZJA 3D6GA 1K5NA 3QCUH 1S5HB 2LQRA 3P0GB 4WI4A 2X89A 4OFIA 2EE9A 4ZOEA 2EH8L 1MEXL 1OQOA 4P2QB 4N8CL 1NCBH 1H9VA 3QUZB 3E3QC 2FJGB 3ILPA 1T2XA 2XWJA 1RZIA 4GBXD 3DUSB 1CGWA 3HZYA 4JVPA 2RFXA 4UTAL 2KL6A 3KYKL 3X13A 1TCRB 4NWUH 4OLYH 5HVWA 4U6VL 1HH6A 2XI9A 3UBXB 1FN4B 4YWGH 1X6NA 3LEXA 4HHAA 1JF1B 1UVQB 1LEGA 4U1MB 3GM0A 2CDEB 2QL1A 3GMPA 1G7IA 3AS0A 5ALBH 4L9LB 3CC5B 4P23C 4R7NA 3V6ZA 4P23D 1JGDA 4JRYE 4LPTA 1Y18A 5I8CB 1U8LB 3KPSE 4I18A 1ZS8B 1G9NL 1LP9B 2KZWA 2WZPD 2RHEA 1U8OA 4JR9L 3EOBA 1S7XB 1A21A 1T80A 3LKQA 3D69B 1I8KA 4FQQB 4AT6A 1DLFL 5JO5B 1M71A 3DARA 4U7KA 5KAQG 3OKLA 1N26A 1RZ8B 1IM3A 2K9UA 5EU6B 5HI4D 3SCMB 4N9GB 4Q9RL 3EJJX 5F88B 3QO0A 3MLWL 2NNAB 3RPIB 3R1GH 2H8PB 5IB1B 1B6DA 4JG0H 1HSBB 3F6IA 4Z8FH 3F65A 4S1QL 4HUUB 1GGTA 1M7DB 5DUPL 1HYSC 4NUGH 5K9KA 1YJDH 3BXNB 1JIBA 1W0WB 4RX4D 4XNZB 1FZMB 2AJYH 4K94L 3BPCB 4G9DB 2XZZA 3V6OE 3BDYH 1LD9A 4WUKH 5MHSE 2XWBA 4HIIA 5DHYB 4ODUB 5C0BD 3VRJB 1QOKA 4I18C 2EE6A 4PJCB 3P0VL 4PGCB 3I9GH 1QBML 3IVKB 1DP0A 2LU4A 1CDIA 1H3UA 1R3IL 4PB9L 4Z77B 5LXGH 4XAWH 3UEZA 4NKMA 4EEEA 5H35A 2P5EA 1AE6H 3EKCA 3VCLA 2OS7A 3MOAL 1MFDH 4E0RA 5DJ6B 3FT2B 2Q76A 4NSKA 5B3JF 4E42B 1I3GL 5HHPB 1OSZA 3O4OB 3UTTA 1ZT7B 1YN6A 5I2IB 1U6AL 4PBXA 3OAZK 1UCBL 3ES6B 5C92A 1MCWW 3GMLA 5LKNA 2EIDA 5HDLA 4JO3H 4ZO6A 2LABA 1OAXL 2X4NB 5GGVH 2CR3A 3WXVH 5J06A 3IDNA 2GK0A 3OKMB 4PJEB 2ZG3A 4G8GB 2DWDB 5AAMA 3WYRA 3OJMB 3B9KB 2AJSH 3SGEI 3RY4A 2Z8WC 3WIFB 4DOHB 4JO2H 2Y6SD 3CCHA 4RGNB 2C7UB 1U58B 3SPVA 1ZAGA 3QB7C 5AYUL 4N0FA 1XGYL 1XCTB 3FQTA 4YHNA 1A6UL 3I02A 3RL2A 1EZVY 3LN5B 5JTWA 2ATPB 4Y16A 2EDYA 3Q1SL 3U46B 4TUOA 1U3HA 3IF1B 1DBKH 3MJGX 3QCTL 1I8MA 1IGFH 5CJXA 5DRNA 2GTWA 2HH0H 3SKNB 5EUOF 3MRQA 4NO2B 4L29A 1P9MA 2XZAH 4WFGE 4UNVA 2DM3A 7FABL 5L0QC 4A6YH 1RHHA 3PQYA 1DBBH 2P5ED 2K7QA 2Y1VA 4JN1H 4OFVA 5CJ5A 1N64L 3BE1L 5D1QC 3TFKC 5D1QD 4YO0A 4LSPL 2ZCLH 4PJDB 1QLRB 4G8FB 3PHQB 5EOQH 4OI8A 4LPWA 3IFLH 4UUJA 5JLZA 5FF6B 2B2XH 3BN3B 5E8DL 3S36L 2LVEA 1Y6NR 4R2GB 4ZYKB 2FHFA 1L7IH 2AXGA 3NGBB 4M7LL 5IJKA 5F97E 2Y72A 3RWGB 3EYVA 1L4IA 1XGUB 3PHOA 3S34L 1YDPA 1DSFL 4AEIL 3C09C 5IROA 2E6QA 1UB5A 3NFSL 2XTLA 3BIKB 4QRSB 1SYVA 5SV3A 3QZWG 5E08L 1HEZB 4H8WH 4K3DL 2VDKH 2YBRB 4ZNEE 5CJXC 4OAWA 3D85A 5DDHB 5SWQB 1FH5L 1QFWH 1MAMH 4HGWA 2IH1A 1Q9WB 4HV8A 2YN5A 3P4NA 3ZTNL 2A83A 1P9MC 1T20A 4BQ6A 1A0QL 2HFGL 3BPOB 5F1IB 5HVHB 1DBJH 4DFIA 1H8OA 5HPMB 3T0BA 1IEAB 5T3XL 2JIXA 3M1BA 5TDPB 2FX8L 4YNYB 3TO4D 1M6OB 3MA9H 2I26N 1QLEL 3PWNA 5BOZG 1P4IH 4EDXB 5IM7A 1S78C 4Z78A 5KVEH 1S78D 2D31B 1T6VN 1WC7A 4P3WA 3T0XA 3EYQC 3TH2T 3EYQD 5IJKC 2J2ZA 4JRXB 3ZKXC 5D72H 3V7AG 4X6DE 4Z5RB 5IROC 4MB4A 2FX7L 5DYOA 2ZSWA 2AP2A 1GOGA 2OJZL 1N5YH 3AU1B 4FQIH 3F6LA 4ONHB 4JFYA 1OPGL 1F00I 1UC6A 1O5DT 2C3WA 4R4FL 4ZTOL 1UH4A 1T1YB 2H9GB 4LLYA 1RFDH 2AEPH 4NC2B 1X5IA 1LILA 4PV8B 4YC2B 4TN9A 3O4LA 1GZPB 3HI1A 1P4BH 4GOSA 5DJYA 4QHKJ 3G5YB 5C8JA 2HJLA 2CO6B 5I71B 2OQJB 1NMCB 2H1PL 5E7BA 2VKWA 3KS0J 3TJEH 4I77H 5EIVA 4AM0A 1TCMA 5CJQL 4MWFB 2FEEI 1X7QB 5F44A 5FIEA 3ZO0A 3IAQA 4IRSC 4PR5B 3V8CA 2VAAB 4IRSD 4PJXE 3ARUA 3FQWB 2FL5B 32C2A 4URTB 4Y2DA 5CP3H 1WZLA 3WN5A 1DBML 1ES0A 1EEYB 5DR5H 3DVGA 2GITB 2CD0A 4WW2B 5CS7A 2BNRD 3N50A 2Z31D 4OLWL 1NLDL 4OFPA 4OF8A 4O5LL 5ESQB 2Z93B 1X4YA 5D6DA 2J12B 1IQWH 2AJZA 1VACB 3QULA 3QQ9C 4PJ9A 5DJAA 1V3MA 2MPAH 3PGDB 2VXTH 1IAII 2QEJA 3O0RL 5D7LB 4BFGA 3I50L 3H9SE 1P84K 1A2YA 2APVA 3W9DA 4WO4D 5I1KH 4TQEH 2AEIT 1RZJC 2XN9E 2X4QB 1HHKA 1YQ2A 2XIDA 3OB8A 2DQCH 4LSTL 4RA0C 1N6QH 3HC4L 3HR5A 3JUZA 5F1NB 1LK3L 4U3HA 1NGYA 4RGOL 1FYHB 2VC2L 1R3KA 3PWLB 3NCYS 1TXKA 1VEOA 1G1CA 1JJUA 2E7MA 2C3VB 4WFHE 4Y2DC 3T65A 1K4CA 2IAMA 4Y2DD 3WN5C 1CG9A 3VXUE 1I9RH 3ZL4H 3WHXA 3AUVA 1EMTH 2P5WB 3DX9B 4PJHE 3PXHA 4Q0XL 2AAVA 4JPIB 1L9MA 3IS1X 4Z7OE 5FGBC 5JIIA 4GAGH 1BREA 1T7WA 1W0VB 3I3EA 5C08E 2ZCHL 5D6DC 3NPSB 3V4UL 2A6JA 4LPVA 4YE4H 2Z4QA 3HNVH 1NANH 3F7PC 3BH8B 4JFOA 4FFZL 3VFNB 1JHKH 1IGYB 3L7EA 3OBAA 2Y36L 1RUAL 2ZZUT 1E4XI 4EUPH 1BFOB 5T3XE 1BIIB 1QHPA 1CD0A 3C60A 4Y89A 5IW1B 4U0RC 4Q97A 3LQAL 2A74B 1MF2L 1JGEA 2Y06L 1FFOB 1C16B 3H9ZA 1LHZA 3QIBB 4EI6A 4ZTPH 4YHOL 3W5NA 3FKUS 4YFDB 5FHAH 4JFHD 4WHDA 3NH7L 5IB4B 1DANT 3QPQC 2BDNH 4ZNCD 4NP4L 3MXVL 3QPQD 2IAMC 4KGLA 2HFEA 2IAMD 3CFDA 2ADIB 3IDJB 1HHJB 5JPNA 1MCPH 1QD0A 2QTEA 5J1SC 1QSFE 3FO2A 2DLHA 1KLFA 3VFRA 2YD4A 1HKFA 5GGTL 4PREA 1WCBA 2OI9B 3EYUL 5F3HB 2X7LB 2IPUK 3EDKA 4P99A 3O2DA 5MP6L 1S7UA 1QPPA 1JNNL 4Q74A 5E70A 2DWEB 3EFFA 3IFOB 3TZVA 3N1QC 3OKEB 3LMJL 3QUXB 2LTQC 3BQUC 3BQUD 4YQXL 1CU4H 1DJSA 1U2HA 1CTOA 4Z0XB 4XPAH 4UQ3A 2W59A 4XCEA 3C60C 4L8CA 1W72B 3C60D 1CXFA 2EDTA 4HIHA 4JM4H 3TF7C 1KELL 2JCCA 1HDMA 3S35L 2ED8A 1XF4A 1NCWL 2BVTA 2AKRA 1UWXH 5CLWA 4NKIL 4P9HH 1KACB 1VPOL 3E1F1 4OFYA 3TESA 5FXCH 3MMEA 5CUSH 3MCKB 4R7DB 3REWA 1CQKA 1KSRA 3DV4B 3RWIA 2BCKB 4M62H 4M4RA 3D2UB 1F4XH 5DUML 2YZ8A 4I3GA 3T0EC 3T0ED 1ADQH 2WBJA 3H9HA 4D2NA 1NMBH 5D7JC 3ARDD 3VXOA 3OR6B 5D7JD 4L4TA 3HPLA 1PJ9A 2VDMH 1OT1A 4GRLB 3I2CL 4U1NB 3TZVC 3GMMB 1FNEB 3TZVD 2A1WL 5IIEB 3IGAA 1F6LL 1NCDH 3BP6A 1A9BA 4GSDH 3WLWC 4XMKL 3ARFB 4AL8L 3LDBC 2P7TB 4NQUA 3GMQB 3D39B 4PJGF 1BIHA 3VXME 4XP1H 3WLBA 1CBVL 4P4KA 2FWOA 1C08B 4OF7A 5EUKA 4U6TA 4R4NC 1FNSH 2Z8RA 4WNQA 1RZ7H 3FZUD 3VWKB 4XAKD 35C8H 4LP4A 5E9DD 4HKZA 2FJFB 4GRWB 3T2OA 4GW5B 5J11C 1J12A 1INQB 4CL7A 1P7HL 4ERSH 5IB3B 3MCLL 5HGAB 4ZXBB 1PEWA 3ZKSD 5E6IA 1OLZA 4ONFL 1FAIL 2BK8A 3DURB 2I07A 3ROOA 5BRZD 2R0KL 2DI9A 2WBJC 1V5JA 3WKNA 4Z9KB 4ACPA 5ETUB 5DI8B 1AJ7H 1EXUA 2IEPA 2R2HA 3RHWF 4FABH 4FQ1L 4I1NB 2XG5A 1PKOA 1F58L 4AEEA 1I9JH 4PJ7E 3VG0H 3MRIB 4RAUA 3G6DL 4OD1L 4L3EB 5DLML 5EOCJ 5KANI 1MQKH 1S5HA 4Y19B 3RNQB 4RMRA 1J10A 3KJ6H 2R4SL 4AEHH 1RU9L 1TJHL 4LBEA 1IL1B 4U6YA 4KH2A 4K9EL 2RAMA 2FATL 3GSOB 5FCSH 1F4HA 2NR6C 3C6LB 3OGCA 4P2QA 2FSEB 1XAUA 4FZEH 3QUZA 1R5IB 4P4KC 5FB8B 2FJGA 4OQ1A 1OY3B 2VDOH 3DUSA 1D6EB 2L7JA 3T3ME 2OK0L 2AW2A 3O41A 5DJ0B 4XC3H 2NYYC 3DXAD 3QDJA 1JPTH 2NYYD 1UXWB 1CZ8L 5CAYB 4LARL 4HEPG 1OD7A 3I3BA 3HFMH 3LH2H 3VMNA 1JF1A 1UVQA 3MRGB 2ZSVB 4WUUD 3QIWA 3IKCA 4L9LA 3CC5A 3BP7A 3RVVC 1NEZG 5KN5B 3RVVD 3N06B 2RGSA 5E6IC 1NLBH 3GSVA 4P48A 5D2LE 5AWNH 5I73B 1CLOL 1ZS8A 3LN4B 1LP9A 3U9PL 5H37H 1S7XA 4PGDB 3ARQA 5CP3A 3SQOL 4RFOL 1I85C 4HMCA 5JO5A 5HDBF 3QIUA 4X98B 3CZJA 4KGJA 2E7CA 2A6KA 3PWVB 4IOFC 4YHMH 4IOFD 4U33A 4I9WE 1RZ8A 2VLME 4UQ2B 2NLJB 1Q94A 4K7FB 4N9GA 5F88A 1E28A 5E8OB 4FFVD 4G8IA 4WDIA 4OI7A 4OIIL 2NNAA 3RPIA 3U7AA 2H8PA 5IB1A 1HSBA 1CIDA 4F15B 1HQRB 1IFHH 4IMKA 4PPTA 4QRPD 4ZFGL 2X41A 4N68A 4PRHB 2DDQH 3RY5A 3VE0B 5GS2D 5CZVH 4I0CC 3T0AA 3PWUB 3BXNA 5D8JL 4UT9H 3QDJD 1U3JA 4XBEL 1QNZH 2AVGA 3KDMB 3KVQA 1HZHH 3JWOH 1MJ8L 3C8DA 1BBDH 2VUOA 1UWEL 3QIWC 1NQBA 2R2CA 5JDSA 3QIWD 4L9LC 1A6TA 3FOMB 4ODWB 4JKLA 3MO1B 5ID0B 1HH9B 1NGPL 3QNXA 1FSKB 1E4KA 1KPUA 4HCRA 1GGBH 3MLRH 3F7VB 4PJCA 5FM5M 2X4PB 5DXWA 1U41A 1KCSL 1R5VB 6CGTA 2R1XB 3EIFA 5TE6H 5KSBF 1R5WB 5K9JL 1JGVL 3QIUC 3RTQA 1RULL 25C8H 3NOIA 5ESVB 1EGJH 1PZ5B 1F90H 5CIPB 3FT2A 2BSED 2F8OA 4PRDA 1EO8L 5HHPA 1JZ5A 5EU7E 2IPTH 4UBDC 1U8PA 3ES6A 4UOW0 3CFBB 3CMOH 4IMKC 4K3HA 1J1PH 2ESVD 2E9BA 4PJEA 4G8GA 1PG7H 5SX5H 2DWDA 4AQ1B 3TM6A 4NM8H 3P77B 1YY9C 4XNZC 3KWWB 5C6TL 3LQZA 3EGSB 1MRCL 1TTGA 1U58A 2C7UA 1IAOB 1FIEA 1PYWA 2FLBT 4NFBA 2X1WL 1U8HB 4IRJC 1WAAF 2A6DB 4IRJD 5KG9A 3E2HC 3U46A 2YPKB 1OSPL 1D6VH 1E4KC 3IF1A 4G7YL 1JZ2A 1W72H 3T2QA 4I0KA 4HK0B 3TA3B 1ZV5A 4YIQB 3SKNA 5DJCB 2PN5A 1A7QL 4OQTH 1NGXB 1AXTL 1HNGA 4ETQA 4ONGL 1TDQA 3PNWB 4NWTL 1PSKL 3RTQC 5ANME 4J7RA 5GGUA 1JPFB 1ZLWK 1AGEB 1BM3L 3NIFF 3Q5TA 4PJDA 3WDIA 1EVTC 1DQQB 4XBPB 1BHGA 4JFEA 2ITCA 4WWID 5IK3B 1GPOL 5K93A 3L3DA 4F58H 4ZYKA 4BZ2H 3H3BC 1P5UA 3T4AA 4KZDL 3RWGA 2IBBA 3OG6B 1I7ZA 2CMRH 4LVNC 2HFTA 4QHNB 2PCPB 4Q9BA 3FN0H 1U8KB 2QR0A 3ZDXE 4QRSA 1SEBA 4POZD 1JYVA 3QDGB 5D2NB 1Z2KA 15C8L 3NA9L 4XCCL 3ULUF 3HTLX 3GSWB 5E4EC 5AG8A 5BMFH 3MACL 2EECA 4OCMC 3G6JE 3GSQB 1A1NA 2BVPA 2PO6B 2XZCL 4A2LA 3O2WL 2ZKHL 5TPWH 4DKAA 3ARGD 4JFDE 3S37L 1IEAA 1JGUH 4GRWH 4BZ1H 1YEKH 1X9QA 4CVWA 4KZEL 4JJHA 5BS0B 2AV7A 3O6KH 4YNYA 2C4XA 3WDHA 3FHAA 3KLDA 3VGGA 5ILTH 1ZLSL 2D31A 4XPBH 2UV3A 5HYEA 5D6CA 2AJ3A 1V3LA 1KXTB 4HUKB 4KUCD 4LSSL 4HFUH 2XQYG 4WV1A 5EZJB 1F97A 1PQZB 3P0YH 2FR4B 4G9FE 2D9QB 4OLUH 4Z5RA 1KN2L 4YXLL 3BPNC 2DJ4A 1OB1B 5SWZB 3GSNB 5HI5D 1T0MB 5C2UB 3O6FB 3AU1A 2VLLA 4I0PA 1JK8A 2M8XA 5GHWL 1JZ7A 4OIBA 4RSVA 3MFFB 4CU7A 4QTIL 3RIFF 3QH3A 3T2NH 2H9GA 5TH2A 4NT6B 2XY1A 4PV8A 2DQEL 4QCIB 3QDMB 5EZOL 3B3IB 1FO0L 5JHDE 1GZPA 5F3BA 4JQIL 4CVZA 5FDYA 3WNNA 1JZ6A 4JHWH 2UY7A 3WUWG 2IFGA 1BVZA 3RVXD 2X9WA 3G5YA 5HVHC 4PJFF 4WFFE 2D0FA 5IFHL 3NCJH 2GFBA 4NC1E 1AI1L 3HC0A 2KZ1B 4XVJH 3G5ZB 2AGJH 3KPMB 1U42A 1J1XH 3SE9L 4JJ5A 5KTEL 4FFYL 5FA4B 5IV2B 1DCLA 2J7LA 1X7QA 1EEQA 5CGMA 1ZGLP 2LAAA 4PR5A 3MNVB 2VAAA 2P24A 5F7LB 3OAZH 3FQWA 5JXAL 3MODL 1I7RB 4WV1C 5IWLC 4HH9B 1EEYA 1B88A 2YR3A 2GITA 4WW2A 1BF8A 1PY9A 3VWJB 1PLGH 1D9KB 5FO9B 5KVFH 5E6ZA 4HFWA 5DZLA 4KJPD 4I0PC 1P7KA 3F7YB 4I0PD 2DOCA 2Z93A 4ZAKB 5ITFA 1ETZB 1H3PL 4YPGB 1CD9B 1RIUH 4DN4H 3V5KB 1IBGH 2LVCA 2C1OB 5IB2B 3PGDA 4YC2C 3HAEA 5IQ7H 3L5HA 1OAQH 1MNUL 4M93C 5D7LA 5C0JB 1YMME 3HE7A 2ICWB 4LHQB 1IRAY 2X4QA 5I71C 3LRSB 2A9NH 4XZUB 2OTWB 1LO0L 1KTDB 3JTSA 4S11A 1RMFH 5F1NA 1DL7L 1QVOA 2N56A 2VLRB 5SWSE 2FD6L 3UDWA 1Z9MA 4AQOA 3QAZC 1OGTB 1LE9A 1ZANH 3PWLA 4JZNA 4PJIB 4XP4L 2CK0H 1JPSH 3ZHDA 5DA4A 2YPLE 4P2RA 2FH8A 2C3VA 1Q0YH 1KG0B 4DKFH 5GRUL 4J12A 4DK3A 3NZHH 4WW2C 4YDLB 2P5WA 3KNBB 4ELMF 1JPST 4JPIA 2YWZA 1HSAB 3EDDA 2IALB 4ODVL 5F7YC 5E8NB 5ACLA 3A67H 4OFDA 1C7SA 1WF5A 4OZGA 1MCDA 4KRPD 2Y25A 1A3QA 2X4RA 3OKNA 3UBXG 1JF5A 3PIQB 3RP1A 2E8YA 4BSWB 3BH8A 3QG6B 4I3SH 3VFNA 3MJ8B 4HW6A 4UDUB 1CK0H 3FO1B 3OXSA 3HE7C 1AO7E 3HE7D 4U2YA 1NFDE 5TFSL 1EEZA 2XA8H 4N8VG 5GRXG 1OQXA 2ZUUA 4JRYB 4NRYB 4ZODA 4FP8L 1FPTL 2A74A 4P2YA 5JIPA 5BV7L 3E3QE 4PJAF 4FQ2L 2Z92B 3UDWC 2DYPA 3P4MB 1C16A 3QIBA 4GW4B 4NJ9L 5C0DB 3MXWH 4MQ7B 2VXQL 1DQMH 3H42L 5FKPB 3VXRB 2J5LB 3VH8B 2WV3A 1J8HE 2CLVB 5IB4A 4Q9QL 4QYOA 2BNQE 1BQHA 4P2RD 2BX5A 3X3GL 3T4YB 1BFSA 1K4DA 4WHTB 5GSRB 3U7YL 3TBTB 4OKDA 3IS0X 1HHJA 1FFPB 1K6QL 5IUSA 4MCZA 1T03H 1O7VA 4LCCB 5BW7A 4I2XB 5HTSA 2D0HA 1XGPB 4Q9CA 4JFQB 4M7KL 4EN3C 2AERT 4JHAH 4EN3D 5FYLL 4Y4KB 4FTVB 4KK5C 1FP5A 3TNMB 3V52H 4KK5D 3IFOA 2NY1C 5ECJE 3OKEA 1BJ1H 3CSGA 2O93L 2NY1D 1CS6A 4NDMB 3QUXA 1CVSC 4UILL 1E4WL 3OJDA 5B22A 3WE6B 4Z0XA 5ITBH 2VLKB 1TNNA 4OGXH 5JOPD 2NY6D 3LHPL 3MRRB 2I9TB 1MFCH 5CKGA 4JZOA 4AENB 1KLGA 1KJ3H 2L4OA 3A6OA 4OLVH 5BCAA 2YSSB 2CDFB 2D7TH 1TZGH 2DYPD 2R23A 2GCYB 5FO8B 2O5XL 5D7KE 3NZ8B 4G6AC 5DMKB 1YECL 1CFNA 3TN0A 3DRQB 2PW2B 3C8KA 4JPKL 4M3KB 3CX5J 4PRNA 5IVOA 5IF0B 2OI9C 1LE5B 5IBLC 1OP5K 4KQ4H 4OSUH 4EUPG 1DFBL 5F89B 5DD1L 3TPUA 4M7JL 5FM4A 3TBYB 1JVKA 3FB5B 4GRLA 1VGEL 1VERA 3B2UC 5HGBB 3GMMA 1FNEA 3GJEB 3S88H 5IIEA 4XCYB 1TFHA 4NCDA 4S1DC 1CFQB 2B1AL 4KMQA 2VERN 5SV4A 2P7TA 3D9AL 1FNFA 3GMQA 3D39A 5D1XB 3MLVL 1YNTB 1MFAL 1NAKL 2Q20A 5I1JL 2GYSA 1C08A 5E00A 1G6VK 4D3CL 2UUDK 3P9WB 5HYQB 4K55A 1QYGL 5I8EB 3M07A 4JG1H 5CJOH 1WT5C 4BM7A 3IDGA 3S3SA 3TN0C 4LCWD 4YAQA 3TN0D 3FMGL 4LCIH 5CD3B 5IB3A 5J6HA 5HGAA 3VFTB 4CDHA 3STZB 4WEBL 5HGGS 2QJDA 3MLUL 3O6MH 5JNYB 1ZA3B 1BMGA 2ARWA 3ZT5A 1GIGH 1H8SA 2UZYB 2JJVA 4C56A 1Y6MR 2AEWA 2WANA 4GUPA 4I5BA 4J6RH 4NKOA 4OM1H 4ONOA 4AYFA 4JLRB 3MRIA 3RZWA 1XMWA 1NUGA 3MV01 4Y19A 4L4JA 3RNQA 4HWZB 2P5EE 4LQFH 5CBAA 1IL1A 1U9KA 4JY4B 1RZJL 1VB9A 3LS5H 2OYPA 1DE4B 5EA0H 3K4ZA 4ZUSB 4DTGH 1IEHA 3S3JA 3KYNB 1R5IA 1H5BC 3UTTE 4RAHA 1YEDA 1JMXA 2XPGB 2ICWJ 3FCTA 2EO1A 1G7HB 3LKRB 1ZT1B 3P4OB 1BFTA 2QQNL 4UTBH 5DJ0A 5E8PB 4M6OH 1G7PA 2NZ9C 1UXWA 2WIMA 2MTPA 4XRCB 5INDB 1M7XA 1ZE3C 5DRZB 4AG4L 2OSLB 2W1NA 5FV2A 3O81A 2ZSVA 1D5XA 4HJJH 1T22A 3VW3H 4XPFH 5B21A 5D1ZD 5F21B 3LN4A 4R96A 1JP5A 3V0VA 4CW1B 3GI8H 5FYLE 4BK4A 4LLDB 1Q1JH 4W4NA 4WI8A 1H15B 1UA6L 2WUBL 1PKQB 3O3DA 1D5IL 4WI7A 2F15A 4C56D 2FJHA 2V5SA 4QO1A 1VGKA 1WITA 4X98A 1YN7B 4GS7C 1WFOA 3HA0A 4X6DB 2BERA 3FHQA 1IGJA 2IGFH 2J8UF 2NXYB 5L88L 3NMEA 3PQYE 4UQ2A 2NLJA 3BIAX 5DVLA 4L5FL 1GRWA 1N0LA 3SGEH 4HUMB 4KJQC 5AZEL 2DJSA 4KJQD 2R69H 3VRLF 5C7XL 1QA9B 4GRMB 1WZ1H 4JFZH 3B9EA 3UJIL 2YD3A 3WXWL 4PRHA 3W39B 3WDJA 2BVQB 1A6PA 3EOAB 3VE0A 4JVWA 1WICA 3H7BB 3PWUA 1G0YR 1QFUH 4U1GB 4YDVA 2VQ1B 3OPZL 4KXZH 1QR4A 3U0TB 3MJ6A 3QA3B 5CWSA 3FOMA 4ODWA 5ID0A 3MO1A 3OAUH 1BEYL 4DZBB 1Z5LB 3C5ZB 4ZUWB 1S7SA 5MERA 4YZFF 1CL7H 4ZDHB 4LEOB 1S7WA 1K2DB 5GQBA 2D3VA 2X4PA 1R5VA 3DPBA 5FYJU 3GI9H 3K4AA 2R1XA 1UKTA 1HINL 4NQSA 2NTSP 5F7EL 2C26A 1NDGB 2DQUH 5ISZA 1F4WL 1C8PA 5CIPA 3R8BB 5EIIB 2FH6A 4RIRB 3BDBA 2I5YH 3MRDB 4HC1A 4ZG1A 3W11C 3V6FA 3W11D 4IHOB 2FGWH 1ZVSA 2JB6B 5CLTA 5MEQB 4ZOCA 4M6ML 5DUBB 3UMTA 1GAFL 1F4YL 2DQFB 4WCYH 5E24E 1OD9A 5F6HI 5DVKA 1HILA 3P77A 3ARRA 3FT3B 1LDPH 1JPGB 2KBGA 4LDEB 5C2BH 4DVBB 5EC2B 4XPGH 3NABH 5H37G 3QFJD 4OCXL 1X44A 3Q6GL 2IPKB 5IG7B 3L3HB 4JM2B 5LCVH 3S5LB 3UZQA 4C58B 4HK0A 5FKAB 2R29H 3W5MA 4OUUB 4YIQA 1DTUA 5DJCA 1FIGH 3BKJL 1A3LH 1MLBB 1HKLL 1FVCA 3O2DL 5EB9A 1NGXA 4LHUA 4FQHB 4G3YL 4KMLB 5FYJD 1SJXA 3T77A 3O4LE 4D0CB 4TOYL 2QSCH 5T1LA 5I18H 4IMLB 3HUJF 1SYSB 5ISZD 1AGEA 4PJHB 3P30L 2Y5TB 2OL3L 5HY9B 3MUZ1 4C83B 4S1RH 1BVLA 1R6VA 2BP3A 4KJYA 1NKOA 5DRWB 5IK3A 2GAZB 4XVSL 1B0GA 3BZFA 4CJ0A 4NCC2 2QQKH 1AFVH 3MLYH 3VGFA 1C5CH 2OP4L 3TPKA 5IEHB 3B8SA 1NAMA 1JTPA 2BNUB 2G60H 4QHNA 1KCVH 2M26A 1U91B 4GG6F 2X1OA 4XPHH 3V79C 1U8KA 4L4VD 1I9EA 3GGWB 3OQ3B 1YA5A 2RIKA 4N0YH 1JNLL 4GKZB 1ZK9A 2YEZA 5D2NA 4AH2A 4DEPC 1KPVB 4DGYH 4POUB 1U0QA 1FL3B 1S9VB 3DX8A 5TQ2L 1T2QL 4WWKB 1IC7H 5E2WH 1A1MB 1KCUH 4P2OB 4LHUD 1JHLH 3GSQA 4N90D 3L3IB 1IM9A 4JFPB 1RK1B 2ZOKA 1CF8H 2YMXL 3QHZL 5T1LD 2VDPL 4MNHB 4HJGA 3NN8B 1KULA 1QSFB 1HE7A 2GSGB 5C6WH 2GJZA 5GJSL 3RVUC 4OLXL 2HKFL 2EH8H 3EO0B 1MEXH 1U3ZA 5GRWA 4N8CH 4E9LA 1TPXC 1XR8A 4XNXL 4KI5F 3RDTD 1JRHI 2H26B 4JFHE 4UTAH 2GJ6B 4H88L 3KYKH 4U05A 1PQZA 4U6VH 1U8QA 4Z7NE 3D1MC 3NCFB 2FHCA 5SWZA 4FN0A 3GSNA 4Y4FC 1T7YA 4ZO9A 3IDMB 4Y4FD 1JF6A 4MXWL 3V7MA 3MOQA 1CGSL 4MA3B 2VITA 3MFFA 4ODBD 2Q1EA 1G9NH 3EZJB 1XF2B 1Z0NA 3IXTB 3B3IA 4JR9H 4M8QB 4YDIL 3K1DA 1YEHL 2X1QA 4NNYB 3LSOB 4OCWL 2XKNA 1IM9D 5IOPB 5D96B 3K3QA 5IQ9B 1T3FB 4KKLC 4NRZA 3WO4B 2J4WL 2IQAB 3Q48A 4NOFA 5J1AA 3K46A 3G5ZA 3KPMA 2EKSB 2NY4C 4Q9RH 2NY4D 4HKXA 4LGSB 3QNYA 4KKNA 3V5DB 3MLWH 2VIRB 5FA4A 5MEOA 3AS3A 2NXZB 1H3GA 3OKOB 4Q6IB 3PP4L 3TBVB 3MNVA 4S1QH 1XF1A 2G75A 5DUPH 1I7RA 4NKQB 5DSCB 1FDLL 1ZMYA 4HH9A 4N5UA 4HJ0C 3VWJA 2FZ3B 2GEEA 2O5YL 4HJ0D 5DC0A 4K94H 4F7MA 3VFUA 2ILLA 4MNQD 3F7YA 3VXMB 4MX7B 3IRZA 4P5MB 1E6JL 1N5AB 3LRHA 4ZAKA 3QI9A 4YPGA 1AXIB 1AQKL 5LQBL 1BD2D 2W0PA 2H2PC 4JREC 2H2PD 1YPZB 1PFCA 4X7SH 1QBMH 4DKEL 5DRXB 5GZOC 3BESR 4H5SA 2HT2C 5GZOD 4XC1L 1R3IH 4PB9H 5C0JA 3CVHA 5HYFA 2ICWA 3CXHK 3ZHKA 3LRSA 3VI4F 3MOAH 2Q7YB 4GG8A 1U8JB 2WNGA 5T1KB 1UJ3B 1H3TA 5I16B 2VL5A 1I3GH 5D93B 1T04A 2QKIB 1ZLWH 5J89A 3CZFA 2JCCE 2DB8A 3LV3B 2C9AA 4X99A 2I9LB 1OGTA 1U6AH 1W2KT 1UCBH 5JIHA 2DIJA 2W07A 4PJIA 5DHVB 4OFKA 4P46B 5FEBA 1OAXH 4HWBA 5I1EL 4PJ7B 4XAKE 5IJVA 1KYOJ 1KG0A 1CFTB 4U1SA 3TGXA 2Y9RT 1PZUB 4MD0A 2X44D 4KQ3L 3KNBA 5GXBB 1VFBB 3N9GL 5AYUH 4TTDC 1MCWM 2IALA 1FC1A 1A6UH 4TTDD 5E8NA 4MQXC 3H2WA 4LRNL 2CH8A 2EDBA 1BOGA 4MQXD 4ZAKC 3Q1SH 3QI9C 4OKVA 4X9HA 5KSAB 3QI9D 4JB9L 4NN7B 5A2JH 4HCRL 3QCTH 2D03L 4F33B 4N0UA 5C0FA 5I30L 5IBUB 4BSWA 3L3GB 4L4TE 1CE1L 4OJFL 2EC8A 3MJ8A 5DK0B 1U95A 1HOCB 2OR9L 4HDIB 4CRPA 7FABH 2FHBA 3DX6B 1RI8A 2EYRB 3AB0C 3KPRB 1N64H 3BE1H 1FVEB 5D2LB 4LSPH 3MSPA 1KTLB 2MQ0A 4FMFA 4CJ1A 1I1YA 4XPTL 4GW4A 3P4MA 5E8DH 3G9VA 4NZRL 4X7FC 1J8KA 3S36H 3VXRA 4YHIA 2X4UB 1EFXB 3D87B 5BJTB 2F74B 5E5MA 5F9AC 3VA6A 4M7LH 1BZ7B 1BVKB 1T5XB 3ESVF 4F57L 5GSRA 1A4KA 3TBTA 1ACZA 3HRZB 2NX5D 3ME0A 4JFFD 4YH6A 3S34H 3S4SG 4YDLC 5IMKB 1NMAL 4I2XA 1DSFH 4AEIH 2PXYB 3NFSH 5ADOL 4QRUB 3IT8D 3SGDH 1NL0L 2DL9A 4JFQA 1JTTA 3PG2A 4M3JA 5E08H 4K3DH 4M7ZC 1PBYA 4Y4KA 5TQ0L 4FTVA 1FLTX 5AUMB 2J88L 5GJTL 3TNMA 1FNLA 2AK4D 9CGTA 2B1HL 1FH5H 4B53A 4NDMA 3DGGB 2GTZA 4XGZB 1SJEB 1YEGH 1K85A 3T8XB 1UACL 2ZNWA 5CJ8A 5EU3B 3ZTNH 3MREB 2BRRH 4TSAL 1A0QH 2HFGH 3A6BL 2BOCB 2VLKA 1FL6A 1MIEL 4YBHA 1QQDB 3MROA 5T3XH 4OV6F 3MRRA 1V7NL 3QFDB 4AENA 3PF2A 4P2QE 5JHLL 4PTUB 2FX8H 2JELL 2ADJA 4CMMB 1QLEH 2DLFH 5F7NC 1IGML 2JK5B 1LO5A 3ULSB 5FO8A 1FNGA 3NZ8A 2BZDA 3MRFB 3QDJE 5DMKA 4PP2B 5T5FL 1K3ZA 2E3VA 2PW2A 1V8HA 1SBSL 4ZFZB 4YR6B 3NA4A 4CBPA 4PGEB 1R3HA 4KVNL 5EO1A 2FX7H 1IC4L 5F7DA 5IF0A 2OJZH 3ARBD 4PY8J 1J0ZA 1LE5A 3PDGA 4H0GA 3BGAA 1OPGH 1CICD 1CGXA 5HPOA 1P2CB 1LP9E 4R3SA 3RX7A 4OGAC 1S9XB 4R4FH 4ZTOH 2ADGB 1JBJA 1D5MA 2DM4A 4RAVB 3GJEA 4XCYA 4XBGB 1CFQA 3V9FA 2HYMA 4S2SB 5E0QA 4E5XB 4WHYH 2D9CA 5CINL 2FBOJ 2H1PH 4RCAA 3R0MA 4JY6B 5F9WB 4E41D 1XZ0B 3VFPB 3U4BL 3H3KA 4Q58C 3QJHB 3DTXB 4X6FB 5E94B 5CJQH 2VZUA 2ESVE 3DVIA 1GSMA 2ERJC 4PRPD 3B83A 2FBJH 2FECL 5GZNC 5F96L 4JGMA 2GSIA 5ANMB 5BZWA 1OAYL 1LNUB 1DBMH 2L0DA 3BEWB 3VFTA 3STZA 4HG4K 1INEL 2EEAA 1QFWI 2YUZA 4OLWH 1NLDH 1FFNB 3EO1A 1MJJB 4O5LH 4KAQL 1N6VA 4YHPB 3I6KB 1C1EL 3CGTA 4PJCE 4ODHL 1L6XA 4HK3J 4C54A 2DAVA 1XH3B 1U8NB 4JLRA 1TJIL 2CUIA 2YUVA 1EVUA 2A0LD 4LSVL 2Q7NA 3O0RH 4Y1AB 3T3PE 3I50H 2EDHA 3BUYB 4K23L 4O58L 4HS8L 1R3JB 2YN3A 3SY0B 1DANU 4EXPX 3C9NB 3O3UN 4RMQA 4PD4J 4I3RL 3WMSA 4LSTH 4ZNEA 3T09A 3T0VA 3GRWA 3W0WB 3HC4H 3S96B 5TDOA 3UROR 1LK3H 1G7HA 4NO5A 3LKRA 3P4OA 1WFNA 2MHAB 3MRMA 4RGOH 3RVTC 2VC2H 5E8PA 3BIBX 3G6JB 4PJEE 4UU9B 4G8GE 1N2RB 3PL6C 5INDA 1J18A 3PL6D 5DRZA 4DCQA 4DOHE 4JFDB 1OARL 4RGNE 5HHOD 4RRPG 3QWRD 3VI3F 5FV1L 4RWYL 1J0YA 1ZHNB 4Q0XH 4CW1A 1DDHB 4HS3B 3VD3A 5C0CA 3OHXA 4LLDA 1PKQA 4HKBB 5EOCL 3V4UH 2XICA 1MVUB 3KPLB 4KV5F 5CEZD 3BSZL 4YUEL 3MV7B 3UBXI 5H2BB 1K8DB 1YN7A 1PX4A 5DHVH 4YHYB 1LDSA 4FFZH 3FTGA 3B9KD 1JYNA 3HS0B 2DIAA 2B7DT 2Y36H 1RUAH 1F11B 1DQDL 4HT1L 3LN9A 5F6IC 3BT2H 3BW9B 1I3RB 4KU1A 4PJDE 1UB6B 4NNPL 1QA9A 4WEMB 2FB4L 3LQAH 4JFEE 1MF2H 1SJVA 3HMWL 3W39A 2BVQA 2Y06H 3DBXA 1X5XA 3EOAA 4HLJA 5JHDB 2HTKC 3H7BA 1MWAA 4TSCL 4F9LC 2HTKD 1F3JA 2LV4A 4N0RA 4YHOH 1S8DA 3CFIC 4IS6A 1ZSDA 3NH7H 3SDDA 4EI5A 4NP4H 3HE6B 3MXVH 3QA3A 2OJEB 1CFSB 3TYGL 4PRIA 4QWWC 4QWWD 1IKNA 3LD8B 2IJ0C 4HUVA 4KKAC 4XXCA 1MHEB 4KKAD 1Z9LA 5ACZA 5GGTH 4ZUWA 2VAJA 3FRPG 3GZKA 3EYUH 5C0CD 5MP6H 1OP5H 2ZUQB 1JNNH 1MHPL 4HUXB 1TQCB 2Y4SA 1NDGA 4APQA 1Q0XL 2X4OB 3LMJH 4RNRB 5GS1B 2XRAL 4YQXH 3TIDB 4RIRA 4ODTL 1MI5B 1RY7B 2NY2B 2YA0A 4X8JB 4TRPL 5DD0L 1KELH 2CLRB 3WKML 3W2DL 5MEQA 3S35H 1RJCA 1NCWH 1XCQA 2LU3A 4NKIH 3QRFM 5DQ9B 3OZ9L 3KPPA 4L8BA 1VPOH 2RR3A 3ARWA 2UUDH 1YMMB 1JPGA 4DVBA 4EI5C 3SDDC 4DZ8B 5EO0A 3SDDD 1B2WL 1NCTA 3RNKA 1FVDB 4FQJL 1M7IB 5D9SB 1B0WA 1UEYA 5GGSA 5I76A 4PRID 1IKNC 2IPUG 1OLLA 3R4DA 4XXCC 1CFVL 2WAHA 3BUTA 3L3HA 4JM2A 2ZUTA 2FX9H 1NBQA 5SWSB 5DUMH 1NANI 1QP1A 5FKAA 4OUUA 1NC4B 3UP1A 5K59E 3IJSA 3PUCA 5GS0C 5GS0D 3U48A 3UPRB 4KKCC 3DMMA 3I2CH 4KKCD 4APQC 4APQD 2P8PB 4JRXD 4IMLA 2A1WH 1SYSA 3O45A 1A14L 4XMKH 1WAAA 4YFLI 1EBAA 3D5OF 4AL8H 4QRTB 5JMOC 5HY9A 2APFA 1RPQA 2V6HA 4C83A 3EJYC 2P45B 3ZTJH 3INUL 3EJYD 5FO7B 3K2UL 5DRWA 2BVOB 1CBVH 4ZUTA 5ICXA 2VLJD 4F37F 1FBIL 4MS8C 4MS8D 4EBQL 4FQCL 1QEWB 4NHUB 3BGMB 1K9TA 4X8XA 4WFED 4RFNB 5IEHA 5IB5B 1MJ7L 1SJHB 5EBMB 5LWYL 1ZTXL 2E6PA 1YEIH 1JWMB 4IOIB 5E99L 5FOBB 1REIA 5HVGB 1ZLVK 4KUZL 3JTTB 1QRNA 3MCLH 4GKZA 1KPVA 5T5NF 3DJ9A 3VH8G 4ONFH 2WINB 1FAIH 4GBXB 1QG3A 3L5JA 2R0KH 4YPJA 3MUGB 4WWKA 1A1MA 2PTUA 2CKNA 3T3MF 5FECB 2X5PA 1J8HB 1SVCP 3VGHA 3L3IA 3F5WB 4U0QB 1RK1A 4FQ1H 3QEQD 3DMMC 1F58H 2VDRL 5D7LE 3HZMB 4MNHA 1QBAA 2CSPA 5KSVA 3LPWA 3G6DH 4OD1H 1WIUA 5DLMH 2CIKB 2HFFB 2GSGA 1BZ9B 2R4SH 4D0BB 1RU9H 1TJHH 3LPGA 4P23B 5DF0A 2PW1A 1JN6A 4K9EH 2BSTB 3EO0A 1J87A 2FATH 3QEGL 4U31A 5HHNB 4GQPH 2W92A 4JHZA 3LS4L 1J0HA 3QNZA 3EFDL 2QQQA 4H25A 3R06A 4HX1B 1RUPL 2P8LA 2GJ6A 4MA8L 2DLEA 4P2RE 1CZ8H 4LARH 3DECA 4Z7VF 3BD4A 2B4CC 5JXED 4EOWL 4J3VA 4OZFA 1SY6A 1KCKA 4MA3A 1WEJL 2AXFA 3WJJA 4OZGE 1CLOH 2XWJB 3KLSA 4LKCB 3V95A 1IGTB 4WWKC 3RWDB 4QHUB 3U9PH 3K7UA 4M8QA 3IAGC 1XF2A 2RFXB 2XTJC 5I1IL 2DJUA 3MGOA 2XTJD 4O2EA 3SQOH 3LSOA 4PJBF 4RFOH 1HH6B 5IOPA 1DEEB 3QUYD 1P69B 5L7XL 1Z9SA 5IQ9A 3LEXB 4ZUUB 2IQ9L 2IQAA 3NCMA 3STLB 3GMPB 3MQIA 1T0PB 1P4LA 3SDXB 1Z3GL 4U1JB 5C0BB 1Y18B 4I18B 4OIIH 2E9IA 3OKOA 3ULUC 4NO0D 4S10A 5INCB 3ULUD 4ZFGH 4AT6B 5FM5O 3BAEL 1M71B 5DSCA 3C87A 5EIQA 2F19L 5D8JH 3WEXB 2R56L 4PJFA 3OR7A 1MELA 2APXA 2O26U 3OKLB 4XBEH 1IM3B 4P59L 1MJ8H 7CGTA 1QFPA 1UWEH 3QO0B 2DQGL 3EHBC 4ESKA 3WJJC 3EHBD 1NGPH 2G2RB 1X5KA 2QADD 2ZUXA 1UZ6F 3TH3T 5FA3A 3DVNA 4X9GA 1JTOA 2LE9A 4YHLL 4WW1A 1YPZA 3U0PB 4OF5A 5DRXA 2HWZL 3MV8A 3MV9A 2F8XC 1IKFL 5K9JH 1JGVH 5D96C 1RULH 1S7RA 2NY0C 5ERWA 1F45A 2NY0D 1LD9B 4P5KB 4R6UA 1U8JA 5T1KA 1UJ3A 1YEJL 1EO8H 1H3XA 2XWBB 1Q72L 3WD5L 4HXAL 2IBZY 3QHTC 2I9LA 3V8OA 4G80B 1MCFA 5IFAH 1V05A 4P46A 1T89A 4PJ7A 3SDAD 1Q38A 4Z7WF 3AXLA 5LBSL 4NKMB 4MXVF 5H35B 1EJOL 2P5EB 4DK6A 5FK9A 5C6TH 3CSBA 1I9IL 4ZUVA 1IT9L 1MRCH 5D1QB 2Q76B 4KY1L 5B8CC 1WBYA 4NSKB 4I48B 2UWEF 3D25A 1OSZB 3RFZC 2VR4A 4M1CC 1FRGL 4M1CD 4XI5C 5KSAA 1OSPH 3BKYL 3GMLB 4G7YH 2V7HA 1FFQA 3FB6A 5I6XC 5ID1A 3L3GA 3NAAL 1A7QH 4O4YL 1NUNB 3RJDA 5FYJL 1AXTH 5IFAL 4HBCL 4AK1A 2ZPKL 3MV8D 3MV9D 2IMMA 5CEYA 1HOCA 4NWTH 1PSKH 3I75B 5A2KH 2IMNA 3C09B 3DX6A 4KTDL 4N0FB 3ULVF 4K7PL 4YHNB 3SO5A 3I02B 4JZJA 1QSED 1BM3H 3KPRA 1UJ3C 2V17L 1FVEA 3D39E 5F7HA 1EUUA 1KTLA 4HC1L 5D93C 4GMSL 2FEDD 4NIKB 1Z6JT 1I8MB 3P11L 5E7FA 3QUMA 2X4UA 2COQA 3MLSL 1GPOH 3MRQB 1T89C 5C07A 1UQSA 5C09D 5BJTA 2F74A 1UWGL 4L29B 1WJ3A 3LKPA 3NIGE 4UIKL 4KZDH 1BZ7A 3MJ9A 3OJVC 1RHHB 1KB9J 3IJHA 3V0AC 1HIML 2NZIA 1QBLH 2JTDA 2FO1A 2G9HA 2AI0L 5JLZB 4QOKD 4PJAA 4NGHH 15C8H 3NA9H 4XCCH 2ITDB 2AXGB 4BSVA 4C56E 3DGGA 3V4PL 3MACH 1NKRA 4XGZA 4LLQA 3FONB 3ZKNC 1SJEA 3FFDB 1IE5A 3ZKXB 2AQ3A 3EYVB 3VXTB 3KPOA 5JUEL 3CLEH 3PHOB 5EU3A 4XNMA 4LQ1A 2ED7A 3O2WH 2DBLL 2BOCA 2ZKHH 4Y19E 1AR1D 1UB5B 1X5FA 4XHJD 3S37H 1QQDA 3J8F7 1SYVB 4JZJC 4KZEH 4LLAA 4ZD3L 5EBWB 1WWAX 2YRPA 3TIEB 4L3AA 5IBTL 2OR8A 1CXIA 5JMRA 3K8MA 1ZLSH 1MCBA 3ULSA 1OAUL 4HGWB 1NFIB 4PJ5D 2IH1B 1MLCA 5JORB 4HV8B 4OZIB 4PP2A 5DQDL 2A83B 4LSSH 1ZWIB 3VXSD 5KS9F 3CFJB 1R3LA 1TQBC 4P9ML 1DLHA 1NAML 1I8LA 1A6ZB 1KN4L 1XGQB 4L3ED 4YR6A 1KN2H 4YXLH 1D5BA 1A02N 2JIXB 1INDH 3ALWA 5GHWH 4L8DB 4KJWC 1P2CA 2AJUL 5IM7B 4Z78B 1Q8MA 1S9XA 4QTIH 1KB5A 3U0WL 4M5YL 4IRSB 2DQHL 4RAVA 4LL9A 4CGTA 2DQEH 5EZOH 1FO0H 4JQIH 4NN5B 1MCHA 3QR2A 4OGYL 1EZVX 3R8QA 4S2SA 4ETYA 4E5XA 3S5LG 4U2ZA 5DYOB 2A2QT 2Z31B 4HPYL 3VMOA 5IFHH 5CFHA 2QLVB 4P3CL 1AI1H 4G6KL 5CJBA 4JY6A 5C3LD 5HSFA 2YUXA 4KKBC 4MJ5A 3CVIL 3DSFL 5J56B 4KKBD 3SE9H 3DTXA 3U1SL 4FFYH 4LLYB 4Y5XB 3KYMB 4PRHE 2GI7A 5JZ7D 3BYYA 3RY6A 3O3EB 3X11B 5DJYB 3UXFA 5ANMA 3D0LA 4WO4B 5JXAH 4HK3N 3MODH 3SE3A 2W60B 4KK9D 4W6XB 1I8LC 2E7HA 3BEWA 5DO2C 3HZKB 5DO2D 3GSNL 1UWXK 4PP1C 4JY5L 4PP1D 3EJZC 3EJZD 1MJJA 3C08L 3KYOB 4HUNB 3L9RB 2CUMA 1H3PH 1CN4A 3EYFA 1FORL 3EYSL 1XH3A 5FYJE 1PDKA 2N7BA 1ITCA 4Y2DB 4OCNC 2JJUA 3WN5B 4Y1AA 3BUYA 5ISZE 1UM5L 3DVGB 4PGZA 1R3JA 2R9HD 2N4IA 5CZXD 4Q2ZB 5F9WC 1LO0H 3RI5K 1YY8A 3C9NA 2YKLL 1J5OL 3W0WA 3VD5A 1ZEAH 5DJ2A 1DL7H 4WENB 2AJZB 2MHAA 2FD6H 4JQXA 4GO6B 4IJ3C 2V9QA 4UU9A 3RVWC 3RY6C 4XP4H 2W38A 2NMSA 3JVGA 4H1LA 2VE6A 3A0OA 4H0HB 1A2YB 1T1WB 3SE3C 3W9DB 5A40E 3WIIL 1NFDF 1HHKB 1UZ8A 2ICES 5B3JE 4YDJB 4ZPTB 5EU5A 3TCLB 4ODVH 3HR5B 3PDOB 2ED9A 4HS3A 4ODSL 1X5LA 2VOTA 4WHYG 4HKBA 1ZHBA 3KPLA 4RWHA 1UKSA 4ODXB 5BZDA 3TYFA 3MV7A 5H2BA 4N90E 3D48R 2DS4A 1K8DA 3VFOA 3OB0K 4U49A 3T65B 2IAMB 3ILQD 3HS0A 1CG9B 4WEUD 1WSST 3CVHL 4PB0L 1F11A 4OTXL 1K8IB 4QY8A 5ICZB 5TFSH 5EBGA 3VFGL 5T1DL 1I3RA 3NVQA 1VFAB 3SN6N 5JPMB 4K2UL 4NQVB 3EDJA 4FP8H 1F3DH 3GB7B 1EV2E 3TA3D 5BV7H 5JHDA 1YNKL 5EO9B 4FQ2H 4HBQA 4NJ9H 4JQXC 1RAMA 2VXQH 3H42H 3MBXL 4JPVL 4AY0A 2LTQB 5KVMC 3JVGC 2DTSA 1D3CA 3BQUB 3LAFA 4HWBL 5DJXA 4Q9QH 4XCFL 5GISL 1MCSA 3CD4A 3HE6A 3X3GH 2OJEA 3AY4C 3U7YH 3K0WA 1K6QH 4BK5A 5MEND 3C60B 1BFVL 4NPYA 3OKKB 1MHEA 1BQSA 1FE8L 3ETBF 4IEFB 4MD5A 4MSWA 5D2NE 2RB8A 4M7KH 3CXDL 4KC3B 3CSPA 5FYLH 3RJQB 1R24B 1T83A 4RNRA 5GS1A 4UILH 2BY0A 2HFEB 3CFDB 1E4WH 2OLDA 4PJ8C 5FGSA 3TIDA 4GAYA 5JPNB 1AGBB 2CRMA 4PJ8D 1MI5A 4YLQT 3MA7A 4AJ0A 1ZA6A 2V2TB 3VFRB 1AXSA 4BJLA 3O2VL 3DUHA 3BOVA 1WCBB 4PREB 3LHPH 3NFPB 4UINH 3T0EB 4XMLL 3QDHA 5J13C 2VQUA 5D7JB 4EQ2A 4R97C 4NUJA 4N0CC 3EFFB 5DQ9A 3TZVB 4N0CD 5IMOB 2VZSA 2O5XH 4J23A 3S9DB 3CFCL 4KTYA 4W4OA 4DZ8A 2B39A 1YECH 3HE6C 3LDBB 2OL3B 4UQ3B 1M7IA 4JPKH 4LU5H 5SWZE 4FXGA 4L8CB 3LD8C 4PLOB 3WFEL 4L9DA 1CI5A 1WGOA 4M61B 5SWSA 4XHQA 5I1GL 1KENL 5HYSG 8FABA 4LVOB 1Y6KR 1FYTA 2CIIA 4HMDA 1DFBH 2ZUQC 5DD1H 1XIWC 1BLNA 2GQHA 4M7JH 1XIWD 2IANA 1TQCC 1VGEH 1DUYB 5E9DB 1T83C 3MMEB 4FRWA 5GS1C 4QF1B 5J11B 1VADA 3E6HB 5JOEA 2ZG1A 5CILL 3UYRH 2B1AH 3RWIB 1PG7X 2VH5L 2N7AA 1GJIA 3BX7C 1UJTA 3O6FD 5BRZB 4PRBB 5FO7A 3MLVH 3MR9A 5IBUG 1MFAH 3H9HB 1NAKH 5F71A 5I1JH 3MFGB 3G04A 4FHBD 2VXSH 4OZHF 4D3CH 4NHUA 1H0DB 1F02I 3BGMA 1FL5A 1QYGH 4MZ2A 3D18A 3PGCB 1SJHA 3IGAB 4PIRF 3BWAA 1MCJA 4IOIA 4W4OC 2C3XA 4QNPE 1JUFA 3JTTA 2VDNL 4AEFA 2F5BL 2VXVH 5IVXF 3FMGH 4QHLB 4FA8A 1MAKA 1IZKA 5FM8A 3T04D 4NJAL 4WEBH 3WLBB 4P4KB 3MLUH 4GBXA 3CK0L 2FWOB 5EUKB 5L8KB 1A6AA 2HRPL 5FECA 1FYTD 3RIAK 2MKWA 3DXAB 4HF5L 5LGKA 4MHHG 3F5WA 3X12A 4MJ6B 1F6FB 4X4MA 2IAND 4NN6C 3HZMA 4QXWA 4OLZL 4GG6A 4WUUB 4O51A 3ZHLA 2CIKA 2HFFA 4MDJA 2DQIL 2OTPA 1BPVA 5HHMD 1D9KD 3WNMA 5B38B 3GK8L 2E7BA 1RZJH 1FNHA 2BSTA 3PWPA 5E6IB 2ADFL 5J1TC 2BJML 5BO1L 1QRKA 2DMKA 2F54D 1YNLL 4HX1A 3WS6A 1EXUB 4PJIE 3OKDB 3Q6FA 5DFWH 5E56A 2QQNH 4C4KT 4CU8A 4QRQB 1KIQB 1GHFL 3LKOA 1RURL 4RAUB 3MX0A 5F7FA 3FFCD 1S9WA 3IDUA 4AG4H 4HWEL 3VU2A 4LBEB 2OTUA 2HRLA 4U6YB 1NGWA 2XA3A 4Y4HC 3RWHB 3OGCB 4CMHC 4Y4HD 3FQNA 4KVCL 1U2CA 4OV5A 1KCLA 2F9BT 4GBXC 3IFPB 4QRPB 4LKCA 1GZQB 4D9QD 4FQXA 4CKVX 1IGTA 3RWDA 4QHUA 4U1KB 1AGDB 4LHJB 1M4KA 2I27N 2VSCA 1CFBA 1KJVB 3O41B 4N0UE 1UA6H 2WUBH 5CEZL 3QDJB 2APTA 1D5IH 2YK1H 4RX4A 3RGVC 5CD5C 3RGVD 5CD5D 1DEEA 3ZTJG 5J4MA 2BHZA 4KTEL 4ZUUA 4ZMAT 1DEDA 1I3VA 1T21B 3STLA 3QIWB 5L88H 3IKCB 5I19L 1NC2A 3BP7B 4L5FH 3V4VL 3SDXA 4U1JA 5C0BA 3GSVB 3KR3L 3PWPD 5AZEH 5C7XH 2MOVA 1RV6X 5INCA 4DUVA 3UJIH 2ZG2A 3GRWL 2XOTA 2GY7B 3WS6C 3WXWH 3VXRE 2V5RA 5I1HL 5J8OA 3HCVA 3QEHB 4L8SA 3QIUB 5BVJB 3WEXA 2A6KB 3U30C 5HI3C 1FHGA 5HI3D 5HI4C 3OPZH 4YHZL 3HZVA 1Q94B 1E28B 3VXPA 4I2XE 4G8IB 4WDIB 2J3SA 5IVZA 5C0EB 3BKCL 2G2RA 3KPSD 3MZGB 1BEYH 5DEGB 4KI5C 4TNWF 3WIHA 4KI5D 2ESVB 4XH2A 4FQXC 1BJMA 4HZAA 1U8MA 4FQXD 2D4DA 2WBKA 2PUQT 4FTVE 4ZPVB 3U0PA 1WWCA 2BOBB 1HINH 4PFEA 5F7EH 4OCSL 4TUJB 3IYLW 1QFOA 4D9RE 1F4WH 4NBZB 2VZVA 4IRJB 4P5KA 5FUOL 2VLKE 5JDSB 3BI9X 4JM4L 3WNLA 1A6TB 1WQVT 3E2HB 3OF6D 1NC2D 3QNXB 1KPUB 5DMIL 1SHMA 4G80A 3DYMA 4OB5L 4M6NH 4F2MA 4M6MH 2D0GA 1LK2B 5F1OB 2DLTA 2C3HA 1GAFH 2KQMA 1F4YH 4L8SC 1MWAL 4OCYL 1ZHLB 4WVRA 1TJGL 2AJXH 4LLUA 3RTQB 1KGCD 4XWOC 4XWOD 5D1QA 4UDTB 4PRDB 1CGYA 4I48A 5MHSD 5F9OL 5DS8A 4OCXH 3EBAA 5F9JA 1ZLVH 2DM7A 4HH8A 3L3OA 1U8PB 3Q6GH 1BBJA 4M02A 3RKPA 3VGEA 1XF3A 1EBPA 4MA1C 1JWSB 3BKJH 3OMZA 1HKLH 1N8ZB 3O2DH 4PG9B 5GS0L 4G3YH 1DQTA 3BMWA 1H3WM 3X17A 4TOYH 2Y6SC 3LQZB 5SX4H 4LVNB 3I75A 1PYWB 3HI5L 2AABL 3P30H 4HGKC 5KG9B 2UVEA 4O2FB 4NQDA 4HEME 4EVNB 2QSTA 3M8OL 3QEUB 5DJ8A 5E4EB 1T1XA 3MLZL 5I9QC 2JJWA 4KXZI 4MDIA 4XVSH 4JVUA 1BJ8A 4UOJA 4ETQB 4RQQB 1OCWL 4HSQA 1P1ZA 1KV3A 3EAKA 2OP4H 3ARGB 3KPNA 2J8OA 5GGUB 3GHEL 5C0RL 1CL7I 3X3FL 3F7RA 4CNIA 3TO4A 5D1XD 1JNLH 2FIKA 2QQLL 4JFEB 2ITCB 2FIRT 3K8KA 3B6SB 2KQNA 3L3DB 2ITDA 4OZ4A 3ZSTA 3MLPA 2QBWA 5TQ2H 1T2QH 5CEZE 2PKDA 3T4AB 3FONA 3CJJA 3FFDA 1A6WL 3JXAA 4CUCA 5J9PB 3VXTA 4UT7L 2HVKB 4O2CB 4WFGD 3CU7A 3PGFL 2YMXH 1I7ZB 3I3DA 1S5IL 3QHZH 4AEHL 3BPNB 4UIMB 2VDPH 4M1DL 5HHVL 2QR0B 2DLGA 3B5HA 1SEBB 3H7LA 5GJSH 4OLXH 4UAOC 2HKFH 2OM5A 5EBWA 4ZSOA 3N1GC 4NQDD 1NCAL 3TIEA 1EA9C 4X4YA 3F12B 4KWUA 4XNXH 2AEQL 1BX2B 4GKNA 1NFIA 5JORA 4HD9A 4OZIA 2H45A 2QSQA 1A1NB 2Z8SA 2BVPB 3F7QA 5L2JB 1ZWIA 4HIEB 3CFJA 4H88H 4WI6A 1LO4L 5TDNA 3UX9B 1A6ZA 1XGQA 5E95B 5AYQA 1HHHA 5IMMB 3QT2A 3AS2A 1F4AA 3RX8A 4NFDA 2JE8A 3TO4C 2AV7B 2B4CL 1ZVYA 2MQCA 4MXWH 4L8DA 3UTOA 3KPTA 5C0CE 5D6CB 4LAQL 5B39A 4DUWA 2AJ3B 4IRSA 4LF3A 1NBYB 1ONQA 1PKQE 5D7IF 4D8PA 4DN3L 4G42B 5E03A 4YDIH 1YEHH 4WV1B 1AD0B 4OCWH 1DBAL 2DN7A 2X1PA 1WBZA 2HT4D 2UY6A 3SDCD 2BNRA 1SMOA 2HN7B 3HPJB 5TE7L 4LNRA 2Z31A 2J4WH 2VLLB 4I0PB 4PUBL 2CJUL 1JK8B 4C59B 1LVEA 1G9EA 2YPVL 3QH3B 3QXDA 3VRIB 5TH2B 4HGMA 4Y5XA 3QZWB 3KYMA 3ULUL 3I6LE 3PP4H 4O9HL 5F3BB 4CVZB 1GXEA 3O3EA 4UT6L 2R2EB 3X11A 2BSRA 4M93B 3QBTB 5GS2H 1HZHL 4EIGB 4WO4A 2W60A 1FDLH 4HPOH 5K9OA 1EX0A 1KTKE 2GFBB 3HZKA 2O5YH 2P8MB 2AK1L 3HC0B 5D71H 4PRIE 4TVPL 2CLZA 3LIZL 3Q5OA 4GT7A 4JJ5B 3KYOA 4Z6AT 1SY6L 1E6JH 1BQLL 3TT1L 3L9RA 1RVFL 3QAZB 1AQKH 3JV0A 5LQBH 2OMNA 3DGCR 2VUYA 3DO3A 3S6CA 2X6MA 2P24B 2Y7QB 1KLUA 3K1KC 4NN5C 3SOBL 3KS0H 4XC1H 3GBNL 4AMKL 3ZYIA 2Z31C 3ZYJA 4HFWB 5FGBA 1P7KB 4Q2ZA 4HIJA 2FDBP 5C0NC 5C0ND 1HXYA 5ITFB 1J1OL 5E2VL 5AZ2L 4MAUL 3QUKA 4Y5XC 4I8DA 5KW9L 1CLCA 3CX5K 2EDWA 4YEEA 3HAEB 4F8QA 2PR4H 3WFBL 5I1EH 4F9PA 4WO4C 1T1WA 3HE7B 5FHBH 5FOJA 2F5AL 2AV1A 5JIKA 1DQLH 4KQ3H 1MHCA 4Z0BL 3TO2B 4H0IA 2V9RA 4YDJA 1I7UA 3N9GH 3JTSB 4ZPTA 3IRPX 3TCLA 4U6HA 4QHMB 3PDOA 1JHTA 2HJKA 3WFDL 1QVOB 4LRNH 5E2TL 4BFIA 1DVFC 4JB9H 1LE9B 4HCRH 1DVFD 1SEQL 4JZNB 4ODXA 3UCRA 2D03H 4POYA 2I24N 3BEVB 4BFEA 5I30H 6FABL 1CE1H 4P2RB 2VZTA 4LSUL 4OJFH 3QEQE 3H9SD 3P9LB 4I13B 5ICYA 2OR9H 4PY7A 2XN9D 1K8IA 5ICZA 1KJ2A 2EDOA 1WAAE 4MJ4A 1VFAA 5JPMA 2ICEB 4NQVA 3C5SA 1U93B 1WFUA 4OZGB 1RZKC 5L6YH 4EN3B 3GB7A 4XVUD 1B6UA 3P9MA 5EO9A 1TTUA 3OKNB 2X4RB 1KEML 4XPTH 2X4TA 4NZRH 1AH1A 1TZHB 2NY1B 5E5RB 5C0GB 3NFNB 4GKSA 5K33A 3N85L 3I6GA 1P5VA 5L2KA 2W9LA 3BQUA 5EC1B 5L8JB 1UYWL 4F9PC 3OXSB 3FN9A 3VXUD 4F57H 4U1HB 1EEZB 2H32B 4TULL 3NIFE 3OKKA 1I7TA 1QRNE 2NY6B 1NMAH 2WMPA 4OT1L 3HG1A 1CIUA 1RK0A 1IGCL 5ADOH 2PYFA 1NL0H 5C08D 4F7TA 3D0VA 2DYPB 1AQDB 4K8RH 4UOW1 5B3NA 4U1LB 5HDQH 5TQ0H 5GJTH 2J88H 2AQ2A 1R24A 2AXJA 5LGJB 2B1HH 4QYOB 1BQHB 1G9MH 1K4DB 5DURD 3CNKA 1UACH 1AGBA 4MCZB 3C2AL 4TSAH 1XGTB 4WTZA 3A6BH 2V2TA 1MIEH 2XZQL 4ZOAA 2FCBA 1CDBA 1LEKA 2BXZA 1V7NH 3NFPA 3T0EA 1EERB 3ZE2E 3HB3C 1XF5B 3EZ8A 3HB3D 5JHLH 3ARDA 2X4SB 1LP9F 2YWYA 5D7JA 2JELH 3SDYL 3ULUE 1RZGB 3QUML 1HHIA 4AIZB 3H3PL 5I1CL 1VA9A 1IGMH 4PLKD 5IMOA 5TGBB 3W9EB 4KK8D 4P2OD 4CVUA 2GJ6E 4XNQA 5L2KD 1CTNA 3OJDB 3MJ9L 5T5FH 2I60L 3SBWC 2OL3A 1SBSH 3QQNA 4TVPE 3MRCB 2PF6A 1OAZL 4KVNH 2XKSA 4JZOB 1KUMA 1KLGB 4M61A 1IC4H 4ZS7L 3HG1D 1VSCA 1BOYA 1AKJD 1ZLUK 5KSUA 5I8KL 1ZGLB 2R23B 4H20L 3D3VA 2UVFA 1HYRC 2PYEA 5E9DA 1DUYA 3MRKA 2D7QA 4DGIL 4HIXH 1CFNB 4QF1A 3TN0B 3E6HA 3NCJL 3C8KB 4HKJA 4PRNB 4HZLB 4X5WB 5DJZB 5CINH 2CKBA 5BRZA 4PRBA 1MFEL 3RA7L 3U2SA 1QBBA 5D70L 3ARDC 5HDOA 3TPUB 3U4BH 2R1WB 2JB5H 5LG1A 1H0DA 4KHTL 2NY5C 4CDGC 2XV6B 3PGCA 2ICCA 3B2VL 4M9OA 5F96H 3NCCB 3MTRA 4JDZB 1OAYH 3SGDI 4PJFE 1NPUA 1PD6A 4QHLA 1MCIA 2EDKA 4X5LA 4X6CB 4LLVA 1INEH 1H5BB 3FOLB 4QGYA 5DGRA 1J88A 3VFMA 3O6LL 2R15A 5E00B 1NBVL 4KAQH 4LVOC 5F7WC 3SGKA 2YD1A 3DXAA 1C1EH 5FYKU 1KB5L 3FZUC 4ODHH 2QHRL 2YD2A 4PJEF 1F5WA 1YPZE 3D3VD 4MJ6A 3EOYG 1HWHB 2PYED 5HYSA 3MV8E 3MV9E 2A77L 4LASH 3IDGB 4KMTL 1TJIH 2VDQL 5HGHA 4R4BB 4YAQB 4LSVH 3U4EA 4WUUA 3ZLQC 3RUGB 2M1KA 5J6HB 3GNML 3OB0H 4K23H 4O58H 4HS8H 5B38A 5D1ZB 2XQBL 4CN1A 4YFLF 3AS1A 1KFAL 4NRXA 3MNZA 1YMHA 1KC5L 4I3RH 3G5VA 3K80A 1FG2A 1ZT4B 1I1RA 3C5JA 1IJ9A 1QTYT 1I85A 4C56B 3OKDA 4GUPB 4BA8A 4I5BB 4NKOB 3WO3B 4QRQA 1KIQA 4GS7B 1PVHA 4RMVA 1G0XA 5ENWB 3QP3A 5CBAB 1HXMA 2EDJA 1OARH 2K7PA 2EYTA 3UPAA 3MYJB 3RWHA 4PJDF 4RWYH 1E4JA 1JL8A 3AVEA 2BVYA 1YEDB 4QOKE 3IFPA 4QRPA 1GZQA 2Z91B 3ESUF 4S0SD 3B9VA 3FCTB 4U1KA 1AGDA 4UV4L 1KJVA 3NTCL 4JN2A 3SGKC 1I4FA 5EOCH 3IFNL 4PY8I 2OR7A 1G7PB 4NNXB 5FYKD 4BSJA 3BSZH 4YUEH 3FO9A 3BGFC 3HAEH 4QT5B 4Z7VA 1EK3A 3DLQR 4G5ZL 3SJVD 2VABB 1T21A 1D5XB 5J3HD 1T22B 3RWJA 3GSXA 4M00A 1MCCA 3EW3B 3IDYC 3KPRE 4HT1H 4NZTL 5DC9B 5F8QC 5IW3A 4R96B 5J6GB 3V0VB 2D7OA 4NNPH 3MXWL 5TF0A 4DQOL 3HMWH 2ZUYA 3O3DB 3NBNA 1IGIL 4PJBA 2FJHB 1GGIL 2G5RA 5C07E 1VGKB 3QEHA 5BVJA 4TSCH 4K7PY 1IGJB 4RZCB 4FFVC 5MI0C 3TYGH 3AMKA 2HVJB 5C0EA 1MFBL 1ORQA 3WCYA 4EJ1C 3N1FC 5DEGA 2G5BA 3RI5F 2ESVA 4PJAE 3QWOA 4NQEA 3DRTA 1BWWA 4X5XB 1TZIB 2IBGA 4ZPVA 3RAJL 2BOBA 2PTTB 1G6RA 5ADPL 1MHPH 1ND0B 2ZWLT 4YDVB 4YX2L 1F2QA 3SKOA 1Q0XH 2IH3A 4TUJA 1RIVL 5CEXA 3QFJB 5BOPA 2XRAH 4XP6L 4IRJA 1Q9KB 3QG7H 5CWSB 4ODTH 1S7QB 4J4PD 2PXYD 1BAFL 4TUKL 4PGBA 4TRPH 2DMCA 1MVFA 1S7SB 1SVZA 4U3XA 5MERB 3K74B 4X9IA 1S7WB 3BHBB 4MQSB 1VHPA 5DD0H 3WKMH 1N59A 5K59F 3W2DH 2BVEA 2ARJA 1LK2A 4NYLA 4NQSB 2AJVH 5ESAB 2CRIA 2VB5A 1ZHLA 4X7TA 4YK4C 2IADB 2VR5A 3OZ9H 2R1YB 5ISZB 3GJFB 3TWCH 4UDTA 1B2WH 3L5WB 4F3FA 1AIFA 4FQJH 4K71C 1NEUA 2IC2A 3V6FB 2D4FA 3VGDA 4M5ZL 1P7QD 3LRGA 1CFVH 1ED3B 1ZVSB 2ZUSA 5DD3L 2VXUH 3IU4L 4JDTL 3KXFA 4NQED 1JWSA 1N8ZA 4PG9A 5E1AB 5T3ZD 4Z7WA 4G6FD 5KVDH 1HILB 5EORL 4WTXA 4W70A 3THML 4L4VB 1NJ9A 1W0YT 2XKUA 5I75C 4GW1B 2UWEA 3VJ6A 1A14H 1QSVA 2BC4A 1JFQL 4NM4L 3MRPB 4O2FA 3UTSA 1EAPB 4DEPB 4DGVL 3U9UB 3EDEA 4EVNA 3QEUA 3FQRA 3INUH 3K2UH 2DQTH 1FVCB 4LHUB 4MJ2A 3T77B 4RQQA 4FQCH 1FGVL 3STBA 1KIUA 1Q9LA 5T1LB 3G9AB 3ARGA 4W6YB 5LWYH 1ZTXH 5E99H 5GRJL 4KUZH 3O3BB 2IG2L 1AY1L 1BVLB 4JCLA 4ORGA 1OM3L 4X7DC 4KJYB 1G7JB 3KLAA 1TPXB 2XY2A 4RMUA 4ZO8A 3B6SA 3RDTB 5EUOB 2V2WA 1B0GB 3BZFB 3KXFD 3GMRA 3LZFL 5J9PA 1ODAA 2C5DC 2HVKA 4O2CA 1NAMB 4MHHI 1T5WB 2VDRH 4Y1AE 4UIMA 3S36X 4Y4FB 3FO0L 4POZC 3BP4A 4V1DA 1XR9A 1T0NA 1KYOK 2YEZB 4AH2B 3UTSD 1F13A 3QEGH 3MBEC 4IDJL 1QHOA 3MBED 3F12A 3DX8B 3W0WE 1QR1B 1BX2A 4MJIA 2EDEA 3LS4H 3L95B 3EFDH 3GBLA 3DETC 5L2JA 1IM9B 3DETD 4HIEA 2ZOKB 1RUPH 4MA8H 5D5MF 3VGAC 5HHQA 4JO4L 3ARGC 4HJGB 2HT3C 5J57B 1OOAA 3UTZA 2HT3D 1QACA 1GC1C 3ULVC 3T0DA 5IMMA 3ULVD 3AAZB 2LU7A 5MENE 2GJZB 3EYOA 1CE6A 5DD6B 2NY4B 5GGVY 4EOWH 2XXMB 1XR8B 1WEJH 4DAGL 1NBYA 4WRLA 4G42A 5I1IH 4MNGA 4YDKL 4KROC 3MV7E 4KROD 5KS9A 1AD0A 5IWLA 5C0AA 3OXRA 1U8QB 4NCC1 5HI5C 2HN7A 3HPJA 4JFDD 5L7XH 2PETA 4D0DA 2IQ9H 3FT4B 4V1DD 2W0KA 4TNVF 2VITB 1X4XA 1Z3GH 3VRIA 2E9JA 1EAJA 3QZWA 3U6RB 3DV6B 3ISWA 3B4NA 4JREB 4MJID 5EWIL 1CT8B 2R2EA 2OXHA 1OTSC 3RIAF 5DEFB 5CMAA 1OTSD 3RVXC 2XKNB 3BAEH 4M43L 5EOTB 1YYLL 4G9FD 3DIFA 2F19H 5J7CC 2R56H 4NRZB 5EZIL 2P8MA 1M1SA 5J1AB 4BELD 4LEXL 4P59H 1DZBA 1I1AD 1YZZA 4MXQD 3AREA 2BHUA 4HKXB 3VRLE 2GK2A 3QNYB 2DQGH 4DKDC 5MEOB 1UXSA 2MNUA 4FMKA 1WBXA 1DN0B 4BFBD 2G75B 2Y7QA 4YHLH 3KG5A 3WL9A 2HWZH 2Q8BL 1KIRA 1A6VL 3SE8L 1IKFH 1KCRL 2ZCKL 1KBGL 5C0AD 3QJFB 4F7MB 2A73A 4WFFD 3VFUB 4KJPC 4CVXB 1MI5E 1G7MA 3G5XB 3L3JA 1YEJH 5CSBA 3ET9F 3MC0A 3QI9B 1F6AA 1L0YA 5HJ3B 4YZFE 2J6EA 1Q72H 5CBEA 3WD5H 4HXAH 4Y5VC 1PAMA 3UAJD 2YA2A 3LEYL 2OCFD 4H5SB 2NTFA 5LBSH 3CVHB 5EPMA 1EJOH 4A2MA 3O3AA 1JNHA 3JV5A 3TO2A 1AR2A 3A6CL 5HYJA 1I9IH 1IT9H 3AB0B 4GG8B 4WTWA 3RU8L 4KY1H 3AREC 2VL5B 1FFRA 3ARED 1T04B 4QHMA 4RMTA 2AS5M 3CZFB 1EJ6A 4X99B 1FRGH 4JAMB 4U4BA 3M17B 4JKMA 3BKYH 4RBPK 1FYTE 3MGTA 3WIHL 3OSKA 3CH8A 3BEVA 3NAAH 4LGPB 3NIGF 4O4YH 5IJVB 2IANE 4YHKL 1DR9A 5FYJH 4U1SB 3WSQL 1CDJA 1FLRL 3P9LA 4GRWF 4HBCH 1YMMD 2NX5B 2ZPKH 1T4KB 4JFFB 4MD0B 2Y07L 4JGUA 1WIPA 4QTHB 5JR1L 3LKNA 2BXYA 4PS4H 4KTDH 4XMPL 4YXHL 1I1FA 2MJWA 4K7PH 2DICA 3OX8A 4MZ3A 4J3WA 2XWTB 2ICEA 4R90L 4Y88A 5CIPH 3RIFK 2V17H 1U93A 4RISL 1AGFA 1BOGB 4KRPC 2EEBA 4HC1H 4OKVB 5IHUL 4GMSH 4EN3A 4M7ZB 3P11H 1JI2A 5C0FB 4N0UB 3HMXA 1TZHA 5C0GA 3NFNA 3MLSH 2YPLD 5EC1A 1UWGH 1U95B 4UIKH 4G6ML 4OIAA 2VISB 5EN2B 4NQXB 4Z95L 4U1HA 1EHLL 3WS3B 2H32A 5DK3A 2DKSA 2DD8L 2NQCA 5HYJD 4P5TA 3CSYB 2ZUWA 1IAKA 2OZ4A 2AI0H 4P57B 1AP2A 1FZOB 2EYSB 1LO3L 1I1YB 1AQDA 4YHIB 3FB7B 4U1LA 2W9EL 4J1UA 12E8L 3GIZL 1R0AL 2X2YA 2C4FT 3ZYOA 1RUML 4ALAL 5LGJA 2FEEL 5E5MB 2JJSA 3V4PH 2EDNA 3DOSA 4PD4K 4X4ME 3ZKMD 1A4KB 1AO7D 5JUEH 3C2SA 4GG6E 3PV6A 1XGTA 4PYGA 5CZKA 1JCKA 4FQLL 3W81A 2DBLH 3MRLA 1WIOA 1OGAA 3ARBB 5L9DL 1AGCB 3PWPE 1CICB 1XF5A 5F70A 4DVRL 4ZD3H 1NH6A 2X4SA 3IDXL 4GXUM 2EH7L 5CGYC 1RZGA 5CGYD 5TE4L 5IBTH 4AIZA 5JW4N 2Q87A 5TGBA 3W9EA 3HNSH 2DM2A 2GTZB 1TENA 1OAUH 1J8HD 2BNQD 3V2AR 5JA8B 5DQDH 1A4JA 1B4JL 1IAIL 3ECBB 5M95B 4P9MH 1NAMH 1FL6B 4NQCA 1KN4H 4MCYA 2NY6C 3MRCA 3MROB 4P5TC 4E41B 4P5TD 1VEPA 4OD2A 4EKXA 2ADJB 4N8VB 1IZJA 4U7SA 4KI5E 2AJUH 2R2BA 4K3JH 1ZGLA 4PRPB 3BPLC 1LO5B 3U0WH 2ERJB 1WT5A 4M5YH 1FNGB 2DQHH 2EDXA 2JJSC 4LCWA 1T2JA 4HQQL 1IQDA 3S35X 3UO1L 1G0DA 4OGYH 1TVHA 1R3HB 3NACL 3LVEA 2X89D 5EO1B 4HZLA 4X5WA 5DJZA 5F7DB 1WUNT 4HPYH 2Q86B 3SDXE 1OGAD 4P3CH 5C0BE 4G6KH 3MRNB 4EDWL 4R3SB 3DSFH 3CVIH 1NCCL 4M6AA 2R1WA 3U1SH 5GIRB 5EDXA 1D5MB 1HYSD 4YGVA 4H26B 5D7KD 3ZYZA 2UZIL 4ZQKB 4WU5A 5FUZL 3GBML 4JDZA 1KGCE 5H8DA 2CRYA 3GIVA 4X6CA 4NQCD 3QO1A 4GAJL 1MUJB 1E4XL 3GSNH 1CLYL 1H5BA 4WGWB 3FOLA 4JY5H 5C6PB 3C08H 1JE6A 1RUKL 4OZHA 1CDUA 1V3JA 4X7SL 3VA2C 3ZDYE 1FORH 3PL6B 3EYSH 2YRZA 3BZEB 2GSIB 5BZWB 3QQ3A 4HAFA 4R4BA 2D7PA 5GPRA 1E27B 2I25N 5HHOB 3RUGA 4RGMC 5IVXA 1UM5H 4PJGB 2EXWC 5D1ZA 4Z18A 2EXWD 1QFWM 4QRRA 4XX1E 1A5FL 1T7ZA 3EO1B 2YKLH 1J5OH 1GCFA 1ZT4A 3JZ7A 43C9A 4EUPB 3L6FB 3JBG7 4LP5A 1A7RL 4DFHA 5ENWA 4Z7QF 1E0OB 3WV0A 3WIIH 3PABB 3VI4E 4JO1L 5BXFA 5F6IB 3MYJA 3LKSB 4QKXB 2P47B 3C8HA 4J8RA 3FRUA 2Z91A 4GLRH 2CQVA 3EOTL 4KHXL 1GGCL 5TDOB 1A7OL 4NO5B 4ODSH 1MREL 3MRMB 2YC1B 3PJSB 3EUUA 3S3PA 4NNXA 3TBWB 3NIDE 2WP3T 4QT5A 4DCQB 3SHSA 3MLTB 2VABA 3MJ7A 2E7LA 3CVHH 3MUY1 4MYWB 4PB0H 4OTXH 1RHFA 5D1ZC 3TFKD 3VFGH 5T1DH 4QRRD 3UTTD 5J6GA 2Q6WA 4NQDE 5BV7C 4M4PA 5IFJA 3GSRA 4K2UH 2E5EA 1MSPA 5C0CB 2GKIA 3OHXB 4NZUL 1RZKL 3DNKA 3LCYA 1CCZA 1S7VB 2VN7A 2Z35A 1VKXA 1YNKH 1NGQH 3QQ4A 4FXKB 3REVB 5DJDA 1N7ML 3MBXH 4JPVH 4AZ8A 4WU7A 1ERNA 3FTGB 4HWBH 2DTML 4XCFH 5GISH 1UFUA 4RZCA 5DWUL 3C6SA 3ALXA 5IKCB 2HVJA 1BFVH 4GJTB 4Y16C 2UYLB 4Y16D 1U3HC 1WLHA 1U3HD 2YD8A 4XVTL 1FE8H 3MCG1 1DQJA 4X5XA 1TZIA 5FYLD 3FB8B 3MRBA 2VDLL 2A9ML 3DBXB 5I74C 2E9WA 4D94A 3CXDH 3BDXA 4W81A 2PTTA 1MWAB 1YEGL 3JWDC 3GSUB 1ZLUH 1F3JB 4WY7L 1MH5A 1ND0A 1S8DB 2BRRL 4IS6B 3QRGL 1ZSDB 3SDDB 4EI5B 3DWTA 3K4DA 3QFJA 3PQYD 1OAKL 5GGSY 4JRWA 3UTPD 1Q9KA 2E7LC 4C4KO 4RA3A 4PRIB 2NW3A 4HAGA 1S7QA 1QZ1A 1T66C 4HUVB 4FNLL 1KJ2L 1T66D 3U7WL 5ACZB 5LAXB 3O2VH 2DLFL 4ZSOE 4NKDA 3BHBA 1NEZA 1FV1A 4XMLH 3CIQA 5JW4R 5ESAA 2B0SL 1CXLA 4APQB 2IADA 4OZIE 5EZLB 2R1YA 4MAYA 3CFCH 3GJFA 3TVMA 3CMGA 4LVHC 3MRHA 2WQ8A 3CUPB 5HHXL 3RWFA 3L5WA 2DI8A 4U1IB 4RFEB 3HC3L 2GY5A 3WFEH 1ED3A 3HAEG 2VLJB 5I1GH 2IFFL 1KENH 4GQ9L 4BZYA 3BRGC 1LMKA 1SM3L 4Z7UF 1ULVA 1HK6A 1AHWA 1XCQB 3D85D 4NFCA 2E27L 5E1AA 5KSBB 2MCPL 3KPPB 4L8BB 2GT9A 5IHBA 5JW3L 3KPQB 4QNPF 5EO0B 1MQ8A 4L4VA 4LDLB 4LCUB 3RNKB 2BNRE 5CILH 4GW1A 2F53A 3BH9A 4XWGL 5GGSB 5I76B 3MRPA 2VH5H 2JIXD 2V5TA 1EAPA 2UZXB 3U9UA 3PV7A 4WI3A 4X4XB 2FO4A 1YQVL 1CDYA 3IJSB 3DVFA 1BF2A 1DUZA 2FBJL 3QEQB 3QYCA 2NY5L 3DMMB 2ATKA 3IKKA 3O9WA 2MFNA 4MAYC 5CSZA 4MAYD 3TVMC 1VFOA 3GUTA 1RIHL 1WV7T 3TVMD 3O45B 3RKDC 3O3BA 1JV5A 2VDNH 3RKDD 2F5BH