3THML

Crystal structure of fas receptor extracellular domain in complex with fab ep6b_b01
Total Genus 45
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
45
sequence length
214
structure length
214
Chain Sequence
QSVLTQPPSVSEAPRQTVTISCSGNSSNIGRYPVNWYQQLPGKAPKLLIYSDNLRFSGVPDRFSGSKSGTTASLAIRDLLSEDEADYYCSTWDDTLEGWVFGGGTKVTVLGQPKAAPSVTLFPPSSEELQANKATLVCLISDFYPGAVTVAWKADSSPVKAGVETTTPSKQSNNKYAASSYLSLTPEQWKSHRSYSCQVTHEGSTVEKTVAPTE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title A series of Fas receptor agonist antibodies that demonstrate an inverse correlation between affinity and potency.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system
molecule keywords Fab EP6b_B01, light chain
total genus 45
structure length 214
sequence length 214
ec nomenclature
pdb deposition date 2011-08-19
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3thmL02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3thmL01
2NY0D 4ZD3L 2A1WL 3U9UA 3RWIB 3U46B 5ISZA 1NCCL 4PJ9D 4KMLB 4X4ZA 1A5FL 3MLTB 1LEKB 5J12C 5EZLB 2VXVL 4HH9B 5TDPB 1KT2A 3BAEH 4FQJH 2R4RL 4FQHB 1PGRB 4JPWL 4MSWB 1DBJL 2NXYC 1MWAB 3ROLB 3ZDYE 3BH8B 3IDJB 3L7FB 3QJFA 3MRRB 2ZOKA 4PJGA 4XNUL 5MEQA 3FT3B 3KYOA 3VH8G 5KTEH 5CEZE 1S7TB 2X4QA 3OB8A 4RZCA 4LPTA 2CO7B 3MACL 3FO2A 2HRLA 2NMSA 3DV4B 1FO0L 4LEXH 4CADA 3QIWB 1IQDB 3HZYB 3QNYB 2FNBA 5J8OA 3GRWA 3O81A 5B3NA 2P49B 1MPAH 2IADA 2Q7YB 3ZSSA 4LCIL 3LKNB 2QQNH 1QACA 2ORBL 3FJTA 2H1PH 5F3BA 1NANH 2AW2A 3CFEB 1AXSA 4KUZL 3KPPB 4Y19B 1SM3H 2W0KA 4APQB 5I1IL 2NZ9C 4NN7C 1GZQA 3MREB 4KAQL 1Q0YH 4N0UE 1MHEB 2VLLA 3SDXB 1MCCA 5E2UL 3Q3GA 4QHMB 5D8JH 3AUVA 1T7YA 5J13C 3GMNB 5BV7C 4F37K 4HCRH 3LQZB 5HDOA 3JWDL 4PUBH 5CZKA 3DTXB 1BOGA 4EI5A 1JHLH 1H5BB 3V6OA 4KU1A 3CSPA 1CIDA 4JZNB 1XEDA 5D1ZB 2EE3A 5M94B 1RURL 4L9DA 3MNZB 4OUUA 3K46A 4JFDA 2HVJA 1EGJH 3S97C 3V9FA 3H7LA 1N2RB 5EH1A 4EI6A 2V2TA 2IG2H 2J8OA 4Y4HD 4WU7A 1PYWA 4HKXA 1NDMB 4ODBD 4XPHL 3BPOC 3EDDA 1NGPL 3SGEI 1B4RA 1AKJD 3BN9D 4HUVA 1OB1A 4RMQA 3OGOE 3L5WB 1RK1B 1CDGA 1OGAB 5CFHA 2N56A 3BZFB 4Y19A 4QLRA 1W0VB 4CJ1A 4Z0XB 1KLUA 1RZJH 2X05A 1U8QA 1AIFA 2CKBB 4OD1L 3MJ8A 3CH8A 1DLFH 2WBKA 4RNRB 3V5DA 4ZSOE 3W9DA 5SWSE 1AP2B 2DQFB 3PWUA 1SYSA 5IKCB 2ENSA 1S7SB 4NRXB 3GHEL 5I16A 4NKIH 5ICZB 3HUJE 1HKFA 2H2PC 1CICB 3JVGA 4NQED 3CFJB 1IL1A 3MRMA 4BYHA 1U8JA 1G7LA 1CGVA 1WIUA 3L3OA 4Z8FL 1F90H 4C58B 1BIIB 1UM4H 3T2OA 4KJWC 2FX9L 3T04D 4B53A 3R0MA 5C07D 1KG0B 5BRZE 4UUJB 3ILPB 1MLCA 4OTXL 4WCYH 1RVFH 4QO1A 2R1YA 5DUML 2W65B 1MCBA 2ZOKB 1GGBH 3UC0H 3MJ9L 2BX5A 4WU5A 1JRHH 2P8LA 2Y7QB 4ZFFA 3P30H 1K4DB 2BCKB 2OJEA 5EZIL 3MRPA 4JPIB 2ZOLA 3L95A 3WS6A 1SJHB 3S5LA 4KMTH 4O2FB 2NY4C 4XP6L 3KLAA 5IVZA 4W4OC 3SKJL 2CR3A 5IW1A 5AZEH 3MRMB 4X6DE 2FR4A 3TIDB 3V8CA 2D03L 2I60H 2H32H 4XCCH 5I16B 2X9YA 3SGKC 5GGRA 2VL5A 3OWEA 4POZC 4PLOB 5IVNA 3S4SA 5JIIA 3VI4F 1F3DH 2ICWA 1DQQB 1IQWH 3EYVA 2VUOA 4LBEA 2X40A 1NEZA 1MHPL 5HJ3B 3CD4A 4I48B 2H3NB 2ITDB 4M6ML 2P5WA 4WHTB 4XH2A 4KGLA 3MOAH 3QNZB 4XGZA 3TWCH 1VPOH 2QTEA 1SYVA 1NSNL 3MNZA 2DRUA 4OUUB 2AEPH 3QIBA 1OSZB 3KHOA 1FL3A 1N2RA 3P4OB 4HJGA 5CBAA 3OQ3B 4ZFOB 3QDGE 1MEXH 5TE7L 2FWOB 4N90E 2VISA 2VITB 5GRYA 1Y0LA 3VRIB 1A6WL 2XY2A 4F7EB 1MI5D 2E9IA 1NEUA 1KEML 2YWYA 3ZDZF 4J7RA 5HD8C 1REIA 3MLXH 5EO0B 3DRTA 3RL2B 4DN4L 3MUJA 1WZKA 3G6DH 3BDXA 1N5AA 4NSKA 3AXLB 1OTSD 2CGRH 1W0VA 1MCWW 3IDGB 1BWWA 4YBHA 1OTTD 1E27B 2QQKL 1FNHA 1MCWM 3SBWA 1DL7L 3MV9B 3GBLA 4YGVA 2AEWA 3QCUL 3QIUB 2BVOB 1AD0A 5J6HB 4XNZC 4QRUA 4MJIE 4MQXC 5EPMA 2APVA 1U92A 1OGTB 1HXYB 5BVPL 3LKQA 1QSFD 1FNAA 2AK1L 3GSXA 5CMAB 4N1EA 3G5ZB 2BZDA 4IRSB 5ICYB 3BSZL 3P0VH 1C5CH 1RIUL 4NPYA 3IDYB 5HYJD 1KJ2L 3VXRD 3JTSB 4NQDA 3TVMB 4P49A 3J7HA 4M7ZC 1S5IL 4BH7B 2DQTL 3F7VA 1OGTA 1N4XH 1Q9WA 2XY1A 3BH8A 1P4BL 3NZHH 1NGPH 1WBYB 1X5IA 4M00A 2EDWA 1L9MA 3DI3B 1F58L 1XH3B 4KRLB 4UV7H 3VGGA 3QI9C 1CBVH 3NZHL 1A6TA 2CUMA 1KJMA 3ARDA 1FE8H 2ZPKH 5I1AA 4MAUL 5J9PB 1L7TH 4LIQE 2DOCA 1GOHA 2G2RB 3TIDA 3FFDB 1HXMA 4Z7WE 3HG1E 3WFHB 5DFVD 4IHOA 4Y5XB 1LO3H 5T1LA 4WI9A 4DJMA 5BV7H 1OAUL 4MB3A 4OZHA 4QCIB 5KSVA 4UOJA 2UVEA 1DUYB 1DQDH 3DURA 3F12A 3F7PC 4GH7B 5HGHA 2OR9L 1S7RB 2OMNA 4NHUB 3UBXI 2Q7NA 4BZ1L 1A4KB 2Q8BL 1T80A 3QIBB 5HYJA 4JR9H 3OAUH 3C6LA 3HLAA 1YJDL 4R4NC 1A5FH 2R1YB 3FO1B 5FO8A 3EYQC 4YQXH 1MLCB 2ADGA 2ORBH 4OQTA 3GM0A 1DN0A 2LQRA 1U95A 4PRHB 2F19L 2LU4A 2IMMA 4WU5B 2NY6C 1KT2B 2C3VA 4OD2B 3ROOB 4PJFF 4U6YB 4AIOA 1NBYA 3L9RB 1NFIA 3RGVD 4HLZG 2A6JA 3WE6B 1FO0H 5CZVH 2A77L 4F15C 1P5UA 3JZ7A 3NFNA 3HZVB 3O4OC 2YPKA 4J3OC 4M03A 4YGAB 4LQ1A 1PEZA 1Q1JH 3RX7A 1P6AB 2BSRB 4HBQA 4FG6D 3MOAL 3TWCL 2CSPA 5A3IC 4TUOB 4Z6AT 1ES0A 5TQ0L 1A1OA 2R0KL 2GJ6B 3BGMA 3WNMA 1UA6L 4PTUA 4Q2ZB 2BY2A 3T2QA 4FQJL 1J12A 4N1HB 3SGDH 5A16B 1AKJB 5KSUA 3QXAA 1T6WA 5HYSG 1UWEL 1MCIA 5AD0A 1DVFC 4PS4L 3O6FD 3QDMB 1Z9SA 3BZFA 3IAGC 3BQUD 1WCBB 4RQQB 4DVRL 2WQRA 5FCUH 5D5MB 1QFWL 1CFBA 3VI3E 1QR1A 2C3HA 5TF1H 4U1HA 3FN9A 3FL7A 4YPJA 4JJ5A 1ZT1B 4LF3B 5IP4A 3PQYD 5HGBA 4MCZA 5HYJE 1CQYA 3IETB 3LEYH 4PRHE 2PTVA 1OWWA 4PJ8C 1ZEAL 3V6ZA 3KYAA 5DHXB 4HWBA 1CT8A 1FNSL 1QRKA 2BSTB 3RNKA 1FFOA 2VLRB 4BZYA 2EEDA 2CXKA 1RZIB 2YD2A 4PGCB 2XQYG 4PLKD 1I9IL 3H9HA 4DAGL 4MJID 4G8GA 2G75B 3IB4A 3UTQA 3GK8H 1FQ9C 1DBML 2CDFB 3MLYH 4S2SA 3ZE1F 1OSPH 1T5WA 1R0AH 2J6EA 1N0XL 3ZTNH 5F9OL 2P8PB 3HE6B 5FV2A 4I0KA 4MWFB 4KKNA 4JG0H 2ZNXA 2B1HL 1AGCA 15C8H 3HG1D 1TZHB 3X13A 1EUUA 5D7IA 3NIFE 4EUPH 2X1XR 3MV8B 4TOYL 3UO1L 2EDXA 2DQHH 2AAVA 3VDAA 2OS7A 1EFQA 4TVPE 4XHJD 2WM0A 2AQ1A 2IADB 3T0DA 4ZTOH 5ITBL 2UZXB 4JAMB 4LPYA 1D5BA 2Z31B 4LRIA 1OAKL 1J0HA 3FAXA 4YXLH 5MEQB 3RPIB 2H3NA 2GFBB 2COQA 4HC1A 3SQBA 1IJ9A 1IGJB 3S96A 3EUUA 2X7LA 3VJ6B 1G6RA 5GSVA 4KJYB 1J1XH 5TF1L 2O5ZH 3W2DH 4FQQA 2DIJA 2KZ1B 1CR9L 4IMLA 1I9RH 2ED8A 2XACC 2R2BB 2PTTB 4F7TA 1AGFA 4PB0H 4H0HB 15C8L 1ZA3A 1WF5A 3VCLA 4XMLH 1H3TA 4OGXL 3FO0L 3NACH 1ZGLA 4NO0D 1A2YB 5DHVH 2YZ8A 2KUTA 4LAJH 2BHZA 1XGPB 1NUNB 2VLJA 3EO0A 4XWOD 4FQXC 1NGXA 1EEYA 4X98A 4JPIA 3FZUD 2IAMD 3ARBD 2CLRA 2IBBA 4QF1A 2V17L 1A6UH 4GAGL 1UM5L 4IIQA 1MOEA 2PW1A 2L4OA 1V3JA 4AQOA 4LLQA 5GZND 2O26U 5B39B 4HK0B 3GSOA 4R90L 4LRIC 1FIGL 2CJUL 1MCPH 1KB9J 4N8VG 3TIEA 4L3AA 1LHZA 2E7HA 1V05A 1HYSC 1ZSDA 4QY8A 4AY0A 3GM8A 5IFHH 4KKCC 4OSUL 1NCAL 5KAQF 3NVQA 3KLHC 2FYYA 2ZSWA 4DGYL 1DJSA 3WE6A 3MRBA 4XPTH 1SY6H 4LLMB 2D4DA 1FH5H 4Q9QH 4TQEH 1G7PA 3WFDH 4XNYH 3KPRD 1HKLH 1VFAA 2NY7H 4X99B 2R56H 5DXWA 3BXNB 1OF2B 2V5MA 1Q94B 2G9HA 3TNNB 3LHPL 3VXNB 5I8EA 2FRGP 4MHHG 4NQVB 5HHOB 3QUYC 1WT5C 2UY6A 3N9GL 2NTFA 2CRYA 3TZVC 2VZUA 2FLRT 2A2QT 3EYFA 3PHOA 4RGNB 1KEGH 4MXVF 1UWGH 2APWA 1S7XA 3EIFA 4GW4B 1WBXA 4YDKH 1SJVA 2EYRB 1A3RL 1NC2B 1BBJA 4Z77A 2W07A 5D4QA 3HE7D 1N8ZA 4U7MA 2DD8L 1HHHB 2X4PB 1YYML 1Z5LB 4NC1E 2NZIA 3ARFA 4P2OB 4M9OA 2DTSA 1UWXK 2XTJE 3VMNA 3F8UB 2VABB 3PGDA 4K94L 3WL9B 3S9DB 1U8OB 3T1FB 3MJ7B 2AABH 4NWTL 1I7ZB 1G7JA 3KS0J 4X9HA 1MAJA 1AHWA 3ZYJA 5EZOL 2IFGA 1B90A 3NCEB 4XCYA 3HI6H 5JMRA 5ISZD 4NT6B 5GSRB 3UTTB 5JHLL 3QR2A 1EMTL 1D5IH 5EU6E 1T1ZB 1S7WA 3MRLA 1T7VA 1U8HA 2DLFH 1U3JA 1CU4H 4X80L 5DC0A 5LBSL 4BSJA 5JIPA 4C83B 4I0PB 4Q6YA 3VXRA 4YDVB 1S3KL 3QUXC 4J2XA 3OKEB 3MV9E 3VMOA 2PW2B 4RFNB 1YA5A 3RGVB 1NC2A 5IW3A 3KPSD 1FPTL 1MRFH 1NFDE 3RA7L 5E95B 2JTDA 3G5XB 3D3VB 4DN4H 2F54B 2YS4A 4R7NB 1J0KA 3X13B 2DYPA 1N4XL 4AT6B 2OX5A 4FOMA 4GKZB 3MBEC 4C4KO 4YEEA 1XGTA 1DSFH 1FZJB 5HHOD 2VZ1A 5T1LD 4O58H 3MSPA 1T03L 2OK0H 1BX2A 3OXSA 1KEGL 5HTSA 5EBLB 4OFPA 5D7LE 1ERNA 1RJYB 3HPLA 1D5BB 2Z31A 4JJ5B 1EVUA 3D85A 3QUYD 3JXAA 4HIHA 4HMCA 1XZ0A 1AQKL 4MHHI 1UM4L 2E6PA 3FKUS 4OCNC 1XF4A 4JZJA 4X9FA 4LSDA 3SEPA 4KROD 1WICA 3QEUA 4HGMA 3HS0B 3MRIB 4PJ5D 4BQCA 4AQ1B 4F3FB 1K5NA 2VL4A 3KPSA 5JW4M 2R4SH 3ARRA 4J6RL 5IMOA 1TTFA 3MLXL 4WTWA 4JO4L 3MC0A 4PGBA 4DGVH 1S7QB 5E5MA 4LOUC 5GGRY 1W8NA 2G75A 2XTLA 4ZTPL 3RUGA 4AK1A 3RVVC 3SKJH 2BY1A 3QRGL 1F8TL 4C55A 1TQBC 1INEL 3MXWH 2HMID 1FL6A 1MFEH 3VFNB 4PJ9B 4CRPA 2XZZA 5DJAB 1XF2A 2CQVA 3WEXA 4OGYL 2NY5L 2YK1H 2JB5H 3VG9B 2AGJH 1T0MA 1MUJA 2XN9B 5ADPL 3WS6C 4OB5L 1N64L 1HINL 3KDMA 5FYLH 4OLVH 1KELL 4Q9BA 3AY4C 1IC5L 3T4YA 4NQEA 4OI7A 1LNUB 2JK5B 1WGOA 2V5TA 5D7SH 5FDWA 4PJHB 1U9KA 5D7JD 4P9HH 3RIFK 5CEYB 3U7YL 5CILL 2CDEB 5D2LE 4EN3C 3FFCB 4HAGA 4RIRA 3MLRL 2LVCA 1OPGL 3RGVC 4R7NA 1ZGLB 3BHBA 3EGSA 1BOYA 4ZNEA 3ECBB 1DR9A 3GSQA 1MWAH 1RZ7L 3GEWB 1QFUL 1F8TH 4FTVB 2CKNA 1VFMA 1Z3GH 5CLTA 1JWMB 3MCLL 1XGPA 4CAGA 2OYPA 3BP6B 2PF6A 3UAJD 1MFAH 3M45A 3OKDB 4AEIH 1YEGH 5FA3A 5SWSB 3WN5C 3RY6C 4U6YA 2H8PB 5B38G 4JPVL 3V0VA 3ARZA 1OARL 1KLUB 4PJDF 1IKNA 2VDPH 4MNQA 3S36L 3CU1A 5ESVA 3VFTA 4KK6D 1EEZA 1EFXA 4XCNB 5GRWA 2XT1B 1CD9B 3H9HB 1HIML 5EBLA 2HTKD 4ODTL 2YUWA 3ZTNL 1IT9H 3MA7A 4YLQT 3L3GA 3VGHA 1I75A 3Q5TA 1AJ7H 1S5HB 3JV0A 4OZIA 4QYOB 3U30B 3MLWL 5C6WH 4FZ8L 4IRZH 3UCRA 2BNUB 5FYKU 1RMFL 5GGVL 3WO4B 1H9VA 4EKXA 3RGVA 5B3JE 2GT9A 4UNTA 5LWYL 4UTAL 1F58H 5J56B 2IF7A 3O6LL 1BFTA 4UQ2B 4HWUA 4G8FB 3X3FH 5ICXA 1TENA 5JW3H 5IQ7H 3LN5A 1HEZB 1XF5B 5D7KE 3T0BA 3PL6B 4WW2A 4U3CA 4GAGH 2X4RB 4TSBH 1KPUB 5BCAA 2BC4B 2P5WD 4K3JH 3UTPE 2BRRL 4MCZB 2BY0A 1ACZA 4HS6A 4LHUG 4XP5H 5D7JC 1MY7A 5DS8A 3OHXB 5DMIH 2R23B 4W70A 3U48A 5C0DB 3QO0B 3NACL 4OLVL 3E2HC 5FYJE 4BFGA 4JY5H 4NQSA 3D85D 3QEQA 2QHLA 4RBPK 5E8EA 2HWZH 3KXFB 1EAPA 4PJBB 4IS6A 5CSGA 2NXZC 4AM0B 3B9AA 3VXUD 3WV0A 4LKCB 4KUZH 4KGJA 4M7KH 4Y4FD 3QNZA 1GGYA 4GG6B 1I8KA 3KYMA 4U6XA 5FECA 2NY2B 5I9QB 5K59F 3KJ4B 5DJXB 2JJSA 5JUEL 3SPVB 4QF1B 2GUOB 3LQAH 4X99A 1TPXC 2A9MH 2VIRB 3D1MC 4WEMB 3H7BA 4Y7MA 3WHE0 1T5XB 3EZJB 4MD5B 2UZYB 3DURB 1QRNA 1SVCP 5IFAL 3P9WB 2BHYA 4Y16B 3BSZH 4L3CA 1XIWB 3JWNC 2ED9A 5D1XA 2BNRB 2X1PA 5T1LB 5CEZL 4O2CA 4QY8B 4UNVA 5IEKA 2GQHA 4XCFL 1N7MH 3QP3A 1KB5H 4JJHA 5DUPH 4KQ3L 2PYEA 1AGEA 4LSUH 5DVLA 2GAZB 4RMUA 3NCJL 1VDGA 3RU8L 1PVHA 5DJ2A 4KROC 4QRRA 3SJVE 4Z7QF 5E6ID 4NUJA 3BAEL 4XB8A 4RMRA 1G6RB 5DFVC 5I74C 1ZLWK 1IAKA 2J2ZA 4HXBL 3GKWH 3NH7L 4ESKA 4NM4L 1T22A 1BQHB 2DTMH 1CLOL 5B39A 4GAYA 3ULVE 4JANA 3QNXB 3CLEL 5HHOE 2FJHA 3BQUB 4JRWA 3BW9A 5J1SC 3OAYH 4G80A 4QRRD 3TO4A 2ITCB 2JIXB 4MGXA 2XQBL 3W9DB 4Y16C 3QUMA 2NW2B 4NJAH 3QWOB 4JRYA 2VLJB 4H5SB 4L4VA 5ALCH 4XPAH 3VFOA 1S5IH 3T0AA 4UILL 1KPUA 3G5YB 4QOKD 4M7LT 1L0YA 1MIEL 4LPWA 3MYJA 3HRZA 3PQYE 5DRXB 4Y5XA 2WWMC 2QHRH 1RJLB 2ADJA 3HAEA 3TM6A 2APTA 2C7UB 4ZPVA 4E0RB 1T1WB 3RUGF 1GZPB 4F9PA 4N8PA 1QKZH 4YHYB 1CXHA 3DRTB 3IS0X 4YO0A 4PD4K 3IVKB 3QHZL 5KSAC 3JVGC 3ILPA 3U1SH 4S0SD 3GSVB 3MZGB 4PY8I 3BMWA 4NN6B 4AM0A 5F1NB 3TN0C 2AJZB 1MY5A 1QSFB 1EHAA 4CL7A 4F9LA 4GW1B 4IDLA 2VE6A 4MNGA 4XCEA 4RX4A 3I6LD 3ESVF 2FX7H 5FV1L 4H25B 5F88A 1P84K 5ANME 4YWGH 2HFEA 3ZE2F 1A6WH 4JRYD 3CDCA 2L7JA 4F7CA 1WK0A 4MJ5B 3D9AL 4HHAB 2P8PA 3CSGA 5LVEA 3WKML 1KFAH 4K9EH 3UPCA 3TO4C 1YECL 4QHUB 2F53E 5E08H 4Y4HC 1TZHA 3FMGH 4WDIA 1INQA 4HQQH 1AXTL 1OGAA 4D9QD 3BDBA 4JGUA 1ZHKB 3Q6FA 3UJJL 5F1IB 1ES0B 1H0DA 2AK4E 3OKNB 1L4IA 3QHZH 1L7IH 3NTCH 4JQXA 2OQJB 3INUH 1CXLA 2AJZA 3CFCH 3PGFL 3BKJH 3O3AA 4CBPA 2OTWB 3HPJA 5F6IB 3DO7A 1NUDA 2DWEB 2V2WA 4WRLA 3S6CA 3P9MB 3A6BL 2WWMD 4Z7UB 5IR1B 3FN0L 3PL6D 5AZ2H 4EI5B 2G60H 1T89C 3DSFH 4JLRB 4YHPB 3CGTA 1MVFA 3FT4B 3GMPB 1YEIH 1MWAA 2BXYA 2WUBH 3QG7H 3ARVA 5DJ6B 5CCKL 4NDMB 4HWNA 4MB5A 3VXSD 1RK0A 5D2NA 4POUB 1GOGA 2ESVB 4HMEA 3IXTB 3BRFA 1MCFA 3DYOA 3QH3A 4RAVA 4O2EB 1QSVA 4BSWB 2HKFH 1KTDA 1CS6A 3C8HA 2QSCH 2FGWL 4JREB 4YBLC 3ZSTA 3QIUD 3QWOA 3F12B 1M7DA 4Y5XC 1I1YB 5IHUL 4HPOH 5F7NC 2HWZL 3WSQL 3AS0A 4MCYA 3FB6A 4KJWD 2FZ3A 1TETH 4PJEB 3P0VL 3DX8B 3RWJB 4LCUB 3V2AR 1LDPL 3HUJF 4XWOC 3QJHB 3QG6A 3ZKXC 2GK0A 2GI7A 1HQ4A 5FUZL 3KR3H 5CSZA 4EN3B 4AEEA 2YKLH 5E70A 1O7VA 4KI5D 3CLFH 2H2PD 4NQCA 1KC5L 5HI4D 3FHQA 5J9PA 1QZ1A 5A40E 2Z93B 4KKBC 1LILA 5I1KH 1LO4L 1EMTH 1C8PA 4LK4A 1Q9KA 3ROOA 4MMZC 4M4PA 2GITA 1JYVA 1X9QA 2R2CA 2CUIA 4DGYH 4NYLB 5TDOA 1UZ6E 4X5WB 2VQTA 3CFJA 1OAXH 4MNQE 2B5IB 2W65A 4YUEL 5HGHB 4NQSB 1QPPA 1KJ3H 3RWFA 1PLGH 1JHTA 5EOQL 3RI5F 3WKMH 1TQBB 5D1ZA 4DZBA 1DUZA 1OAXL 1OTUD 1HQ4B 1T20A 2XPGB 1F11B 2B4CL 5ILTL 4IRJB 3ALWA 3KPLB 5HHQB 4LHUA 4XNQB 4JZOB 1HHIB 4HK3J 1OAZL 2E7LA 2VLRD 5AG8A 2Q8BH 2BVOA 1ETZB 3X17A 4ZAKD 4CNIB 1PFCA 4RFOH 1JNHA 3LHPH 3ZE0F 1G0XA 2X4SA 3ARGB 1KYOK 3PP3H 4WO4B 4PRNB 2AXJA 4LCYA 1SEQH 2F54E 5L9DL 1OB1B 4HJ0C 3B9DA 5BXFB 5IGXH 3LKNA 4QKXB 4N0YH 1FZOA 4NPYB 1KLFA 3PIQB 1CL7L 1AHWC 1YJDC 5DJ6A 2YD6A 3RVTC 3SE9L 5BO1L 2EKSA 1BJMA 1FNLA 1TQCC 5BZWA 3VWKD 2A1WH 2LU3A 1YEGL 2RB8A 3V6FB 4OZGF 2FB4L 1ED3B 1VEMA 4U1MA 3ULVH 3DV4A 2EDKA 3B9EA 5GGUB 3SE3C 3T0EE 2A6DA 1S7WB 1QFUH 4XZUA 3GSNH 5D70H 4MJ6B 4YNYB 1FSKC 2W1NA 3HTLX 4ZS7H 3T3PF 5CHNB 2C1PA 2K7QA 3QUXA 5D71L 4DZ8A 3OJDA 5E2TH 4H26B 4H20H 5IJKA 1I1AA 1JRHL 3BJ91 2R0LH 3V4PL 4NOFA 5A43C 3PWPE 1MNUL 3O6ML 5CKGA 3QPQD 3MRKA 4OF0A 1QEWB 2NW3B 2GJZA 2VSDA 1P7QD 5KN5B 3OR6B 3OKDA 3RPKA 3REVB 3G5VA 5I0ZA 3QDHA 4CADB 4XT1C 1P9MA 5E1HB 1CFSB 1NMCC 3GSWA 4JHZA 3DVFA 3QDGD 1LO0H 1UKTA 4OCYL 3VE0B 2P1YA 2QQLL 5D7JA 4MAYD 4G6KH 1IFHL 4PJXB 2Y6SC 1S5HA 4PB9H 4U6HA 4TTDD 2K3TA 3QA3B 4NFBA 4UB0L 5GGSB 3UP1A 1AXIB 1IGML 4Z5RA 4J8RB 3ULVD 2R2HA 3DGGA 5D1ZC 4YXLL 3UJIH 1CF8L 3EO1B 4XGZB 4B7LA 3QDJA 1EV2E 1X5ZA 1ZEAH 4ODUA 3RRQA 2ITDA 2VOTA 4XCYB 3QYCA 5IJVB 5IV2A 2VZVA 4JHWL 1JF1A 1MELA 4NNXB 4HBCH 4M9PA 1N26A 5H94A 1URLA 2E7LC 4NKMB 1U8OA 2Z8RA 1CD8A 3KPMB 4MAYC 3NCBB 5DD0H 2A0LC 3CCHA 5I1LA 4DVRH 5KJRH 1NFDA 1YUHA 4APQD 1JGLH 3ZTJH 3LPGA 2FATL 3U1SL 1FRGH 2E7BA 3NBNA 1T2JA 2BSED 2DWDB 1N6QL 5DJZA 5C71A 3U4EB 4JB9H 2DLFL 2B8OT 2AI0L 2YEZB 3BMVA 2IH3B 1FJ1A 2P47B 4OF5A 5LXGL 2P8LB 4ZOAA 2LTQB 1V7MH 4YBLB 3G6JA 3M1BA 3DSNA 4GXVH 2DQGL 1FNSH 3PV6A 4AYFA 3O4LD 4X7CC 4KVCL 1UCBL 4QHNB 1IEAB 2R1WA 4HULB 1MVUA 4FRWA 3VXPA 3RVVD 2W60B 5F9WB 5L0QC 3EFFA 4DKFL 2DS4A 1B9ZA 4JM2C 3RJQB 4LAQH 1GHFL 1W8OA 1HHJB 4GRLD 1AP2A 4OQTL 5CP3A 2WINA 1YY9D 3HPLB 3V5KA 2VDRL 4PGDB 1CICA 4NQCE 1SHMA 4YX2L 5BS0D 3MACH 4PREB 3GSOB 2HJFB 1X5JA 4L3ED 4L8SB 3ULVF 3U9PH 4KVNL 2VLKE 3PWLB 3WFBL 2HJLA 5EBGA 3EFDL 1LO4H 3DUSA 3E6FB 3QXWA 5HHMD 4MA1C 4ODTH 1KTDB 4ZSOA 1AQKH 3G6JF 4Z7OE 5IVXB 4QRPB 4MDIA 5IB2A 1GRWA 4XBPB 4M61A 5I1HL 5DUBB 5I66A 3WHE1 2AV7A 1U8IA 3E0GA 1BLNB 3HZKA 1HK6A 1BD2A 2RCSL 5LCVH 2V7NA 3MRDA 4UIMB 2ZUSA 4X9IA 5CSBA 1KTRL 3CJJA 2HJKB 3ZKSD 3BPNB 2VNCA 5EULV 3Q3GB 2R23A 4FXKB 3QHFL 1NBZA 2OQJA 4U2ZA 4EUPA 1FPTH 4LL9A 3DTXA 2ZSVB 3ARED 4GW5A 4JM2A 4XCNA 1ZLWH 1EJ6A 3VFTB 2VLRA 2J6EH 3TBSB 3HC3H 4NFDA 2R0ZH 4NZRL 3V6ZB 4B41A 5IUSA 2OCFD 2X9XA 5DJCB 4YHNA 3UTSE 3BD3A 4EZMA 4LQFL 3MTRA 1F4YL 1VFOA 4HCRL 4CW1B 4P3DB 1NLBH 3C5ZA 3PWVA 3D3VA 2GT9B 1HINH 4U1GB 4Z77B 4W81A 3MUHL 4APQC 3BYYA 2O5YH 5IHUH 2VAJA 5DURB 2NY2C 3DXAE 4G6AC 1KJVB 1AGCB 3RBGA 5T3XE 1YEHL 3DUHA 4A6YB 1NGQL 5GGQH 1I3RA 3O2WH 1BM3L 3IJYB 4TNWF 3OF6D 1A7PL 1C12A 5C09D 1T7XA 3VXTA 3RY5A 3HE7C 2GHWB 3MGOA 3BEWB 5IMLB 5E4IA 2P5EE 2X1QA 3RQ3A 3LAFA 2C3GA 1UM5H 4GT7A 2Y6SD 2DBLH 3CLEH 3TN0B 3P4MA 1FC1A 3RBSA 3VD7A 2VKWA 3BWUC 4UT7L 1HHJA 1A22B 1IGFH 2D0FA 4M7JH 4AJ0A 2AK1H 4N9GA 1YPZB 5DUMH 2GY5A 3S88L 4GOSA 5MERA 3PL6C 4HDIA 5KSAB 4IBLT 4JKWA 5IG7A 2Y4SA 4ENED 1X5KA 2XWJB 1MQKL 4WI7A 5HHPB 4LGPB 3WFBH 4D3CL 4N8VA 5KZCB 3W9EB 4QXGL 2DM3A 1AI1H 2I07B 1J0IA 3EJZC 4RGMC 3RNQB 3QUMB 2RIKA 5J0BA 1MAMH 2CMRL 4JDVA 4MDIB 4L4VE 4N8CH 5D2NE 5IVXA 3N85H 4MAYB 5LAXB 4OQTH 3QUKB 3GJFH 1HSBA 5I30L 5JPNB 5GISL 4XMPH 4GUPA 2DBLL 2DMKA 3VFUA 3I6GB 3SGKA 1INDL 3F65A 1Q9OB 5I76B 2PR4H 2X9WA 1D5ZA 1KTLA 2YA2A 4HDIB 2KDGA 1MRCL 1H3PH 2BNQE 2ZCHH 4QRRB 2ATPB 1QYGL 3T0VA 1HILA 4ZDHA 1CN4A 2OI9C 4HJ0D 1MCRA 3THML 5EOTA 1MVUB 3HI5H 3DX6A 3NN8A 4J8RA 1MCDA 4FXLA 1RURH 2EIDA 2FJGB 4MQ7A 4N0UA 1VKXB 1IC4H 2EDRA 5EOCJ 3LEVH 3HMXL 2HH0L 1MJ7H 4LQFH 2F53A 3T2NH 3RUGB 2Y72A 1HQRA 2CKBL 4J4PD 4ODWA 5T1DH 5KG9A 5C0RL 4XBGA 3VXSA 3D39A 2AJUL 4Z7VB 1KCVL 2HFGH 5CD5D 2PYFB 5TFSH 4HPYH 1U8PA 3SKMA 3U6RB 3D2UB 5KSVB 3EYOA 4LKCA 5ILTH 3PWPA 4NJAL 2VXSH 3SBWC 2Q6WB 1YMHB 3ISWA 3NA9L 3I75B 3ARXA 4R4BA 3VFSA 3ULVL 3O3BA 1D7FA 5EU7E 1PSKL 4XNXL 3W81A 1NBVL 1CE6A 4O00A 5BQ7A 3Q48A 1CCZA 1CE1H 4OV5B 2CIKA 2Z4QB 3MJ9H 4PJBF 4I18A 5EWIL 3D85B 1DBBL 1NKOA 5JHDB 1MJ8L 2C1PB 1MCKA 1GYAA 2AQ3A 1BAFH 1AD9A 4EUPB 5MP6L 5L9DH 1GOFA 1AHWB 3CZJA 5H35B 1G6RL 3AM8C 4PR5B 4HW6A 4M6NH 5IHZA 4TNWK 4EUPG 5T3ZD 1MQKH 1JGDA 1EDQA 3WL9A 3TVMA 1FVDB 4KQ3H 1IGCH 4NJ9L 3TCLA 3GHBL 1KCLA 3DHMA 4G9DB 3VXUB 4OD1H 3KYNA 1YN6A 3BZDA 1NMBL 3QIUC 1YEDA 3ZHKA 1FIEA 3QFJB 4NNYA 4X6EA 2YD7A 1KIRB 4ONOA 3QDMA 4TUKL 4YHLL 1JUFA 1S7VB 4K3DH 3STLB 2WBJA 4X6FB 4PJ8D 5DJ8B 3MUZ1 5GS3A 1R24A 2EIBA 4L8CA 3HA0A 4OD3L 4L3EB 2GJ6E 3ZKND 4KDTA 2UWEE 5GS0H 2PXYA 5GJTL 3SDAA 5IIEB 1I1AB 4GG8A 4OJFL 5TE4H 1Q94A 1WZ1H 3H8NA 3O8XA 4MVBC 5IROC 5T1MA 4XBEL 4LSPL 4GBXD 1XGYH 1WV7T 1OGAD 5C9JA 1OWRM 3DX7B 3K80A 1LE5A 5CD5C 1B3JA 4LEXL 2NXZD 3HR6A 1J5OH 1YEEH 3RWGB 4LSSL 5GHWL 3BEVB 5T3XH 5EUKA 3VXMA 3CFCL 3PGFH 5BV7L 2KBGA 5IT2H 4OZGB 4ODSL 4LIQH 1DCLA 4PV9A 3MBEB 3ESUF 2L7UA 5KVEL 5FM5M 5EZOH 3L7EB 2IBGA 5JA9A 3D5OF 4OV6F 4UUJA 3ECBA 1T6VN 4LSTH 4N68A 4XBGB 2QBWA 2EDBA 4ODWB 2X4SB 2DLGA 5IW6B 5IMOB 3MRGA 4K3EH 4KHXL 1ZGLP 3QDME 2DD8H 1UZ8A 5AWNH 4F3FA 4PJEA 5SWQB 2Q20A 4UZGA 3UBXG 2UWEB 1VCAA 2B1AH 1Z3GL 1NCUA 3IKKA 5ENWA 4WEBH 5H2BB 1FZMA 5IBUG 1T2XA 4QWWC 5TQ2H 2DL2A 35C8L 2I9LB 4KK8D 5ESQA 4R3SB 1IVLA 2DAVA 3DPBA 3HNSL 3KLSA 3O8XC 3FCTA 4KQ4L 2L0DA 4CN6A 3PXHA 5E5UB 5FM4A 1QFWM 4PG2C 4ODUB 1BP3B 4WTXA 4JN2A 5IMKB 4BQ8A 4Z95H 1YEKH 3VFNA 4RDQF 3ZYIA 1B4JH 1H5BC 1QVOB 5D7LD 3IFLL 1DE4A 3LOWA 3FB8B 4ZUUA 5FO8B 4AT6A 4C56D 3SCMA 4KK6C 3DO7B 2IH1A 3STLA 5GS2D 5HI5D 1FN4B 2QSCL 4IRSA 3FRPG 3PNWB 3LEXB 4X7EC 1NGXB 4O02L 4QRPE 5E9DA 1MFEL 3ARGC 4LP5A 4MMXC 2BJMH 5I1GL 1Z6JT 1QOKA 3ARDB 4KTYA 3KPSE 2XA3A 5DT1H 2IQ9H 1HXMB 3HE6A 4ZNCD 2F8VA 4C83A 4TULH 4P5TC 4WGVB 3CC5A 4P99A 5LGHH 4WENB 1BZQK 4NQXB 3KS0H 5EFIA 5T1DL 3CSYB 2AJXL 4D9RE 3GJFB 3HC4L 4I0PC 3CFKB 5IWLC 4WI5A 4NM4H 4Y19D 3EO1A 3SDYH 5KS9B 4BKLA 1MFDH 1BGXH 3LRGA 1UQSA 4NN6C 5DVKA 3C5SA 3TBSA 2CIKB 3W5MA 3QQ9C 5EBMB 3VFVA 5C7XL 2BXZA 4ZFOA 2JCCE 1FCGA 3IETA 1OW0A 5MHSE 3ILQC 2PO6B 1V7NL 4U1IA 4LLWB 1IAMA 2O5ZL 1R3LB 3EDEA 3UROR 1QR1B 1OVZA 1AD0B 4U1NA 1G0YR 1YN6B 2AABL 4MNHA 3AREC 1HH9B 2EH7L 1T03H 3EYVB 4JFQB 1EA9C 3HFMH 5F1IA 1Z0MA 3NIGE 1OAKH 3MRKB 1YNTB 4NRYB 4MWFA 2R1XA 2VXQL 3HRZB 5JUEH 3S8WA 1ZHLA 5FOBA 1T5WB 1WFTA 4JRYE 4FS0A 1F4HA 4NBXB 1S9WB 4OZ4B 3ULSB 1UWGL 2IEPA 4M8QA 1J1PL 4FNLL 3QIWC 1TLKA 2YPKB 2GCYA 1LE9B 2J3SA 4JFFA 1AFVL 1DLHA 4JY5L 1EAJA 5E8DL 2HN7A 5MENE 1N7ML 3IDIA 4FXGA 4KRNA 2VUYA 2NXYB 1KB9K 3WIIL 1G84A 1KTLB 2VB5A 3VFWB 2EDDA 1RHHB 1DQTA 2Y7QA 1RV6X 3WFCL 3M17A 5LGHL 1IAKB 1GAFL 3CH1A 5DQ9A 1MCOL 4OKVB 2E9WA 1NCAH 4HG4J 3QJFB 4PJ7E 5A2FA 1Q9LB 5F7WC 4P2OC 1A9EB 1SJEA 1CLZL 5F89A 2IBZX 3IDNA 4J4PA 4XP9H 5TE4L 5TDPA 1I7RA 2ZCLH 3RKDD 3DXAA 5J3HC 3BD4A 3PWLA 4L4TB 4FFYL 4S1SL 5FB8B 4PJ5B 4WW1B 2FB4H 3R4DA 2VLKB 3BWAB 1FZKB 3QUYA 4NGHH 4P59H 2K7PA 4U33A 5I1LB 4MD5A 4H5SA 5CD3B 4R4FH 1UH3A 5TF0A 4ZXBA 5KVEH 3BGAA 4RGMB 2HFTA 3MO1B 4G7VH 4Y4HB 4FZ8H 4IRZL 4HAFA 1S9XA 4GFTB 4YC2C 1PEWA 3LS4H 1CGUA 3GBNH 3EO9H 2I26N 4RA3A 5EG6C 2HTKC 3OR7B 1A6TB 4GSDL 4HT1L 1UA6H 3TT1L 3O3UN 4X6CF 3BPNC 5JIKA 2R56L 5BS0A 5C1MB 2R4RH 2HT2D 4TSBL 4P9MH 1MF2H 1G7LB 2KKQA 2FDBP 4J3UA 5MP6H 1NL0H 3GO1H 3C6LD 4OGZA 3T0XA 4AMKH 1RZJL 3UX9B 1JMXA 5DJ2B 1KG0A 2BOBB 2B1AL 1X7QA 5DJ0B 4Q97A 4LLAA 4HQQL 3VWJD 3LSOB 1XIWC 4PJ7B 1MHCB 2EXWC 3MO1A 1RJZA 5ISZE 3GMOA 3FO9B 3TBVA 1NUGA 3RWJA 5DMKB 3PP4L 5K9QI 1K8IA 4X0KB 4ZO9A 3TZVA 4K2UL 2VLJE 1YNLH 4OIIL 1UVQB 4JKPH 4FQ1L 1NFDB 1TFHA 1YUHB 1ZHKA 3N0PB 4PRID 4M1GH 2R1XB 5CJ8A 4EN3D 3DRQA 1ZA3B 4NRYA 5CZXC 4YZFF 1INQB 1M05A 1BBDL 2DQJL 1VB9A 4YXHH 1YC8A 3SPVA 3AXLA 3CU7A 5AUMA 4DUXA 3WS3B 5F7EH 2V2TB 4R0LB 1MREH 1G9NL 3ARFC 3MZTA 5DSCA 2CLZA 4I5BB 4A6YH 3TPUA 3W0WD 2JF1A 5D7LB 3VH8B 3T1WA 3GMLA 4G7YH 3VFRA 1KUMA 4JLRA 4YHPA 1FRGL 4NCC2 5GIRB 3BUTA 2VLKD 4FXGB 1KPRA 4AIZB 5IESH 3GSUB 2FO4B 4NQDB 5I74B 5EIVA 4D9LH 2DWEA 2V2WB 4GMTL 4MVBD 2IANB 4LLWA 2HKFL 5IQ7L 1QBBA 3AVEA 1OD7A 1R3JB 1A0QH 3WHXA 2Z31C 1RIVH 3V4VL 3A0OA 2ZCLL 5C0AE 4ZS7L 4AZ8A 1QUNA 4LBEB 3NFSH 4BH8A 3NPSC 5A2IH 2OMBA 1ITBB 3I02B 4YHNB 1GZQB 3MREA 2Z31D 4Q2ZA 3FONA 3QCVH 4J23A 1SY6A 3OKLB 2NLJA 3WXWL 3WO4C 5LJYH 3O4LB 4J6RH 4V1DB 4X4YB 2DTML 1GGCL 1AXSB 2FBJH 2EC8A 1J18A 4L4VB 2LABA 5I9QC 3IFPB 1BFOA 5I2IA 3ET9F 5KVGH 4E5XA 4L9LB 3V79C 3QI9B 3IU3A 3LRSA 3R8BB 3K2UL 1FV1B 3CFBB 3GJFK 2I27N 1S8DB 3GIVB 3NCJH 3RU8H 1W72A 4O2FA 4I2XE 4UI2A 2XN9E 5DD0L 2WANA 1WC7B 2DKMA 4YXHL 4NYLA 5TDOB 1BD2B 5BS0B 4U1HB 2YHGA 3FTGA 3RL1A 2NX5E 3EDKA 4FQHA 5B39G 1NEZG 3QXVA 4G8IA 1I9IH 2I9TA 2HRPL 2Z8WC 2B4CH 2CLVA 4JM4H 1PSKH 4XNXH 4K9EL 4L29A 5HHMB 1NEZB 3GMQA 1CFTA 1FL5B 1N3NB 5CGMA 1A6AB 4JFHD 4BZ2H 1CZ8L 3BP4B 4JM4L 4OZFH 3T3PE 3OJ2C 3FQTB 3WNPA 4WO4C 4YIQB 2B20A 1XIWD 1KN2H 5TFSL 4UOW0 1EHLL 4U1KB 3F7RA 4OCRL 4X0KA 3O6KL 3UTSB 4WJ5B 2VLKA 1G7HA 2W9EH 3QUXD 3V7AE 2P44B 1WIOA 5BO1H 4L9LA 5F9DC 3E8UH 1IEHA 1MF2L 4XHJC 4ZXBB 2G2RA 3ARPA 4GLRI 5SWZB 1J87A 1ZHNB 3QWQB 4MCYB 5HBBA 1SMOA 1PZ5B 3I84A 5F3HB 4L29B 1SJHA 3S5LB 4WFHE 3H9SA 4HX1B 3GK8L 2NPLX 2B0SH 3VXPB 4LPCA 5FGBC 1U3HB 1TZGL 1EXUB 4GLRH 3EOYG 1RUQL 3WXWH 2AEQL 4HKBB 1QA9B 4OBRA 4NZUL 3D0LB 4PLKC 5CWSB 3X12A 1NAMA 1BFVH 2PXYD 4NZTL 4H1LB 4XBEH 3DUUB 3GSRA 4DTGL 5ITFA 2E7CA 5JHDE 2G5BA 1MI5A 2EXYC 2R39A 2FEDC 4W6XB 2LV4A 1F4XH 1QFOA 1NC4A 1OQOA 3IDYC 3NAAL 5F7LB 5F8RC 3BH9A 4ZPTB 1K3IA 5JW4Q 4TUKH 5IEHA 4M62L 1PQZA 3NZ8A 4GQ9L 3WN5B 5DK2A 1UH4A 3BI9X 3E3QC 4L8CB 3O41A 1I4FA 1ACYH 3WFZA 2IPKB 3QH3B 4AL8H 5F7YC 4RGOH 1G9NH 3PDGA 5DC9B 5L8JB 3DRQB 5D2NB 4J3TA 3T3ME 4F7CB 5M95B 1K5NB 2J6EL 3CXDL 1SEBB 3L5HA 3MV7B 1F02I 1A4JA 3BUYB 4FG6C 1Q0XL 1QSEB 5K9JL 2B5IC 2EDOA 1ZT4A 1J05B 5CZVL 5SV3A 4AIZA 2Q86B 5GIRA 1CD1A 3VE0A 1LMKA 4UT6H 3B5HA 5BZWB 1UCTA 5CBEB 1KBGL 2EO1A 5DHVA 2ZUVA 4ZUWB 2GCYB 3TVMC 1AD9B 5KZCD 3LMJL 3GSUA 3QZWB 4JFYB 4KDVA 4F57H 4AIXA 1EFXB 1IGTB 4OCMC 5D2LF 4KRMB 3CSYA 3RVWD 2OL3L 3UTTE 2QADB 5FUCE 4LSTL 2WIMA 1EH9A 3VWJC 2QJDA 3U0TB 1BFVL 2OXHA 2PTUA 5KS9A 4K8RC 2B2XH 1P4IL 1IBGH 3SDDD 1UADC 1FHGA 2JJVA 3EOTH 4RWYH 3PV7A 1FFQA 4PTTB 5BVJA 3QQ3A 3A6BH 3TZVB 3TN0D 5KOMC 5HYFA 2VN7A 4H26A 3U7WH 5F7DA 3QUXB 2VDQL 3F6IA 5KSAD 2BVQB 4TQEL 4CU6A 4I8DA 3HR5A 2C5DC 4Y4KD 1ZVYA 4MXQD 5DO2D 1A7QL 2FATH 4WW1A 3U82B 3H3PH 4FFVD 1U8PB 3AU1B 3KPOB 4XCCL 1Q8MA 4FQCL 3BIAX 5E6YA 4JRXD 4C59B 5ACLA 1JWSB 2FL5B 1SYVB 1WAAF 2IQ9L 3H6JA 3LKPB 4KZDH 4JY4A 4OKVA 4G8GE 4P4KC 5EC2A 3KJ6H 4EBQL 1I7ZA 5J13B 5LQBL 4CGTA 3O3BB 1U8JB 4HS3A 5H8DA 1YPZF 2HG5B 1IFHH 1RSFA 5JW5A 4PJ9A 2B0SL 3RDTA 3U0PA 4KRPB 3MRFB 4P46A 5M7QA 1CGTA 3ULUE 3CVHL 4FMFA 4OGXH 4KTEH 4M8QB 4MZ3A 3K8MA 4KTDH 4LCWD 4X4MA 3WLWC 5IW6A 2VDLL 5DMJB 4AL8L 5DVOA 4OQ1A 3C8DA 2I24N 1YMMA 3BW9B 3PHQA 5C6TH 1S9VA 2NY1D 3S36H 1QBLL 1M6OA 1ZVSA 5K9QG 2F53B 1R0AL 1RK1A 4N1CA 3OMZA 4RFNC 4HKZA 4P2RA 1DBAH 3SQOL 1KGCE 1UWXH 35C8H 5EZJA 5SX5H 4N0CD 2GITB 5CGTA 3T08A 4TTGA 1CFVH 2JIXD 4CVXA 3DHJA 4R7DB 3ETBF 3V5HA 4CU7A 3VGEA 2GAZA 2E9JA 1QLFB 5B38B 3IU3B 3DX7A 3LRSB 4LVEA 3L3OB 2XWBA 3HE7B 5AAWA 3GGWB 4PRPD 1IL1B 5T3XD 1QHPA 3MCKB 4UTBL 4DKEH 4O2CB 1YPZA 3VFVB 3FOMB 4PJFA 1AO7A 1PDKA 2XYCA 3LQZA 4FQCH 3C09C 3QXTA 2DQHL 4YC2B 2Z91A 4GMTH 4X6CE 3VW3L 3SE9H 2HT3C 1DEDA 3NH7H 1G7IA 5KW9L 5ELIA 1FBIL 5HHVH 2HH0H 1WBZB 1RZ8B 1WAAA 2ESVE 3B6SB 1HNFA 3R8QA 5KW9H 2ZUYA 3MLYL 1TCRB 3HE6C 2JJWA 1RZGB 2A38A 3ZDXE 1YEEL 3KPOA 3D0VB 3H9ZA 4LDEB 4X7DC 1GXEA 4DVBB 1Y6MR 2R29H 2MKWA 3BGFB 1U6AL 5DDHB 32C2B 2P8MA 1EAPB 4R26H 3ZL4H 5FYLE 1I8LC 3AAZB 3WDHA 1NCBH 3L3JA 2DM7A 3QFJD 1QFWI 5FKAA 1N5YH 5I1GH 1A7BA 2NXZB 3ULVC 2PR4L 5EU3A 3KYKH 1FFPB 1A0QL 3O2VH 3TBTB 2J88L 4BKLB 2P24A 4D0DB 3W11D 2PCPA 2YRZA 3NCCB 4KROB 3B8YA 5LGKA 3EOAB 3CFKA 4K3EL 4PYHA 3T77B 1P7KB 3IDJA 3L7FA 4K3DL 4PLNC 4UBDD 4ONFL 1XR8A 1CT8B 2JCCA 2CMRH 3KWWA 5HI5C 1XGTB 2X10A 5CJXA 1AI1L 3QZWA 4JFYA 1T21A 2H32B 3I85A 4OM1H 3ARFB 5FA3B 5K33A 1JZ2A 2VDLH 2VZTA 4JAMA 3GNML 4A2LA 4OV5A 3TLRA 1XGUB 3SGEH 3SHSA 1WUNT 1RUAL 1CQKA 5FKAB 2FSEB 25C8H 2YC1A 3JWDH 4MA1B 1OAUH 4Z9KB 5F93C 1LO5B 1YMHA 4I13B 3EO9L 5H37G 1BF2A 1I8IA 4QHKJ 1FN4A 1J5OL 4P3DA 4JG1L 2OR8A 4O5LL 3OKEA 3G08B 3WSQH 4I3SH 3IDMB 5MEND 3D18B 2ZUTA 4MAUH 4W6YB 1GGTA 5FEBA 1KIUA 2JELL 1BZ9A 1QFPA 3LQAL 4PV8A 4QRPA 5E9DE 4QNPE 4LLYB 1I4FB 3QCTL 5C08A 2RAMA 4NHCH 1IAOA 4WWKB 4DKAA 1OOAA 3BN9C 2YXFA 1KTKE 2PYED 2W92A 3ES6B 5B38A 3QPXH 2Z91B 3T2PA 4MNQB 5MENA 4NZUH 3HUJA 2B39A 3MUGB 4I18C 4BZ1H 5H2BA 2AJUH 1IILE 4Z7UF 5EIIB 4P2OA 1CDUA 1DQLH 2XNAA 2F54D 4TNVK 3FCTB 4P5TB 5E8PA 4X5XA 1CGSH 3P0YH 3RVXD 3SE8L 1QRNB 4MQTB 1P7QB 1II4E 4HWZB 4XPGL 4RRPA 1I7RB 1MCHA 3WUWA 2IJ0C 4Z7VA 4UINL 2IFFL 2GUOA 2VQUA 4AEFA 5SWQA 1GC1L 2AJ3B 2FEEI 1EGJA 2H9GA 3H9SB 3PUCA 5CS7A 1Z2KA 4HIXL 2VZSA 4UTBH 3DMMA 3U0WH 1YMMB 5D93C 1KB5A 4NHCL 2BOCA 1V3LA 5DZNA 2VERN 5EOCL 3FQUA 1E6OH 1JPTL 3TCXA 4NKMA 4R9HA 3RWGA 4YUEH 3HFML 5B8CB 4JPKH 3RHWK 3F5WB 3C09B 3IRPX 1JF5A 4OI8A 4LKXA 3TEUA 1RZJC 3O3DB 1F4WL 3D39D 2H32A 2R8SL 4PJ8B 2ADIA 2QQLH 4G6ML 3WEXB 4Z5RB 3SJVB 7FABL 1JCKA 1Q9OA 2AJYL 5FKPA 5DJYB 4FZEL 2CKBH 3EJZD 4TYUA 4KI5C 1FG2A 3FO1A 5F96H 1E6JL 2MFNA 3QULB 2EKJA 1QBMH 5B21A 3LKPA 1DL7H 1U8MB 3GKZA 4Z76A 4TVSa 4Z0BL 4GXUN 5SV4A 1BVKB 5F9OH 1IAIM 1U58B 1T83A 1F3JA 2M2DA 3NABL 4XAKE 4X6EB 5BRZA 4XNZB 5DZOA 3G6DL 3BPLC 4LLVB 4ZFZA 3O2DH 2DQIL 4OCSL 2JB5L 2P8MB 4HUXB 5J4MA 4M5YL 3PWJA 3W11C 4JN1H 4TSCH 5MERB 3K4ZA 5TDNB 4KRPC 1MRDH 2DQTH 2X42A 4P4RA 5DK0A 5KN5A 2X6MA 4Z78B 1UQSB 1J8HD 4QTHB 3O41B 2Y23A 4H0IA 3UXFA 3DSFL 3W5NA 3U7YH 3G6AA 1M4KA 4NQEE 5MEPA 3E2HB 5HDBE 5DVNA 3WDIA 3VRIA 1C16B 1PW3A 1UACL 5IGXL 2AXHA 2NX5A 3F58L 3DNKA 4C57C 5D7JB 1KXVC 3GGWA 2P24B 4D0DA 1Y6KR 3L5XH 4KJPD 3SN6N 2P5WE 1WEJH 3QRFM 4YHOH 5TGBB 2OTUB 1N6UA 4EOWL 3E8UL 5ADPH 3V5HB 4CU8A 1J1PH 2RR3A 1KB5L 2EYRA 2XQYK 1PAMA 4PJAA 3PG2A 1NMCB 1IGIL 2BOCB 2X4PA 3MXVH 1PKOA 1WJ3A 2MQ3A 4QOKA 2AV7B 4PJIA 2R15A 1NPUA 4XTRD 3FT2B 3VXMD 4Y8AA 3VXSB 5JPMB 4I77H 1ZHNA 3QIBD 1EIBA 3SKOB 3JWDC 4X7TB 3AS2A 4CJ0A 5HGAA 5C8JA 3ARBA 2HLAB 4KY1H 3LKSB 4Y1AE 1MRFL 4PGEA 4G42B 1D6VH 1U41A 1ZK9A 2PN5A 1E28B 3T1FA 1LO2L 1A7RL 3CNKA 4KZEL 4UMGA 3A6CH 3DYPA 3W39B 1GH7A 3MUGA 3TIEB 3MRNA 2XWTB 1OCWL 4Q58C 2X4NB 5DJDA 12E8L 3MLZH 5T5FH 5TJWK 2FX8H 3WLWD 4RSVA 4HKZB 4R7DA 3BP6A 1HKLL 1K2DB 2HLFC 1RZFH 1XCQA 2H26B 5E2UH 4PBVC 4P46C 4N0RA 1JWSA 5AD0B 1KNOA 5D2LB 1ZA6B 5DURD 5JLZB 5D71H 3PHSA 2CIIB 3DUSB 3L7EA 4NCC1 5C0CA 1UYWH 2OL3A 3OKKB 1FVCB 4PY7B 1CBVL 4WJ5A 4R8WL 3FB6B 4FFYH 1IAIL 4PV9B 3P9LB 4PYGA 3WXVL 1RIVL 3OKYA 3VGAB 2GK0B 4YR6B 3D87B 4PBXA 1FAIH 1FLTX 1A2YA 4HIHB 4IJ3C 3D25A 3NABH 3ARBC 3P4MB 2OI9B 5FYJD 4BELD 1ND0A 2W59A 4UAOB 3DXAB 4KHTL 5DLML 1U91B 5CUSH 1A3LH 5DMYA 2ZKHH 5HDLA 4ZO7A 4WFHD 1A7OL 5E8OA 3EZ8A 4NCDA 4WW2F 3BDYL 1RAMA 4WTZA 2GTZB 4J12A 3QFDA 5BS0E 4U4BA 4NN5C 5T5NF 4WWKA 1IBGL 5ECJE 3X14A 4WY7L 3QO1A 1CICC 2M1KA 5HHME 1CFSA 4NN7B 4I0CC 4XVJH 5GGSA 4GBXA 1B6DA 2IMNA 2ZUXA 5D9SA 1J1XL 2FO4A 2UWEF 1BOGB 1DBBH 5FCSH 4ZUSA 3TC9A 1VSCA 3HC0A 2FD6H 4BA8A 4F57L 1K9TA 1ODAA 5J1AA 2NY3B 1E6OL 2EDLA 3PWVB 5I8OH 3F7YA 4ZODA 3MRIA 4IMKC 2IALA 1FNFA 5GS0D 2IAND 3QXDA 4G6JH 1ADQL 2V5YA 1MFCL 5LGJA 5DRNA 2HP4A 5JHDD 5HPMA 1YJDH 2XA8H 3BPOB 4CW1A 2IAMA 2AVGA 1ZHLB 4G6KL 1CDIA 3RL2A 2V17H 3ZHDA 3FONB 3E6FA 2JB6A 5GSVB 3Q1SH 1VPOL 5EO0A 4PP1D 3QB7C 4PGCA 2AKRB 1D9KD 4KWUA 1P2CA 3ZLQC 2D7TH 3BP7B 4EI5D 4LASH 4PJDA 1H3UA 4PJIE 4W6WB 2IANA 4OT1L 3QNYA 3HZYA 2VDML 2O61A 1RULH 5JW4R 4JDZB 1XGQB 4OI9A 4B0MM 1N64H 4D0CA 1I3GH 2JKXA 4ZUWA 2FH6A 2KQNA 3NGBC 3C60C 3O3AB 4YHYC 1X4XA 5CBEA 3EYOB 2D7QA 4NGHL 2QSTA 4XH2B 4JFFE 1I1FA 4I48A 5F6IC 2O61B 1UXWA 3G5VB 4MLIA 1WZ1L 5K9KB 1RUPL 4Q0XH 5E2VL 1CXEA 32C2A 4GRLC 1M05B 4KUCD 5TH2B 3Q5OA 1P4BH 2Y07L 1NGZB 1M6OB 1ZVSB 3NIFF 1MCEA 4RGNC 4BJLA 3MLTA 5HHNA 3BGMB 2EXYD 5IEHB 4Z7WB 1HHIA 2EH8H 5CIPH 3AC0A 2ZUUA 1S9XB 4JREC 3JWOH 1VFAB 3MMEA 3N85L 1T0PB 3SY0A 4ZXBD 3EHBD 5IESL 1XMWA 4XZUB 3TO4B 3QUYB 4NBYB 1ADQA 1B88A 1W0WA 3VRLF 1YDPA 2W9DH 1C08B 2BVEA 1QBAA 2EE9A 4YIQA 1F90L 1ZLSH 4GS7C 2BVTA 5FM5O 4Z95L 1HIMH 3DXAD 1RZKL 3ARUA 1D5ZB 3OKOA 1IC7H 4PRDA 2W9DL 3TA3C 2W9EL 2A83A 5I1DA 2APBA 4EI5C 4PP1C 4G3YH 2R0LL 4KDWA 1DZBA 3MXWL 4BQ9A 1JGVH 5DR5H 1DEEB 2J88H 3B9KA 5FUOL 2DLTA 5DF0A 1ORQB 1TIUA 3IDIB 4AH2B 1CGXA 4G9FD 4WNQA 4G6JL 2NCMA 3BPCB 5F7FA 2VL5B 4Y1AA 1DVFB 3TP4A 1FLRH 5GS0C 5DR5L 1KENH 2F19H 4UB0H 2XWJA 5C70A 2ZCKL 2FX7L 4P2QE 4ZTOL 4RFEB 4WVRA 1CD0A 4DEPB 3C6SA 5JXEA 5GPRA 4HWBH 2DLIA 3D3VE 4U3XA 4L8SC 4S1DD 2HKHH 5KSBA 2UWEA 4HKJA 2J1KA 3H3PL 3E3QE 3NPZB 1A6ZA 4LVHC 4PJ5A 2BHUA 3GJEA 3T65B 2HVKB 3T0WA 3WFHA 2YMXH 3DVNB 3P4LA 1DEEA 1XF3A 1MH5B 2W0FA 4G8EA 1C5BH 5HI4C 1J1OL 3RWDB 1CFTB 1FL5A 4MX7B 1RPQA 3GFUA 3CZFA 5IF0A 1I1FB 5F7EL 4PJXA 4U6HB 5T3ZE 3JWOL 2WLZA 2I9TB 3K1DA 4O58L 3O3EB 1J0ZA 3LZFH 2A74A 5HYJB 2J8HA 3FRUA 1DQJB 2XWTA 1NC2D 1NAMH 2FGWH 3WNKA 1U8LB 1H3PL 2P7TA 1FAIL 4FQ1H 2ZUQB 5ANMB 1HXYA 3IYLW 4K2UH 4JN1L 4TSCL 2H1PL 3D69A 3TESA 5FO9A 5J6HA 3GI8H 5ICYA 3G6AB 4LMQI 5E00A 3MRHB 1M1SA 1CDCA 4KPHH 4YFEA 5J12B 2C4XA 3A6OA 1CLOH 4UT6L 3GIZH 3I02A 2R4SL 1KCUH 3T8XB 2BFVL 4H0GA 5JNYA 2MSPA 5HPMB 5TE6L 4LPUA 3FN0H 1HNGA 1MSPA 3EYSL 1QFHA 3IDUA 1F4YH 3QXDB 4F15B 4UQ2A 3LN4B 3GBML 1C7SA 5C0JB 1UJ3A 4MQXD 4DWHA 1PBYA 5I71C 2VE6B 4XCEB 2NYYD 2WZPD 2NY6B 3UTSD 1LDPH 2F5AH 3N1GC 1OSZA 4M5ZL 3WJJC 4Q9QL 5EBMA 2EZ0C 4JDTH 3VFRB 4PJCA 4LP4A 5TGBA 4KI5E 3KAAA 4GRWB 2G5BB 2VISB 5DS8B 2GTWA 1NCCH 4XP4L 1JFQH 5DSCB 5D5MA 2MKLC 4JQVC 1WSST 4G5ZH 2Q8AH 4RQQA 3JUZA 4PJHE 2BC4A 5L8LB 5GRUL 5ESVB 3QIBC 4KXZH 5D7LA 3VH8A 3MV7A 3G6JE 4LRNL 4R90H 4XP1L 2VDKL 2RCSH 1EO8H 1W72H 3OSKA 3HAEB 3RA7H 1VEOA 3HI1A 3K7UA 4PJIF 4Q9RH 2BNQA 5FFLA 2FEEL 1T1XB 5C3TA 1JYNA 4J1UA 3LZFL 1JPGA 5SWZA 3L3HB 1TPXB 5F72S 2WBJC 1V7NH 2FHCA 2B4CC 2RBLA 2NW2A 3WIHL 3WJLA 3MV7D 2W91A 3KJ4C 4JFZL 3MYZA 4PUBL 3SDAC 1B2WH 3U7WL 4ZFOL 4ELMF 1G1CA 4QYOA 3HRPA 12E8H 1FSKB 4AENA 2FR4B 1RUMH 3CMGA 2PYFA 4OFIA 5L7XH 4MA7L 3R06A 3RWHA 1ZA6A 4FQLH 5EO1B 1DUZB 1I8MA 3O4OB 1DQJA 1LVEA 1SBBA 3DECA 4M02A 5MI0C 3CFIC 5IBLD 2EDJA 4K7PL 43C9B 3HAEH 2ESVA 3LRHA 4GQPH 3EDJA 2ZG2A 4OJFH 1WZLA 3ZT7A 4RWHA 3QCTH 3VRLE 3CSBA 3S4SG 3MLUL 2VWEE 1AKJA 1AC6A 5ALBL 1NC4D 3RZWA 4O51B 5E0QA 5EIIA 1ZHBA 3KPRA 4S10A 2PNDA 5C08D 4ELMA 2OLDA 1AO7E 4UOW1 4QRPD 1E28A 4JRXE 4KH2A 2FZ3B 5IFJB 5DEGB 2HFFA 4Y2DC 5FIEA 5AZ2L 4UV4H 2ATPA 3N50A 4YXKL 1E4XI 4JVUA 3ARDC 3VFPB 3CXDH 5IQ9A 3N1PC 4TVPL 1H3GA 1MFBL 5JXED 5IVZB 3DMMB 4FQIL 2P4AB 1E4JA 3KYMB 4U6XB 1FAKT 3OKLA 5JPNA 3MRGB 3MV11 2AJ3A 1PG7H 1QKZL 3UDWC 1WQVT 3ZT6A 1N0XH 5INCB 3U30C 2VDNH 3VWKA 4HKXB 1L6ZA 1H3WM 3OB0K 2AQ2A 2Y5TA 1Q9WB 4PRBB 1ONQB 2J8UB 3KVQA 3HC4H 4U0QB 4LEOB 3RY6A 2BVPB 2MHAA 1ZS8B 4WEBL 2WBWB 3LB6D 1CZ8H 4DN3H 4HIEB 3OKOB 4LHQB 1HWGB 4LVNC 2F5BH 3B4NA 1K4CA 1JZ8A 2D4FA 1JPTH 1KGCD 1NBQA 5IEKB 4F33A 2PO6D 5KAQG 4XP6H 3P9MA 4Z7UA 3O8XB 1C08A 2BNRA 5MENB 1AR1D 2RQ8A 1R3KA 1H8OA 1S8DA 5IKCA 1JV5B 2DIBA 5IIEA 2EE6A 3GSVA 2YXMA 1M7XA 2N4IA 2BSSB 1GIGL 4DKDC 3QUZC 1GGBL 3AS1A 3UC0L 5C07E 3ILQD 3BE1L 2MQ0A 3LV3B 5CLWA 2VN4A 3MRQB 4ZUVA 4U1NB 3AAZA 1NCNA 2A6DB 4LCCB 1HCVA 2VITA 3VFOB 3G9VA 2YC1B 3TJEH 4ORZC 4I0PA 1EHLH 5BJTB 5CEXA 2GY7B 4K94C 3VXUA 1OAZH 2PW2A 2J8UE 4Q9RL 4ACPA 2H6PA 1EERB 4EVNB 3QIWA 1RZKC 4OZIB 2IQAB 3L1OH 5E2VH 3NCMA 4ZAKB 1NCDH 2FLBT 4WI2A 5DZLA 5I30H 1EJOL 4GG6F 9CGTA 4PJ8A 4PP2A 3IVKA 4CNIA 4PJGB 2J5LB 4OCLC 1NMBH 4PIRF 1UWEH 1QSFE 4AMKL 1TTUA 5C6TL 2BVUA 1I9EA 2QKIA 4JDTL 2UZIH 5MEOB 4WY7H 5ESQB 3MOBH 4JO3L 3BKYL 4I3RH 1JHKL 2CK0L 1IT9L 3ELAT 3U2SB 3VXUE 4U1LA 1YMMD 4E42B 5DC4B 4S1QH 1WFUA 2HTLD 2GSGA 4KKAC 4RX4D 2NXYD 3KPRE 4OLXL 2FWOA 5JR1H 2ZKHL 4L4TA 4XP5L 3O2DA 5C09E 3P4OA 3K8LA 4NM8H 3VFGH 4BFIA 5IB4B 4M1GL 3LEXA 5BW7A 2OK0L 5LG1A 3PHQB 2NY4B 1MCQA 2JCCF 3BXNA 2VLJD 4ZSOB 1MFCH 1HH6B 3GSNA 1I8KB 3CK0H 5HHOA 1A14L 3WUWG 1YZZA 1KJ3L 4LCWA 4K07A 2Z92A 3L3DB 4L8BB 4U7SA 3KPQB 4P2OD 5B22A 3VXQB 3R1GL 3MRNB 3BFOA 3K4AA 4Q74A 3CK0L 1CLZH 1PY9A 4JFOA 1BJ1H 1B0GA 2ED7A 1BQUA 2DQEH 3T0EC 1OM3L 4Y4FC 2YD1A 1I7TB 3LPFA 1UZ8B 1S9YA 3RI5K 5L7XL 3STBA 2P42B 1T0MB 4OLUL 3G04B 1V5JA 3MMEB 3KPNA 4NO5A 3H2WA 3C5ZC 4LSQH 5KSBE 3EDFA 2FX8L 4Y1AD 1FYTB 1IC5H 3GB7A 5L2KA 2RFXA 5FGSA 4S11A 5HHVL 1DBJH 3FFCA 3BKCL 5IHLB 5HYSB 5DGRA 4HUVB 3W9EA 1X6NA 2V9TA 4PJHA 4NDMA 2XZQH 3QEHA 2IH3A 4JHBA 1D6VL 4JDVB 5EDXA 1JPSL 3RNQA 1Q38A 4KY1L 3H9YA 4XP1H 1T7ZA 4C56B 1R3HB 4X4XB 4M48L 4HUWA 4BK4A 4PTTA 5BVJB 4PRDB 4M1DL 4DK6A 5D6CA 5FHBH 2RHEA 5DJCA 3BEVA 2FCBA 3VFMB 5AG9A 3GMRA 1F97A 3CVIL 3OAUL 2YA0A 1CDBA 4N0CC 1P5VA 2VWEC 1S9KC 5IJVA 4UDUB 1PKQE 4N8CL 2HLAA 2DF3A 5F7UA 5CILH 5JO5B 3ULSA 4M6MH 3QQ9D 2NY1C 4YK4B 5K9OA 4Z78A 1IGJA 4Z0XA 3IGAB 1JHKH 5CINL 3ZDXF 3PQYA 1EEYB 1G7MA 1WCQA 4MD0A 3DVGA 1IC4L 1P1ZB 4OFYD 5FYJH 3G08A 5ERWA 5HGDA 4G7VL 4OZFG 4AG4L 1JUFB 1S7VA 4JFHE 1PYWB 2GSIB 3V6BR 3D0VA 1LK2B 4JZJB 3QI9D 1BZ7B 1G7MB 4UV7L 3FO2B 2NR6D 2DLHA 3IFOB 1BVKA 4R2GC 4R2GD 3MBED 1T1ZA 4P4KD 4GW5B 1UCBH 3LDBC 1CK0L 2NX5B 4KV5E 2P5EB 1IGIH 3LH2L 5DRZA 4ZQKA 5E8NB 3SGJA 4ETQB 5B4MC 1LEIB 2HJFA 4LU5H 3ULUF 5BQ7B 4PJDB 3SJVA 2VLLB 1P2CB 2G60L 5JO5A 4QRSB 2IGFL 3DLQR 3QEGL 4JY6B 4UU9B 3I75A 5JHDA 5J57B 1K4CB 1CDYA 1VHPA 1LEKA 5JXAH 3VRJB 3GRWH 5DK0B 4HGKC 5HHXH 3RWIA 1NLBL 5FAAA 2EYSB 5DHYB 4PJCE 1ZT1A 4LF3A 3QAZC 5DD6B 2OJZL 2R69H 4JO1H 4KTEL 3THMH 3SCMC 4EDXA 2DJUA 4GRMB 5C0GB 1JGEA 3IJSA 4X6DF 4P9HC 1BBJB 4CVZA 3VXRB 3HC0B 1MQ8A 2NTFB 2FECL 5SWZD 4HH8A 3UPRB 3BYTA 2XA8L 4ODXA 2XI9A 1IZJA 1VGEL 1XAUA 3VXNA 2C3WA 5J1TC 1FLRL 1IZKA 1KFAL 1WBZA 3BIKB 4QOKE 3K3QA 3DX6B 2HMIC 3M8OH 4XVTL 2CDEA 3SO3C 3QAZB 4HC1L 4ELKB 5CEYA 1P53A 3TVMD 1NCTA 1ZANL 4ELME 4PJAF 5C0IB 2BDNL 3U0WL 1KCSL 3CVHB 1QLRB 3PGDB 4KV5F 4K8RH 1QBLH 5FGRA 1IEAA 2R1WB 3KGRA 4QXTB 3AM8A 1I7TA 1JGUH 1F45A 4H1LA 1B0GB 4X7TA 1ZSDB 4YDJB 5GGTA 4ODSH 5D96C 4EEEA 1G9ML 5FUZH 3FTGB 5IOPA 2UUDH 3FQRB 3HNTH 5JXEC 1MJUH 3C8KB 3O9WC 4HK0A 3HKFA 1IGFL 4KHTH 2IPUK 3T0ED 1QPXA 4EXKA 3V4PH 3ARDD 3BRGC 3LKRB 5I1IH 2DICA 2EH8L 2AJSL 1P4IH 4Y5YA 4RRPG 4QCIA 1HI6B 5IHBA 3VD5A 1JK8B 3KJ6L 4H1LG 4IS6B 4KKCD 4U1LB 5E1AB 2AK4A 2NY4D 3CCHB 2BVQA 3GI8L 5E8EB 1MCPL 3QUMH 4PJ7F 3FFDA 1IM9D 5C6PB 1P69B 3O2WL 5JOFA 2X4UA 4DW2H 4G9DA 5FGBA 4PFEA 5EZIH 4ZS6D 2FEDD 1YQVH 4OZHB 4PLJD 3AB0B 1XGRB 5GZNC 4B5EA 2BK8A 8FABB 4D94A 1PD6A 5SX4I 1DFBL 1RFDL 4AEHL 2WUBL 2AJVH 2IPTL 1GAFH 5D5ME 2VH5H 4V2CB 3E6HA 4XPGH 1NLDL 1QBML 1G9MH 3N9GH 4G8FA 1MREL 2GTWB 3D48R 1BQHG 4HIJA 5D8JL 1WWCA 1R5VB 5FO7A 1U3YA 5DRWA 1AFVH 1LP9F 3F6LA 1IKFL 4O9HL 3Q1SL 4M6NL 4OF8A 4MJIA 3W82A 5JW4N 2LTQC 1T4KA 2OM5A 3FN3A 5C86A 1A6VH 5DWUL 5T1KA 1J11A 4LCCA 1IEBB 3IAQA 1TJGL 2BFVH 4EDXB 1UT9A 4PJAB 1JL8A 1LK2A 1EK3A 1LWRA 2C4FU 3JV4A 3TV3H 5I8OL 4HC1H 3DV6B 2AERT 5AUMB 3L1OL 1MFAL 3M8OL 4YHLH 3MRLB 1JNHB 5FUOH 1Q72H 1D5MA 5KANG 4Q7DA 1EEZB 3GI9H 4NQVA 3HN3A 2F5AL 4M5ZH 4FFZL 4P9ML 5DMGD 4Z7VF 1A1MA 1LQSR 1N5AB 4LSVL 5E8NA 2DI8A 3MCG1 1LEGB 3T0EB 1A3QA 4F33B 1TZGH 4P9HL 5C0FB 3GUTB 1DP0A 3HNVH 3SGDI 1CGSL 2KL6A 1H8NA 4K23L 3K2MC 4I9WD 1R3HA 5GRXG 1FC2D 3VWJA 1CFNA 1NKRA 5GRJH 1ROWA 1CLYL 3I9GL 5CWSA 3X12B 2IPTH 3MGTB 3QSKB 4K7PY 1HCFX 2V7NB 4IRSC 3HZKB 1JK8A 3PWPB 3HG1B 3QPXL 2DKSA 1OAYH 2ICWB 3ZO0A 4NIKB 4I5BA 4JRXB 3KLHD 4DFHA 4TULL 3MRQA 4TSAH 3PABA 4ZUVB 5HYEA 2ARJQ 3DVGB 5D72L 4OLZL 2EC9U 4G9FB 3SKUD 4OD3H 1U58A 1YQ2A 2CDFA 5E24E 4HEME 2K1MA 1U2CA 3VXSE 1NGWB 4KXZI 3RAJH 1OPGH 4HWZA 4HLJA 2MCG1 5L6YL 1TVBA 1S9YB 2X70A 4TPRH 2R29L 3VXME 3O2DL 3BWAA 4OCSH 1V7ML 1AE6H 3BH9B 1DN2A 4NO5B 3FB5A 5CKAA 1M7DB 2IAMC 3OL2A 1C1EH 2DI7A 2IBZY 1A47A 3KPMA 4PG9B 4E41E 4FQXD 5BVPH 3GDBA 3MFFB 5FYJL 2R2BA 1QLFA 3VXOB 4P4KA 3A67L 2V7HA 4D8PA 3AGVA 4M7ZB 2CK0H 4GKSA 4CVXB 3BZ4A 3H0TA 1WCBA 3V0WL 4DK3A 2VDPL 43C9A 3O45A 2ARWA 3W2DL 5JMOC 2R2EB 4Z7NE 4PJ9C 2D31B 2DM4A 2CRZA 2AXGA 1BZ9B 2A0LD 2ADGB 4JM2F 2ZCHL 4UV4L 4YXKH 2UV3A 1KYOJ 4FQ2L 1ZANH 3G6JB 2AS5M 5IR1A 5F71A 5HY9A 1NCDL 1NMAH 1NANI 4I77L 4IIQB 2GIYA 3KXFD 2A73A 5EA0H 2GSGB 5E4EB 2XKSA 5E99H 2VXSL 4M1DH 2Y07H 4ZOBA 5D70L 5L88L 2HRPH 4JKMA 3GMMB 4NQDD 5F1KC 3HZVA 3CX5J 4PB9L 4XPHH 4JQIL 3UJTH 1CLCA 2FD6L 5HHPA 4X4YA 1J7VR 5EO9A 1AGDA 5D7IB 3EYQD 1U36A 2VDNL 5FB8A 5I1EL 3HI1B 4JVWA 1QR4A 1BVLA 3L6FB 3BP4A 4CUCA 5CP7A 5A2JH 3KPQA 4ZFFB 1I8LA 2YPLB 1KJMB 4K71C 1PKQA 2Y9RT 3LQAC 1TTGA 3C2AL 4X6CA 4NUGH 4PP2B 1EX0A 1KIPB 3S3JA 2VXUL 2FBJL 3S3PA 1F42A 1YPZE 5I15L 3WIHH 1PG7X 4OZIE 3S36X 4FFWC 4ZAKA 4QRRE 3OTTA 2YK1L 3KXFE 3R06B 4NZDA 1ED3A 1I3RB 3LD8B 1CFNB 3R0NA 3LKOB 1N6VA 4EBQH 1QSEA 3P11H 1DLHB 5E5RB 2EIZB 4ERSL 3Q6GL 2OTWA 5CJXC 4IEFB 2BJML 2QSQA 2F8XC 4RA0C 1ZAGA 3B9VA 3D39E 4ZTPH 5J3HD 1AIFB 3LMJH 4XX1G 1YEHH 3HMXA 4HZLB 4UQ3A 3TBWB 1B0WA 3O4LA 3REWA 3I2CL 1RMFH 4DZ8B 4YQXL 1D5MB 5FYJU 2M26A 1G7IB 3JV5A 5D7IE 1CLYH 3NA4A 5DD3L 1UVQA 4JG1H 4O5LH 1WBYA 1UM6L 2D3VA 3C60D 1DVFD 4LHUB 4XNQA 2DYPD 4HV8A 1JN6A 4M6OL 4YFLF 2VDQH 5DMKA 2BSRA 1IQDA 1RD6A 4OLXH 3LKOA 3HNVL 3INUL 4HJGB 3PXJA 5F9AC 1OCWH 2HFEB 4HWEH 3FQXA 4ONHB 1AY1H 4XCFH 3HC3L 1FFPA 3QEQE 5IROA 5EU3B 3O3EA 5EC1B 5I73C 2BVPA 2MHAB 3EJJX 1D3CA 1JTTA 4LEOA 4H8WC 3L3JB 4XPFL 4WFED 2D7PA 2GJ6D 4YX2H 1OTTC 1DE4B 3LPWA 5KVMC 1YNLL 2X5PA 2YD8A 2YD5A 3GIZL 1DSFL 2OXGA 2BNQD 3PIQA 1ADQH 3B3IA 3QDGB 4OLWL 4Z18A 4HIJB 4JCMA 2VXQH 5HD8D 2DI9A 3NCFB 1QNZL 3MV9A 5GRUH 4ODVH 3EOBA 5I8CA 4DKFH 1BM3H 3VXRE 5EO9B 5ID0A 4R8WH 4U2YA 3T8XA 2W9LA 5KSBB 1P6FA 5TPWL 1H15B 5EZLA 1JRHI 1N59A 3MLSL 2LAGB 1WFOA 4Y4KC 5DEGA 3G5YA 5DQDH 2DBJA 2XG4A 3S37X 2CUHA 4ELMB 4MLSA 3VFPA 1T20B 3H7BB 2FGZA 4KKBD 5DMIL 4K7PX 3C9NB 4XNYL 3CX2A 5HHXL 4KI1A 5CP3H 1FG9C 4L3EE 3B43A 4LCWB 2J7LA 3LKRA 1CGYA 2VRAA 5KVDH 3QCUH 4NQTA 2AJVL 4K8RD 1FFNA 1RIHH 3D0LA 2CDGA 3DMMD 1HH6A 3C5JB 4MX7A 4F9LC 3VW3H 3SDCC 2ICEB 3VWKB 2R2EA 4UDTB 3O45B 5IMKA 2ZP0T 4EQ3A 3MBXH 2BDNH 4M4RA 1BEYH 3FMGL 4DGIH 4NUJB 4GKSB 2FHFA 5C2BH 1S9VB 3BESR 5I1DB 1KEMH 5ISZB 5E99L 3OHXA 1KBGH 5GGVH 3U46A 3BZEA 3RWCB 2J4WL 2XTJC 3ARGD 4ALAL 1F2XK 4Y4HA 1NAKL 4HXAL 5FK9B 4LCUA 4P23C 1H0DB 1S7UB 5JIHA 4RCAA 5MEOA 2QR0A 3U79A 5I15H 3I6KA 4U1KA 1J1OH 25C8L 1FORH 2C26A 3FB7B 4XC1H 2UVFA 5T5FL 4WNQB 5FYKL 2HLFD 1NGWA 4GG6A 4I4WA 1DANT 1SVZA 3MV01 1E27A 5GRVK 4JQXC 4Z7WA 4KVNH 2AEIT 1IQWL 5FECB 3QFJA 4IOIB 4FZEH 4XI5C 3UJJH 3JTSA 1O5DT 1KV3A 4NKOA 1K85A 5FGCB 5DQJB 4M7JL 1TJIL 4JQIH 3UJTL 1JE6A 2QL1A 3L3IB 4G6FD 1EPFA 3KLDA 3VD9A 3K0WA 5EN2A 1JZ4A 3BT2L 3FB5B 1ZT4B 3D9AH 3TO4D 3HPJB 4XPAL 4DOHE 1X5YA 5MEPB 1SYSB 1CL7I 2EDFA 3LEYL 1HZHH 3OV6A 3VDBA 4YO0B 2A6KB 5EUOF 1F6FB 1OHQA 2N1KA 4HIXH 3RVTD 4LVHB 3U4BH 1XCTB 2YPLD 4M7LL 2UY7A 4UQ3B 3SDXA 2XZQL 5C08E 3TBWA 4DCQA 2X89D 3UO1H 1TZIB 4HUUB 4I4WB 4YAQA 4YBQC 3NZ8B 4UINH 1VESA 3BP5B 5AYUH 1PQZB 2V5RA 3K74B 1L0XA 2BVYA 1GGUA 2FX9H 4LGSB 5F88B 4QHUA 3SDDB 4ZPTA 2Z0BA 4KJPC 1BZ7A 5CBAB 5HGBB 2GSIA 4MJ6A 3VD4A 1NUFA 4POZD 4YHML 4KDTC 4OLYH 4QXUH 4F7EA 7FABH 4OGYH 4LU5L 4D0CB 1JHTB 4ZFGL 3N1MC 3P77A 3CVIH 3QDJD 2MWCA 1ZTXL 4D9QE 4UDTA 1UJ3B 1R5VA 4NNPH 5FO7B 1CF8H 2ATKA 2ICEA 2CH8A 1INDH 3I3DA 5D1QC 1J9CT 5D72H 1TJHL 3X3GL 3SE3A 5A2LH 4DGVL 1PKQB 2J12B 4Z7NF 1VFBA 1HILB 2Y1VA 3WIFB 1PZ5A 5FA4B 2QR0B 2XN9A 2O5XH 2YOCA 1YEJH 3IFNH 4I2XA 1DTUA 4ZPVB 4N0YL 4YZFE 4XVJL 5C0NC 3S4SB 5FK9A 2B7DT 1EGJL 4Z0BH 1SEQL 1IC7L 2F15A 4HJJL 4Z8FH 1JNLH 3ZE0E 3QUZA 1HI6A 3GHBH 1RU9L 1AY1L 4LVOC 1OP5H 3UBXA 1IAII 5E6IC 1F11A 3QQ4B 4GKNA 4FTVA 2AK4B 3VMPA 3S37L 5T3XL 3RTQC 5F7MC 2HYMA 4O2EA 4OLUH 1HHGA 1X5HA 5FF6B 1Z9LA 4HXAH 4ONFH 3SOBH 5DI8B 1RQ5A 2RFXB 4YPGA 2D31A 2XG5A 4IOFC 2P48B 4JFPA 3RZCB 1U91A 2NY0C 3R1GH 1FFNB 3NA9H 2HVKA 3CVHA 2HVJB 5DJAA 1XF2B 4WUKH 1TNMA 4G42A 1NCBL 1MUJB 1H5BA 1T5XA 4K3HA 4D9LL 5JQ6H 1BFOB 5I2IB 2IFFH 3OXSB 3I9GH 4LLYA 1XIWA 3MFGB 3MNVA 2YA1A 4Y5YB 3EOBB 5I8CB 1FO0B 4JFED 1KOAA 4QNPF 1CU4L 3KR3L 4X80H 5C0BE 3ARFD 5B3JF 1VEPA 1NGYA 4S1QL 4QGYA 1U42A 5DLMH 3NTCL 4X6FA 3MR9A 3ULUL 2R0ZL 5GS2H 5DFTA 5DGQA 5EU6D 2YWZA 4PB0L 1JWUB 4JKLA 3QEUB 1GGIH 3IXTA 4BUHA 4OM1L 1HH9A 4BH7A 1FVEA 1YMME 4F7PB 4PJIB 4WI4A 4QOKB 5KANI 4OCRH 1UEYA 3IJSB 2A83B 1JPST 1XZ0B 4PJCF 3QO0A 1R3LA 1KCSH 4WUKL 2J5LC 5T33L 5E08L 4JGJA 2NY1B 1INEH 5CJQH 1LEGA 1TJHH 4WI8A 1IM9A 5EU5B 3QT2A 2XKNA 4N0FA 1IGMH 1EHXA 5C9JB 4ELKA 2CLZB 4YGVB 2PCPB 4JO4H 1D9KB 3LS5L 3TBTA 4C4KT 3S96B 1MJUL 3GMNA 1KCVH 1ZWIB 3N06B 3MOQA 4RAUB 2MJWA 4OLYL 4QXUL 5IVXF 4HG4K 4PJ5E 1FYTD 5C0RH 4GKZA 1X5LA 4XC3H 3BRDA 1NGZA 4XI5D 4HH9A 3S3SA 4R96A 3MRDB 5D7SL 3OX8A 1FCCA 4FQXA 3ALXA 5C0BB 1J88A 3U7AA 1YN7A 3DV6A 5KVGL 1QQDB 3TBVB 2FIRT 4JO2L 1MI5E 5IB2B 4YHZH 3F7YB 3QBTB 4MA8H 1JI1A 2JE8A 3UTZB 4MJ2A 4DKEL 5D7IF 1HHKA 2J4WH 4QRSA 3FB8A 4ZUUB 4Y16D 1HOCB 1G7QB 1C16A 3HB3D 3GSNL 4S2SB 3HCVA 5HVHB 2W38A 3UTTA 2EIEA 1CI5A 4OCWL 4F58L 5BV7B 2F58H 2AEQH 2FECI 3W0WB 4FXKA 1I1AD 2Z4QA 3OKMA 5FKPB 2NY2D 4YJZL 2PYEB 5EU6B 4Y8DC 3U9UB 5KBNC 4AG4H 4IDJL 4GRLA 2H8PA 2CXGA 1S3KH 3OAYK 1A8JH