1H3VA

Crystal structure of the human igg1 fc-fragment,glycoform (g2f)2,sg p212121
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
207
structure length
207
Chain Sequence
PSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPQVKFNWYVDGVQVHNAKTKPREQQYNSTYRVVSVLTVLHQNWLDGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSREEMTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords IG GAMMA-1 CHAIN C REGION
publication title Structural Analysis of Human Igg-Fc Glycoforms Reveals a Correlation between Glycosylation and Structural Integrity
pubmed doi rcsb
molecule tags Immune system
total genus 29
structure length 207
sequence length 207
chains with identical sequence B
ec nomenclature
pdb deposition date 2002-09-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1h3vA02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1h3vA01
2A38A 3QUMH 3QUYD 1ADQL 2GFBB 3FFCE 3RDTA 2W0FA 3O3DA 1UB6B 4JB9H 3CFEA 5EC1A 3G6JF 1V7NL 4PJAF 3QXUA 4J8RB 3VCLB 1NC2B 4R96B 3EYFA 2H6PB 2DTMH 3B43A 2I60H 5J1AB 3GSNB 1KB5A 3B9KD 1HQRB 1UXWA 5EU4A 4GS7B 4ODWB 1EJ6A 1P7QB 2AJVL 1M05B 3U30B 1WFNA 1DBBH 5CWSA 4MB5A 5LWYL 2AKRA 2D4FA 2MOVA 4JO4L 5MERB 3WHE0 4ZPTA 3BZ4A 1RZ7L 4U1MB 3DV4A 1II4E 2O5YL 2X89A 3LHPL 4OCWH 5LGJA 4M02A 2VLLA 5SX4I 4OM0L 4YFLF 3SOBL 4GG8B 4J3UA 1R3IH 2BMKB 4LAJH 4HPOH 5D7SL 4Z5RA 4L4TE 5I8KL 2B4CH 3FOMB 3SDDB 1VACA 4MNQA 4XTRD 5A2FA 4JKLA 4JFFD 1FQ9C 3BPLB 5GS3A 4JHAL 4ONHA 1RUKH 2FIKA 3MRBB 1FYTB 3DRQB 1JTTA 5T1DL 4LVNB 1BFVH 1YEGL 1OTTD 3QQ9D 4K2UL 4ONFH 3WE6A 4E41B 1F4XH 4P2QA 1B0RA 4JFPA 5I8CA 1MHPH 4IOFD 1QA9B 4Z7VB 3LKNB 3WHXB 1P69B 5ICZA 4K94C 2W65A 1FL6A 5JXEA 1A02N 1RVFL 1A3RL 5C71A 5DD0H 4YHZL 3GMOA 2MMXA 3CFBB 3QO1B 2EH8H 4NZUL 1T7XA 3QDMD 3SDCB 2KUTA 1FIGL 3OF6D 4TUOB 4XXCC 4XPAH 4FQCH 5ESVA 1H0DB 2DWEB 3FQTA 1FFRA 1YDPB 3NFSH 5CSGA 4M6NL 4WFFD 3NN8A 2VR5A 3N1PC 4LSDA 3IU4H 1FIEA 3TBSB 3CFJA 1IGJB 2EDJA 1KB9J 5DHYB 4CVXA 1AQKL 3S7GA 5HD8D 4HWNA 5AD0A 4U2YA 1DQML 3RUGE 2MNUA 4HWUA 2EO1A 1P4LB 4NQSB 2FB4H 3GRWH 3MMEB 4QTIH 5D1ZB 5AUMB 1CGVA 1T20B 4F57L 5E2UH 2BVQB 1HXMB 5FYKE 4NKMB 4MAYD 5DK0B 5GJTL 3ZDYF 1F11B 4NWUL 4QKXB 1RHHB 2BHYA 2BVPB 4Z8FH 1FE8H 4KZDH 5T3ZD 5FK9A 1GZQB 3RGVD 5K9JL 1F3JA 4I4WB 1J0ZA 1JRHL 3RWJA 5KVFL 1A6TB 1U8MB 2EIEA 5KVEH 1A8JH 5KSBB 3MLWL 3SBWC 5CJQL 4PJCB 3KJ6H 4G9DA 4ZUVA 4ZOAA 1W72B 5IW6A 2FEDC 3KPSD 4HD9A 4NQXB 5C09A 1I7RA 3PGDA 2LFGA 4LVHC 3L3OA 1PD6A 3CX5K 2EE3A 2YC1B 4OFPA 4OLVL 1DQLL 4U1HA 3U4EB 5D1QD 1U8NB 3AM8C 1S9VA 3BQUD 3DX7A 1OPGL 4JRXA 2DAVA 3O3AA 3SGDI 3FB7A 1JPFA 1X44A 5JO5A 5IB2A 3LZFL 3SKMA 3OAYK 2XKNB 1EH9A 4YXLH 4X6BA 1RUQL 2X4OA 4RRPG 4H25B 4KMTL 3WDIA 1K85A 4FG6D 5HYJB 4K7FA 4I2XB 1NQBA 7FABH 4PGBA 4QRTB 4ORGA 1OSZA 1YNTB 1TNNA 5HDBE 2DKUA 2X1QA 1AHWB 3L3KA 2ERJB 5FHBL 3M1BB 4X4YA 2I9LB 3MRKB 1ULVA 2P4AB 1RULH 5CILH 4HUWB 3TA3C 3HRPA 3QG6A 1HHGA 2LU7A 4CN4A 1HHJB 5HI4D 1Q0YH 3WN5C 1A6WL 2OZ4A 3KPSA 1DBAL 3CUPA 3EOAB 5AG9A 1A3QA 4K8RD 1IKFH 4Y5XC 5M95B 1BZ9A 1QR4A 2A1WH 5DD6B 5C0GA 5EA0H 5JW4Q 1OD7A 5FA4A 2QSTA 1KIPA 1G1CA 1A1NA 3WLBA 4LSQL 2ITDA 1FBIH 3RVXD 5IP4A 5D1QA 3QUXD 4ZD3H 1FV1B 4H0GA 4JKPL 4ZO7A 2ORBL 1I1FA 5J89A 5H2BB 5FF6A 5J6HB 4EN3C 2UV3A 4WEUD 4LU5L 3BO8B 3GK8H 4FA8A 1EAPB 4PRPE 4MXWH 3OB8A 4HUMB 2F19H 3QXWA 1IC5L 5EOCH 4YDKL 1U3HB 3K8KA 2A6JB 2F54E 4AH2B 2DBJA 4YHKH 4YQXH 4FS0A 4D94A 3QEUA 2MQ0A 5DXWA 5HVHB 1QEWB 3MV9D 3TYFB 1PLGH 3BKYH 4OCLC 3WUZA 3P11L 4X6CE 4XC3H 5T3XL 1G7LA 2HN7B 4NPYB 4XNXL 3I3BA 2HLFC 3MLXH 3MZGB 1MUJA 1GPOL 1XF4A 1S7XB 4JN1H 4G7VH 5E2TL 3OPZH 5IVOA 3U1SL 1SEQL 1PZUB 4J4PA 5CEZL 4FTVE 3QWRD 3WS3A 1JHTB 3D85D 1DVFA 4S11A 1G9NC 3VA2C 1MOEA 2WBJA 1NUNB 5J9PB 5JPMB 3U0WL 5F9DC 3QUXA 2VH5H 3QFDA 3PABB 1NUFA 4IOIB 5GISL 5T5FH 2IFFH 4N0YL 3NPZB 4Y16A 3GIZH 4MA1C 3MJ9L 5FUOH 3HG1E 4AIZA 2EYTA 1ZVHA 2NR6D 5JXAL 5DUBB 2NW3A 5M7QA 1TCRB 4LBEB 5AG8A 4PLKD 3SE9L 2B0SH 4BQ9A 3UBXG 3PL6D 5JW3L 3QZWA 4KK5C 3KPQB 4MX7A 1IEBB 5D6DA 4WI2A 3U7YL 4K7PL 3F7RA 4DAGL 4R9HA 3LQZB 5H37H 5DD1H 3S3JA 2AABL 1L0QA 2AEIT 5CEYA 2EC8A 2HFGL 1BZ7B 5C0BD 3DROB 2FRGP 1PZ5A 2FEEL 1F13A 3CIQA 1C7TA 3UTZB 1L6ZA 1MHHB 4IIQA 1U8JB 3WFBL 1QHOA 3D85A 4ONOA 1OSPL 3ZE1F 2AK4E 4JQIH 4MD4B 4OLXH 4XMKL 3UYOD 5BZWB 1O5DT 2E9JA 2DKSA 3VGHA 2AJUH 4XVSL 1RZFL 2H1PH 4HS6A 2ARWA 5HHVL 5DRXA 12E8H 4LPYA 3MNWB 4LLWB 1FVDA 1M71A 1WTLA 3FO9B 5SWSE 4NQEE 3WJLA 5D5MA 5F21B 1KTDB 4FZEL 3L9RA 1BFTA 2FECL 3GIVA 4OCSH 4YZFE 4ODHL 2ZG2A 1ZHLB 5D2LE 4GAJL 3HA0A 1GIGL 3SJVA 4PJFF 3E6FB 3GUTB 3DX8B 4CVUA 4FXKA 1G7QB 4MQ7A 1RK0B 2G9HB 3MUY1 3BGFB 2J8UF 4D0CB 4HG4K 1MH5B 2A73A 4LKXB 3RBGA 3O81A 3AU1B 4MZ3A 1N5YL 1ZHNB 1CYGA 1FO0B 3RTQA 3NCJH 3U2SA 1RSFA 4J1UA 3MRIB 3WDHA 2MSPA 3TFKD 2AEPL 4WUUA 5LQBL 5FUZL 4TSBH 1IC4H 5CD5C 5JOFB 1XR8B 1NFDF 1T89A 4NRXA 5DEFB 2OK0H 3ARRA 1R5VB 3TPUB 4H1LB 2A6DB 1ADQA 1QLRB 3EGSA 1TFHA 1EZVX 3V5HA 1P1ZA 3HMXL 4GKSB 3WLWC 5IBLD 4U6YA 3LAFA 2D7TH 4TULH 3O8XB 3DBXA 4G80A 4YO0A 2FYYB 4UB0L 4JPWL 4JGUA 1LEGB 4D0DB 4ZFOL 1LO0H 5DK3A 5DD5H 3D2UB 1CFTA 4G6MH 1R3HB 1VFBA 4NNXA 5B8CB 4NKOB 2D03H 4OIAA 5F3HA 2KKQA 1FG9C 4HC1H 1C16B 2DIBA 4QY8A 2NXYB 1DQJA 4Y1AE 1N3NA 3E3QE 3IF1B 2BX5A 2QV2A 4F15C 3C9NB 4RSVA 2XZZA 3B2UC 1Q1JH 4PRID 3W0WB 3IRZA 1AKJA 3HPLB 1OARH 2NY5H 1RIHL 1XZ0A 3BVNB 3WO4C 1XR9A 3F7YA 3D0VB 5GGRY 5GS1B 1MCBA 5F88A 3ULVC 1TDQA 4OZGA 4LIQE 4HW6A 1EO7A 1SBSL 4XPBH 4JO1L 2UVFA 2X7LA 4PRNA 3VG9B 3BAEH 3HAEB 3ZKND 4I18C 2XWJB 2EDTA 2N4IA 4FQXA 4GQPH 5FYKD 1E27B 3NZ8A 4W6YB 4O51A 4QGTA 2VQTA 1YEHH 2AXJA 3E6HB 5C0IA 1MCNA 2EDLA 3VI4F 2H32H 3R8BB 1FORH 1MWAH 1QFWL 3FN0L 4OAWB 5DK2B 4NUJB 5IMKA 2OM5A 1ZWIB 5DQ9B 3OKMA 1G7JB 4EDWL 3MV7E 2QSCL 2NW2A 5EIIA 1TZHA 1JPSL 3RIFF 1T83C 3OX8B 1YMHA 2EDEA 2PETA 5I74B 3FQNB 4TPRH 4R8WL 5B22A 1B2WL 5HJ3A 4JG1H 3CK0L 2H2PD 1QD0A 4WV1B 1I9RH 5L9DH 3FB8A 1T2JA 1MHCB 5J13C 1ZT1B 4Q6IB 4RFEB 1OP3K 1GC1C 2UWEA 5GS0H 4OB5L 1F97A 2CKBH 3BRDA 2CR3A 4KVCL 5DJ0A 1R6VA 3QXDA 2IBZX 3T3ME 1BQLH 5DTFB 3TCLB 4HKXB 5KN5A 4PGEB 2IAMD 5DJZA 3D0LB 3L7EA 4M62L 3ZTJH 2QADC 1DL7H 4EVNB 3DNKA 4KXZH 4N8CH 1BEYH 1XH3B 4Y5YC 5I1CH 2P5WB 3F12A 4RMUA 4LSPH 5DJ6B 3T0EA 3HUJB 4XCYB 4HKZB 5HHOE 3P77A 5CGYC 4JN2B 1Y0LB 1OLZA 2B1AH 5HDQL 3PDOA 1S9YB 1S7QB 2HJLA 2IGFH 3U0TB 4JGJA 4NDMA 2JTDA 5DRZB 3VH8G 2YPLB 4OZHF 3MBED 3X13A 4YNYA 4MJ6B 5DDHB 5ACZB 5GGTL 1UCBH 2CRYA 3I9GL 2VDOL 1HH6A 3GSNH 2ZOKB 4LVEA 3HC3H 4GO6B 4PRPD 2CQVA 3GMNB 1QKZH 1UJTA 5TE7H 4PJ5B 1CL7I 4X80L 4QOKB 3V7MA 1YMMA 5L0QC 1RZGB 4L8BA 5FXCH 5DFWH 1NMCC 2F54D 2ZJSH 3MREB 3TT3H 2BC4A 1Q94A 5IR1A 2CLRB 4KTEL 3MA9L 4I3SL 3FZUC 3RDTB 2W0FB 4JAMA 3O3DB 5EC1B 3G5ZA 2ICCA 2Z91A 2LVCA 3T2NH 3O6KL 3C60B 5I1IL 3EYFB 1PKQA 5CINL 4PJ7F 5EU7C 2FGWH 5I6XB 2WQRA 3QPQD 4MCZB 1KB5B 1UXWB 5EU4B 4L4JA 5MENE 2AJ3A 3MZTA 2IAND 5CWSB 4GXUM 4WHDA 4YXHH 3BXNA 3MGTA 5KSUA 2WANA 4GS7C 4ZPTB 3SGKC 3BZ4B 4HUKB 3DV4B 15C8H 3ZKSD 5LGJB 1JPST 2VLLB 3BUTA 2WV3A 5FGCB 2YWZA 1QP1A 4NKDB 3BDBA 3T2OA 4XNZB 1OCWH 4Z5RB 3HG1D 3MRJB 3IXTA 2VDLH 3VXQB 5D70L 2FX9L 4P46C 4YDLC 2R2CA 4R4FH 3G9VA 5KVGL 1P53A 2YD6A 3G6JA 4UT6L 1VACB 4PJAA 5JW5A 4ONHB 1O7SA 2DKMA 4HXBH 1TZIB 4M9PA 3BH8A 1U8QA 3V2AR 4OI8A 1K3ZA 3D25A 1I8IA 2YXMA 3WE6B 3BPLC 4U6HB 4JFPB 3AB0B 3BZEA 5E6IC 2YD2A 5DHVA 3JVGA 4LVNC 1DUYA 5ICZB 4XPFH 2W65B 1FL6B 3KS0J 5J4MA 3VFNA 3LN4A 2XN9E 5I75B 2IANA 3C5ZD 1VDGA 2VWEC 2EDWA 2IC2A 4F3FA 3QUZD 4MA8H 4GW4A 5M94B 3ZHLA 1QSFD 1HZHL 3MNVA 3OQ3B 4XCFL 4HKBA 4OZFG 2JIXA 3MBXL 5K9KA 2R1WA 5ESVB 3KPOA 4M6AA 1NFKA 2FBOJ 5GRJL 3NN8B 4ZFZA 1FL3A 2C1PA 1A6VL 2JE8A 4U1IA 1MIML 2NYYC 5FKPA 3CFJB 1KCRH 1CLOL 3IVKA 3MJ9A 1AFVH 4NSKB 4WI9A 1B3JA 3MCKA 5EUKA 2YUXA 1CXFA 4R7NA 3BDYL 3RIAF 4HUVA 3OKDA 3WFDH 3WNMA 3PF2A 3VFVA 1FZKA 2I07A 4ZYKA 1NBVL 3CXHK 1MCPH 1ITCA 4DN3H 3CX2A 4L3CB 2DQHH 3ZT6A 3HZKA 1WCBA 4XGZA 2N1KA 3QDGA 1OWWA 4Z7QF 3ROLB 3UDWC 4PB0L 5KS9F 1VGKA 3UBXA 1RZ8A 5D1ZC 3QQ3A 2V5YA 1NSNL 4N9GA 5I73B 5FK9B 4KI1A 5HHME 3MGOA 3O6FD 1JGUL 5HHPA 2Y9RT 3FFDB 4O2EB 3GSUA 3RWJB 5DR5H 1NC4A 2ZKHH 1F90H 4LSVL 1XFPA 4HIXL 3N9GL 4ZUVB 3STZB 4JY5L 1JNLH 5IW6B 5AYUH 1OAYH 4D9LL 3WMSA 5KG9B 1I7RB 5FOJA 4P9ML 3PGDB 4XCNA 3P30L 5DQJA 3ARBA 3TZVA 1U41A 3L3OB 3HE6C 4FZ8L 2C3VA 1RY7B 1A6UH 3KPLA 1UZ8A 1M7DA 4U1HB 3U6RA 2LTQB 1QSEA 3DX7B 4JRXB 1IC7H 2DQDL 1H3TA 3O3AB 3FB7B 1JPFB 5JO5B 3KPRD 5IB2B 3QFJD 3SKMB 4Y1AD 3EW3B 1FSKB 3DUHA 3BZDA 1B88A 1EFXD 5IMMA 1KGCE 3UROR 4K7FB 1SMOA 4PGBB 1ES0A 5IFJA 4EDXA 2A6IA 3L3KB 2YMXH 1YQVH 1I7TA 4X4YB 5DO2C 5E00A 2LV4A 5ESQA 4RAHA 1EUUA 3QG6B 1NLDH 1AHWC 1MREH 2ERJC 1MCCA 1XIWA 3C08H 1KJ3L 1MCWW 2FBJH 3OR7A 4WVRA 3CUPB 1QYGH 3C2AH 5JIIA 1K8IA 4JFDB 1BZ9B 5I76B 4RFOH 4N0RA 5C0GB 1VPOH 3HRZB 5FA4B 1KIPB 2NY7H 3WLBB 2VISB 2Y06H 32C2B 4KROC 3WEXA 4OD1L 3HMXA 4PJDB 4MA7L 4BZ2L 2CSPA 4OF0A 3DX9A 2NZIA 1I1FB 1YECL 5F89A 1RI8A 3QNXA 4MDJA 1INDL 3O4OB 4O2FA 5K59E 3VWKB 5FF6B 3EDEA 3SKJH 2CIIB 2Q76B 4ZFOA 2X4UA 4LF3A 4JFHE 1IL1A 4KI5F 2H3NA 1MJUH 3GNMH 2RIKA 1MRFH 3H42L 5HHNA 5IF0B 4PJ8D 1MCDA 2NY0D 1V7MH 3RZCA 2CK2A 3V8OA 1IAII 1BX2A 2A83B 5FGBA 3L95A 2OSLA 2R0ZL 2BVUA 4GXUN 4Z76B 1G7LB 4LDEB 1GGYA 5HVHC 1CK0H 3RIFK 1OAKH 1XF4B 5C2BL 1V3MA 3VMOA 1X5IA 1JZ3A 1RURH 1UQSB 3LEXA 4PP1D 3WS3B 1T0MA 2WP3T 1DVFB 1S7SA 5GZOC 5GGUA 2WBJB 5B3NA 1WGOA 4H8WL 4NQDA 1EHLH 4GLRI 1QO3A 3DECA 4R3SA 2W9DL 2JJSC 3FOLA 4LASL 1M6OA 4L3AA 1AD0A 1X7QA 5HHOD 3HE7D 4OLYH 4XPTH 1K4CA 4YE4L 4Y16B 3LY6A 4MXQD 4CKVX 2R0WH 4AIZB 1UZ6E 1QRKA 3QIWD 1ZA3B 4S10A 3T04D 1H15B 1KBGH 2OXGA 1HXYA 5IBUG 3S9DB 3RU8H 3RUGF 1HEZA 1WBXA 1D5IH 5JTWA 1P84K 3P9MA 4E5XB 4B0MM 1NEZG 5BRZB 4BZYA 2QHRL 5A1AA 3DHJA 4OD3L 3D39A 2F58L 3UPCA 1HKLL 1I1AA 5E99L 2ESVA 3QDAA 2GK2A 4HJ0D 4M1DL 4TRPL 4OFIA 3SE8L 2VIRA 4EUPA 4IIQB 2MKLC 4LGPB 5HYQA 5FDWB 1LVEA 3AREA 1UXSA 5C0DA 3QWQB 3HZMA 4W6WB 1A14L 1J0HA 4DUXA 4HS6B 4PJIE 3RWEB 5D8JH 4GMTL 4Z95H 4OV5A 1IILE 1A7NL 3LPGA 3O9WA 3ULUD 1M71B 5A2JH 2J1KA 4JZJC 2OJZH 5MEND 3X3GL 2OTWA 4JHWL 4F9LA 2KBGA 4K3EL 3L9RB 2P8LA 3GIVB 4PJXF 5KBNC 2VXUH 4NO2B 3RBSA 4N0UE 4R0LA 4XC1L 2VXTL 3GO1L 4KXZI 2FZ3A 3SJVB 2YUWA 1RU9L 5LXGL 4GUPA 4HH9A 4YK4C 1ZT7A 3OKKB 2XIDA 4NNPL 4FXKB 4MQ7B 4LQ1A 1K5NA 5L2JB 5DQDL 3MODH 4H26A 3KLAA 5EOTA 3ABZA 4HQQH 4PIRF 2A73B 3UC0L 5HDBF 1C5BL 4XNMA 2YKLH 1OAUH 3VH8A 3U2SB 5F93C 3VXRE 4J1UB 3QIUA 2J4WL 3KPTA 4X4MA 3UPRA 3ZYIA 4G5ZL 4GRLB 1UACH 3DMMD 4NRXB 4LCWA 1A5FH 3TH2T 1GAFH 1U95A 4GBXD 3NA4A 3MRNA 4ZXBA 3EGSB 3V6OE 3V5HB 1P1ZB 4UUJA 1MCSA 1Z3GH 4CMHC 4PJFA 5JPNA 4FOMA 1CIDA 4U6YB 1YPZE 3BN9D 3VGBA 1AE6H 1ORSA 1FDLH 4O5LL 3DBXB 4G80B 4YO0B 2Z31D 5F6IB 5E8DL 3PWPA 1X5YA 5HXMA 4RQQA 3RVWC 2J8UA 3ZLQC 2X9XA 5ICYB 1YNKH 3K2UL 1T7VA 5F3HB 4P2OD 5J8OA 1C1EL 2EDBA 2P45B 3CSGA 3NZHH 3HAEH 4XVUC 2AJZA 4QY8B 1DQJB 4KRPD 4K71B 1N3NB 1U3YA 3A6CL 1BOGB 2ATKA 3V0VA 1Q0XH 3JWDH 4K3HA 1NFDA 1MCIA 4Y4FA 1IEHA 1AKJB 2FX7H 1A7OH 1XZ0B 3V6ZA 1X4ZA 1XR9B 3F7YB 1AR1D 5GIRA 1CF8L 4XPHH 3TBVA 5F88B 4DKFH 3ARFD 2Z35A 3QIBD 3MRGA 2DTML 3A67H 3RNKA 4YAQA 2I60L 5GS1C 1WZ1H 3UO1H 5MI0C 5SV3A 1KIUA 4NWTH 1N6QL 4OFDA 3H9SE 1QHPA 3NZ8B 2IMNA 3MOAH 5AAMA 2DMCA 4O51B 3VG9C 1AC6A 1F4WH 1YN7A 3RIAK 5D72L 3B8SA 4G8FA 3CSYB 3GB7B 3BMWA 5C0IB 1SYSA 3IJHB 4OCWL 3O2DH 1B4JH 3D3VE 3QAZB 1JF6A 2NTSP 4WU7A 4M4RA 4X6DE 1R3IL 3OKMB 3A6BH 4LL9A 1H3GA 3T0DA 3QRFM 3ES6A 5BO1H 1TZHB 4RA0C 1J0KA 2D7NA 5C08E 4YBQC 3UTQB 4UZGA 2JJWA 4XVJL 5D1XD 1RUKL 3EJZD 3IFNH 3ZKMD 1YMHB 4MJIE 2R0LH 4I13B 3V0WL 2PW2A 4Y89A 2R29H 4OZFA 1F4XL 2M2DA 5HJ3B 5EZOH 1XGRA 2CDGA 1KJMA 3GBML 1MHPL 2X4QB 3MRHA 2YOCA 1N7MH 3UAJD 2EDOA 1FJ1B 4GQ9H 4JREB 2MCPH 2UWEB 4MXVF 3G5YA 4V1DE 3VFOA 5FCUH 1MJ8L 4AQ1B 5DD0L 5DJ0B 1A7PH 2QTEA 3QXDB 2E7MA 4Q6IC 4Z0BH 5C6PB 1AQDA 2EH8L 5LVEA 5KN5B 3OXRA 1HYSD 5DJZB 3L7EB 4CJ0A 3AMLA 3BJ91 3MLYH 3TVMA 1MFNA 4FQCL 3F12B 1T22A 5DFVC 3T0EB 3BP7A 1VKXA 1PQZA 3NFSL 3P9LA 1R5IB 5DUMH 3U9PH 3KXFD 3P77B 3B4NA 1NBYA 2HT3D 1W0YT 3UTTE 1J5OL 2E27H 4P57B 1OW0C 5I15L 3PDOB 4EI5A 5IHLB 5DJYA 5L8LB 2HJLB 4JQXC 3V0AC 4CDHA 4CMMB 4LPCA 4NDMB 4G8GA 5E8NB 1HHIB 3V4UH 4DK3A 4BYHA 4GOSA 4L4VA 5C92A 1S5HA 5LCVH 1P4BH 5DS8A 2FB4L 1Q9LA 5FYJH 4P99A 5KOMC 2L4OA 5E2UL 4QHMA 1HH6B 1BFOA 1MCWM 1KB5H 4HMDA 4JFHD 4TNWK 4U6VH 3VWJA 4MB4A 5EU5A 1SEBA 4WTZG 2FX8L 1YMMB 1G9MC 4Z8FL 3E2HB 4AL8H 1FE8L 3P0VL 1N64L 2FGZA 2WUBL 2BC4B 4YGAB 1Q94B 5IR1B 2QHLA 4KQ3H 1D9KB 3P0GB 3B3IA 3WNKA 5DI8A 4JAMB 1WZLA 3G5ZB 1YY9D 3QI9B 1ZHKA 2Z91B 2OR9H 1VERA 4YHLH 5KVEL 4NQCA 4X9HA 1BVKA 1J11A 5FYLD 1G84A 4IMKC 5L8JB 1DN2A 3KJ6L 2Z93A 1YEFL 3RDTC 1XF2A 3MUGA 4I0PA 1FGVL 4OZHA 1AGEB 2AJ3B 3DX6B 4ENED 3FT4A 4OFVA 3C6LD 3VXUE 1DJSA 3MLRH 2RGSA 3BXNB 3MGTB 5KSUB 4LLVA 3RFZC 1BIIB 2UVEA 4KK9C 4LHJB 1MLBA 1NEUA 3CMGA 3QEGH 2HG5A 4WFGE 2Y23A 4M3KB 1NL0H 5GGQL 4Y2DD 3W39B 4H20L 2V5TA 5IOPA 4YXLL 4FP8H 3IXTB 2Y5TA 3KPPA 2EC9T 3G6JB 3B2VH 4KV5E 7FABL 2R4SH 4PJAB 4XNZC 4WI3A 3L5HA 2BHZA 2X2YA 3KDMB 4NCC1 3HR5A 4PJ7A 1HQ4B 1I8IB 5CILL 1ZANL 1ZLWH 2FIRT 2Y07H 3BZEB 5JHLL 5F7LB 5SX5H 1DUYB 4NT6A 3IDUA 3BKMH 2HJKA 3VFNB 4U1NA 3LN4B 3AB0C 1IKFL 3ARDD 3OKNA 2A1WL 5EA0L 3UJTH 5C0AD 4F3FB 5LGKA 3G04A 3BPOB 4HXAH 5DMKB 3B8YA 5I75C 3HI1A 4Y4HB 1G0DA 3MNVB 4ZD3L 1LK2A 1U8OA 2JIXB 4Z7UF 3GSRA 4Z7WF 2R1WB 4XRCA 3KPOB 4RAVA 1RZJH 4ZS7H 4U3CA 4MXWL 2EEBA 1FL3B 2F19L 5EOCL 1DDHA 4U1IB 4F7PA 5FKPB 1CICD 1JN6A 4PS4H 2NTFA 5IB5A 1ZXQA 1PLGL 4DTGH 3UTSE 2APBA 4QRPA 4P48A 3MCKB 3QT2A 4R7NB 3OKDB 4XNUH 4KKAC 3VFVB 1FZKB 2W60A 1SJXA 2I07B 3MLXL 3FMGL 3WFCH 4ETYA 3EOBA 2NY2D 3ZTNL 1J8HA 4AEEA 4JN1L 2FD6H 2M26A 4J7RA 3VXTA 1WCBB 4XGZB 3O4LA 3QDGB 5T1KD 4FQ2H 5T5NF 1BD2A 5BZDB 1VGKB 4X4XA 3UBXB 1ZT4A 1IM9D 1I8LC 1NCBH 4LCCA 2YA1A 2R2BB 3BZFA 5F7DA 3UCRA 4HJJL 2VH5L 3RVTD 3MGOB 5HHPB 5I8EA 4U2ZA 3N1QC 3VFPA 3GSUB 2IFFL 1DANT 3HC4L 3ILQD 5J0BA 4D9RE 1NC4B 4LK4A 3WKMH 3GIZL 3WXVH 3HZYB 4XP5H 3GMQB 4ERSH 5IROA 1LP9E 4C55A 1CCZA 3G08A 5E9DA 5H37G 1A1MA 4NJ9H 2B0SL 2EZ0D 3Q48A 3F5WA 4KRLB 1T2QH 3OJDA 2DLEA 4XCNB 1VHPA 5DQJB 2X4RB 3ARBB 4PV8A 2VZUA 2J2ZA 3CH1A 3ARWA 1MCLA 4R2GB 4LLDA 1PX3A 2IBBA 4PY7A 2C3VB 5F8RC 3KPLB 5E7FA 4RGNE 3DIFA 1UZ8B 3OJMB 1EMTH 3LOWA 3U6RB 4X5WA 1QSEB 2W9EH 1INEH 4R90H 2WBKA 1F02I 1XGTB 2P8MA 4LVOC 4M8QA 2LTQC 4J3WA 5IMMB 1GZPA 3FRUA 1LMKA 1T0NA 4JQIL 4OLXL 1CIUA 1CXLA 4J3TA 1FSKC 1ES0B 5IFJB 2AEQH 1RJCA 2AJUL 3RWCA 1I7TB 1HINL 1OGAD 2H1PL 2V7HA 1E4JA 1MCJA 1BFSA 2VRAA 2OLDA 3SKOA 2NZ9C 5BJTA 1P7KA 5C7XH 1OT1A 1XIWB 3FQRA 2AV7B 4OLEA 4S0TD 4NN6B 1N4XH 3H9SD 3H3KA 4JRYA 4OCSL 1J10A 5C0CA 3DXAA 1K8IB 2JCCE 4M7ZC 3QDJE 3NIFE 3QSKB 4CBPA 1CD0A 1IZKA 5D96B 3WEXB 3THMH 4ODVL 3DJ9A 3DX9B 3FFCA 5F89B 3QNXB 2YD9A 4MDJB 4KI5D 3VFWB 5ECJE 2ADGA 4RBPH 1DQTA 2AJXH 1PY4A 2R1YA 5D1QC 3RL2A 4LF3B 3RP1A 3V52H 4UT7H 3O4OC 4M48L 4U49A 1G6RB 4UU9A 2H3NB 4HX1A 2ED9A 1E4WH 3BWAA 5I17B 5IW1A 4TSBL 1U2CA 3RZCB 1X6NA 1DLHA 1Y6MR 1Q72H 4PJHB 4HPYL 5E5RB 3L95B 2VUOA 2OSLB 3RY6A 1X5JA 2OK0L 3P4LA 5DLMH 1WTGT 4TVSa 1UM4H 4ZSOE 4L1DA 4LLAA 1OVZA 4V1DD 2ZOLA 5CCKH 1I1CA 1E6OH 4LP4A 1NGWA 2BSED 5BQ7A 2D7TL 3RWGA 4LGRB 4TULL 4G6JL 4L4TA 3LEXB 1T0MB 5HI4C 2XKSA 4PJGB 3IAGC 1S7SB 5GGUB 1OP9A 2BNQD 3PWNA 4NQDB 3IDXH 4XB8A 5ISZE 4K8RC 5DD5L 1QO3B 4R3SB 4J4PC 5F7NC 4G6ML 2OI9B 3QCTH 3FOLB 3FTGA 3BSZH 5I0DA 1DVFC 1QFUH 2D03L 1AD0B 3EJYC 4IJ3B 1X5XA 2WBJC 1X7QB 4HC1L 5L2KB 1T1YB 3L7FA 3GMLA 1K4CB 5JQHC 4NC0B 3QUXC 1JF1A 4LMQE 2FATH 1JHKL 3KHOA 4JFZL 5ELIA 5C6TL 3HI5L 2A77H 1OARL 4Y16C 5ADPH 2NY5L 3VE0B 1N0XH 1HEZB 1UWEH 5A43C 4ODUA 4TVPH 3P9MB 1EEYB 5JORB 2E8YA 2XI9A 3NFNA 4QRRE 4U1SA 2C5DC 4EOWH 3D39B 3QHFH 1TQBB 1I1AB 2HFFA 1I3RA 1P7HL 5J3HC 1VFMA 5EUOE 4ZTOH 1QRND 2FSEA 3UP1A 2NQCA 2FEDD 2MFNA 2VIRB 4EUPB 4P3DA 1YEHL 3S5LB 1U58A 1MWAL 5HYQB 3VFMA 1UXSB 5C0DB 1AR2A 3HZMB 5KSBF 4IIQC 4P4RB 4QWWC 3IYLW 3JTTA 4WNQA 2P5EE 5T5NG 2Q86A 3RUGA 4WY7L 3O9WB 4PB9H 4M43H 3QXTA 1QR1A 3PGFL 2QQNH 4N5ED 2OTWB 3CSPA 3AS3A 1BQHG 2VLJD 4TPRL 1LQSR 3BN3B 1UWXH 4MD5A 4R0LB 1WWCA 3P2TA 3O2VL 3WJLC 4GUPB 3DVNA 1I9RL 3PL6C 5E4EB 5L9DL 4LPUA 4MQXC 4WWID 1MF2H 4WFGD 3TA3D 1C5DA 1ZOXA 5GS0L 3BKCH 3ZTJG 2YEZA 2CKBL 4G9FB 1RUPH 4H26B 3KLAB 5EOTB 1BQLL 5HYEA 4JDZA 1KEGH 4D0BB 1YJDC 3UYPA 2FWOB 1NKOA 3UZQA 1HNGA 1F45A 2DWDB 4BH8B 1FFNA 1DL7L 4I5BA 5EZIL 3QIUB 4N8CL 1BEYL 5I1CL 1N26A 2YK1H 4LSPL 1ZSDA 3RTQC 5LWYH 5JHDD 5CLWA 1HILA 4LCWB 2GITA 4EN3D 1U95B 2B1AL 4ZXBB 3WYRA 3LHPH 3DO3A 5IB3A 2FJHA 4WTZA 1T89C 4UUJB 2PO6A 3VW3H 4PJFB 2P47B 2EDDA 2IGFL 1KULA 3WJJC 2QR0A 4PV9B 4RMVA 4EKXA 3SOBH 3TESA 1ORSB 1DE4A 4S1SL 2BHUA 5J56B 3K1DA 4XX1G 2N7BA 3PWPB 25C8H 1D6EB 4BZ1H 4RQQB 1LEIA 2G2RA 3RA7H 2H26A 2J8UB 3NIDF 4J12A 2R69H 5EO9A 3OAYH 4CN6A 2HLFD 3HC3L 1QKZL 2AJZB 3VRLF 1I9IL 3MRPA 3RY5A 2ATKB 2Z9TA 4ELME 3W9DA 3TT3L 1NFDB 4Y4FB 4Z7NE 3UTSD 1DN0A 1TENA 1A64A 2XQYK 1YA5A 3ET9F 5GIRB 1IGFH 1QOKA 3BT2H 4JFXB 2KQMA 5FV1L 2UY6A 5GSRA 3M8OL 4UNTA 4XVTL 4NOBA 3TBVB 1KLGA 3ZT7A 4YHZH 3RNKB 4LRIA 4IHOB 4YAQB 1N5AA 3TFKC 2J8OA 4OD2A 1I3VA 4ODTH 1CGWA 1KXQE 5GGVY 5F8QC 4C4KT 4YDVA 3EFFA 4P9HL 4XXDB 4PBXA 4JVPA 4YXHL 1T6VN 1YN7B 4KK5D 4WWKD 4G8FB 4NCDA 4FQXC 3GMPB 15C8L 1S78C 1SYSB 5IBLC 2GSIB 3HNTL 3HTLX 5E1AA 5C8JA 1CGTA 1N59B 3VFRA 3B9VA 3MV8E 3GI8L 5HBBA 4WU7B 2IH3A 1FYTE 1OCWL 2K1MA 4XBPA 3ES6B 4H0HB 4R4FL 4X4ZA 3RI5F 3P4MA 1DQMH 3DWTA 3QAZC 4MVBC 2CXKA 3SE4A 4KJWC 3X3FH 1TIUA 2VWEE 4ZAKA 4F57H 4BH7A 2KZ1B 2B5IB 4P2RD 5C07A 2CK0H 2PW2B 1XGPA 4FTVA 4OZFB 4P3CL 4TOYH 2PYEE 4YFDB 3TCXA 4KQ4H 2QBWA 3PNWA 1J87A 3H7BA 3QEQD 3R8QA 4Q9RH 3O3BB 5IEKA 5K9JH 3Q6FA 4Q2ZA 4J23A 5BV7L 1JRHH 3VFOB 1CR9L 4HV8A 1Z0NA 3GJFK 4S1RH 4ALAH 2YD4A 3SQBA 2BNRD 4JM2F 4DGVH 1R3JA 3K3QA 4WDIA 1N6VA 1Y6NR 4JFFB 3O6LL 3TVMB 3BIAX 5EBGA 2HTKC 2X40A 4AYFA 1T22B 4YIQA 2WUCH 3RQ3A 1VKXB 3C09C 2D0FA 3P9LB 5HGAA 1MCRA 1NBYB 2MPAH 4KU1A 2R4RH 4OLVH 1K9TA 1DQLH 3CJJA 2WQ8A 2WW8A 4UQ2A 4NP4L 5EZLA 5SWZE 5TGBA 1OPGH 1KCRL 1EHXA 5DJYB 1UT9A 1AFVL 2W07A 3FL7A 4P2RA 2YSSA 2ZCLH 2P8PA 4L4VB 3C8DA 2AK4A 4KMTH 3RWFA 5CD5D 4ACPA 5DS8B 1Q9LB 1YEDA 2Z8RA 4DN3L 5KANI 2I26N 1HYRC 4PJEE 4C56E 3L3HA 1BFOB 2YHGA 2VN7A 5C9KA 1I4FB 3MRLA 5IKCA 1I8KA 5EU5B 3C87A 3T0BA 1JWSA 1DTUA 1HI6B 1SEBB 3WLWD 1BF2A 5I71B 4IRSA 1G6VK 3OHXA 3RVVD 5SWSA 3T3PF 4NQEA 1A6WH 3B3IB 1DBAH 3E2HC 1ZHKB 4PY8J 1TPXB 2F5BH 1F90L 3DSFL 4QHKJ 4NQCB 1BWWA 3FHQA 1CVRA 4OBRA 2Z93B 3NMEA 1OD9A 1G7IA 1YPZF 3ILPA 3MUGB 1JNLL 4Q9BA 4OZHB 5AYUL 1OAYL 1RZIB 4C83A 1HK6A 1A1OA 1ED3B 2ORBH 3B2UD 3FT4B 1SJVA 5DVKA 3GGWA 3W82A 2OJEB 1CGXA 3LKPB 1SMAA 4LLVB 4D8PA 3ROOB 5IM7A 1A6UL 2BZDA 4MAYB 3SEPA 4PTTA 5C86A 1IC5H 4IM8A 5HYJE 5EB9A 2F8OA 3ULVD 1SJHA 2HG5B 3CXHJ 3MLUH 4R4NC 3RGVB 1HN1A 4L1HA 1JYNA 1J9CT 1P5UA 1J05A 3VXSE 3REWA 1D5XA 1OY3B 3KPPB 5FDYA 4OGZA 3T8XA 3GSQA 4XNXH 3K1KC 2Z8WC 4OGYL 1MFAL 3UTOA 1S7TA 2YMXL 2X44D 4PJ7B 3U1SH 4HUUA 1SEQH 3K0WA 1KCLA 1MIEL 3MSPA 4AG4L 1NLDL 4MD0A 1MREL 3HZVA 4QHNA 2CR6A 4ZG1A 4LPTA 2Y6SC 3TNNA 1UADC 2IEPA 3C08L 2J7LA 4NT6B 3U36A 4I77H 5ACMA 4ZMAT 3FT2A 4U1NB 5GISH 5A2KH 3PWVA 5EN2A 2VMFA 3OKNB 4N0YH 1BMGA 4RFOL 2XTJD 5C0EA 2NY7L 4JRWA 4TN9A 1KT2A 4OI9A 3P4OB 3MJ9H 3RWHA 2APTA 2Y06L 3QJHA 5JXAH 3QG7L 3MLZH 3HI1B 2NY4C 4GAGH 1LK2B 1U8OB 5F1NB 3PQYE 2P5ED 5JW3H 4DCQA 2XT1B 3SKJL 5IBTH 5IESL 3BKJH 4XRCB 3SO3B 3I02A 3ZSTA 4C54A 3MCLL 3WBDA 1KYOK 4J6RH 2CUHA 3KLSA 4UOJA 2AS5M 4DN4L 2AV1A 1JP5A 2EIBA 3QNYA 3SGJA 3GNML 1DDHB 4F7PB 2GTZA 4HC1A 1JN6B 4OCRL 4XP1H 2NTFB 5IB5B 1WFOA 2VLRD 1V7ML 2IH1A 4FQIL 4QRPB 4KPHL 2QADD 5DA0B 2XG5A 1MVUA 2FO1A 2NX5E 3WFBH 2VITA 2DMBA 5IB4A 3KJ4C 2W60B 1CK0L 4MDIA 2XRAH 3TJHC 5D7IE 1BQUA 1ZS8A 4FQJH 1BECA 4XMKH 4XNQA 1J8HB 4OFYA 4HLJA 5CGYD 3VXTB 3O4LB 4S1QH 7CGTA 5F7WC 3MV7A 1BD2B 1RURL 1BLNA 5IBUB 3TNMB 5E8PA 2DYPD 4LOUC 1E4XL 2CIKB 4Z7UA 4ZS6C 3IDJA 3D18A 2ED7A 4Z7WA 3BZFB 5F7DB 1WCQA 1DR9A 2AJSL 3KYAA 5KVMC 5I8EB 1K6QH 1T6WA 3NBNA 4FZEH 2O93L 3VFPB 5E70A 1UB5A 4OLYL 3SDYH 3MV9B 2R23A 5JMOC 4GAJH 1MWAA 4PJBE 4JDTL 5I0ZA 2Q7YB 4HZLA 4L8DA 1A1MB 1KBGL 3GHBH 5BS0E 3F5WB 4NM8L 3OJDB 1D5IL 1JPGA 4PV8B 1UENA 3CH1B 2DLFL 4LLDB 1KELH 3FZUD 2IPUG 1JNHA 1F4YH 3DIFB 2DQCH 3ARBC 3TZVC 4X5WB 1OP3H 4Y19E 1DBMH 3M07A 2P8MB 4GAYA 5FUZH 4M8QB 1SQ2N 3FAXA 1NC2D 5ACLA 3LCYA 2X42A 1BQHA 1EEZA 2ADIA 2EO9A 5DWUH 1GZPB 2D7OA 3FRUB 4GXVH 2XQBH 2YXFA 4U1GB 2X1PA 5FUCE 3RRQA 3FO2A 5D7LE 2CKBA 1P7QD 5JIKA 4ISVA 2NY1B 2V7HB 4OFKA 5K9OB 5D8JL 5DFTA 4Z95L 4JPWH 2ZUXA 2BRQA 5BJTB 4PRDA 1P7KB 3C5JA 2OJZL 4XWOD 4Q6YA 3VG0L 4OCYL 3GEWB 5DF0A 2GJ6A 2V2XA 1CVSC 1G6RH 4JRYB 1IAOA 1QLFA 2VXUL 5C0CB 5C0BB 3DXAB 2VSCA 1KEML 1XIWC 4N9OB 1P84J 3EHBD 3MRMB 4NN6C 2ATPA 3RWDA 3SDDD 4P4KB 5DC0A 5E24E 1WWBX 3CZFB 3LPWA 1FYTD 3FFCB 2JK5A 2GFBA 4FQQB 1LGVA 5D96C 5E6ID 1IEAA 1ZVYA 2VE6B 4KV5F 5TDNA 4HQQL 5E95B 2MQCA 1PW3A 4J8RA 1NC2A 4E41D 3ZZ1A 1NCAL 1M1SA 4UU9B 1E4KA 4HX1B 1NLBH 5DMIL 4JO1H 5E03A 3BWAB 1T04B 1CDIA 2X4TA 5KAQG 1NGPL 4ODWA 5IW1B 1DLHB 5T1MA 5JA9A 4PP2A 2KL6A 1GGTA 1A5FL 2BCKA 1GAFL 3ESVF 3VDAA 4HUNB 2H45A 5KW9H 3AY4A 4LDLB 2D7QA 3LQAH 3RZCC 1X5HA 3BD5A 3D48R 4BQBA 4YFEA 1QFWH 5FGBC 1ORQA 1AP2A 3QDHA 2ZOLB 4MJ5B 1ZA6B 3JUZA 1NGWB 5BQ7B 5TDPB 3RWGB 1RIUH 2BMKA 1FDLL 2XZAH 5IJVA 4L4TB 2QSCH 3IDYB 4JY4A 4OZ4A 3VXME 2RHEA 4MJ4A 3HAEG 3PWNB 1CXKA 4WTXA 1JK8A 1JPSH 5KTEL 2P44B 4LSUH 4YHNB 1F3DH 5CLTA 1HDMB 1VA9A 1F00I 3NZHL 3L7FB 3GMLB 1WAAF 5KVDL 5CBAA 4PD4J 4TUKL 2CUIA 2Z92A 5IVXE 3HNSH 4JLRB 1Q0XL 3T08A 4EUPH 3LKNA 3WHXA 5D1ZD 4OT1H 2E5EA 1A7OL 1E6JH 2XN9A 4ODUB 1EFQA 2LAAA 4XCCH 4XPHL 2X9WA 1CDUA 2DLTA 4KVCH 1T3FB 2IPUK 4DKFL 3NFNB 3QO1A 4U1SB 4K94L 4HF5L 3UO1L 3CD4A 1I3RB 3SDCA 4C56D 4M62H 4NWTL 5HGGS 4TUOA 4ESKA 3OR6A 1PKOA 3BW9B 3U7WH 2JB6A 2FSEB 4J2XA 1TQBC 4P3DB 4LHUG 1PDKA 3FT3A 4K9EH 3TBTB 1U58B 4LCIH 4YX2L 1TNMA 3VFMB 5HDQH 3HE6D 1K8DA 4HWBH 4WRLA 4XP9H 2J12B 4YHMH 5HYSB 3JV4A 3JTTB 4WNQB 3F7QA 2Q86B 3AREC 5BO1L 2R56H 4HFWA 3RUGB 3JWOC 1JRHI 4OF5A 4LNVA 1QR1B 1P4LA 3MMEA 5HHXH 5GGTH 1KJ2H 5AUMA 3IFNL 1T20A 3PXJA 1EBPA 4MXQC 5L88H 3O9WC 2VDOH 2ZNWA 4M9OA 5EBLB 4MD5B 3CC5A 2WIIB 3J8F7 1NH6A 4X80H 1I9JH 4W68A 3DVNB 5DO2D 5HYJD 5C0JB 2YPKA 2J8HA 1N7ML 4G6KH 4R0LC 1C5DB 4GQ9L 1UH2A 2MCPL 4ZUWB 3HHRB 5FCUL 2P5WE 1A7PL 3DYMA 4X98B 4QRSA 3O6KH 1CFNA 4JDZB 4Z0BL 3VD7A 5F7UA 5I1IH 3HUJE 4K23H 4OSUL 4HJ0C 4Y7MA 4I5BB 3MLYL 1J1XH 3D5OF 2DDQH 5EFIA 5LKNA 1ZSDB 1ODAA 2VAAA 2J6EH 1RIVH 2VC2H 3IFPB 5DUML 3DSNA 4LPXA 5BCAA 3IDNA 3QIUC 2GITB 3T77B 2E27L 2JCCF 3NIFF 3U0PA 1OWRM 4UIKH 5LBSL 1U8NA 4UTBL 5IB3B 2PO6B 2VN4A 4G6AC 3IDGA 5HY9A 3V4UL 2XKNA 4PJDF 4K7PY 4TTDD 5F7MC 1DE4B 4S1DC 1B90A 3RL1A 4WGWB 3LV3A 4H25A 1NMBH 4U0RB 5KVGH 1LEIB 2H26B 5IHUH 1P4BL 4UT6H 1U3HD 3PQYD 5FYJL 2HJFB 2QQLH 2EYRB 5JOPD 5EO9B 3EUUA 4IDJH 1BBJB 2I9LA 3MRKA 2RAMA 6FABH 4KK8D 4RGOH 5CJXA 1W2KT 4AL8L 1UG9A 3W9DB 3UMTA 3WNPA 2CDFB 4KQ3L 4U3HA 1DN0B 3CU1A 4BKLA 4FQ1H 3ARGA 4N90E 4A6YH 5GSRB 4Y4FC 2VQ1A 1KLGB 4I9WD 4IRJA 2FNBA 2IJ0C 3H6JA 4DQOH 5ITBL 1A6AA 1EEUA 2UYLB 1ONQA 4OD2B 2SEBA 5ABDE 1T80A 1KTLA 1AO7E 1D5BA 4YDVB 3EFFB 3Q1SL 3SKUD 4JY6B 3MBXH 5H2BA 4MQTB 3MLRL 4LCYB 3BO8A 3P3YA 4U7KA 4YFLI 1EAPA 2BY1A 4PRPB 5E1AB 1MIMH 4MNQE 2F54B 3QEGL 3VFRB 2A6JA 1UFUA 2YWYA 1NL0L 1CLOH 1OOAA 4PR5A 4FP8L 1AGBB 4RAUA 3BDYH 2HN7A 4AEIH 4EQ3A 4P2QE 2PKDA 5DC4B 2R4SL 5BS0D 3PHQB 1NBVH 4ZAKB 3B6SA 3TO2A 4F7MB 1V5JA 4G8IA 1XGPB 4FTVB 5DJXA 2Q8BL 1S7UB 4F9PA 3PGCA 5E5MA 1KPVA 3SCMA 2PXYA 2AVGA 2B5IC 5J9PA 1KIRB 3PNWB 3C6SA 5JPMA 1VEPA 4OGAC 3H7BB 1FVCA 3PXHA 1JGUH 5IEKB 3Q6FB 3UBXI 2YRPA 3QIBC 4Q2ZB 2X4NA 3VRIB 4HV8B 3TH3T 1G9NL 4LSVH 3HG1B 4HXAL 4HIXH 4DZBA 3N9GH 2FEEI 5DUBA 3N1FC 4NKIL 1N2RA 3EZJB 4JY5H 1IGTA 1SY6H 4WDIB 2APFA 4D9LH 4GMSL 2X4PA 2JLLA 4YIQB 1NUDA 1RZJL 3FQWA 2K7PA 1MCQA 1KNOB 2ZG1A 4ZS7L 3VGGA 5HGAB 3QQNA 3DVGA 4FZ8H 3TVMC 1W8NA 5CZVH 5EZLB 1IQDA 3TIEB 3MV11 4PS4L 3AS0A 4JQVC 1LDPL 3LDBB 4LNRA 2YSSB 3UTZA 1MHHA 2P8PB 1FYHB 2FECI 4XNUL 1U3ZA 4EI5C 4YHOH 2AK4B 3WFCL 1YEDB 5BZWA 2HT4D 3QDME 4YHYC 4FQ2L 3MRLB 4JM2A 4EQ2A 3DI3B 3FRPG 1JV5B 4IRSB 3ARTA 4LLWA 3ZE2E 4X9FA 5AZEH 1NCBL 2ZG3A 2VXVL 4WFFE 5DRWA 3VWJC 5SWSB 3FO9A 4NQEB 3NCMA 5KANG 1KJ3H 1KTDA 5I66A 5I71C 3LKSA 4OLWL 3RVWD 2VOTA 3SDAA 3UYRL 5D2LB 1ZHLA 1S7RA 5T3ZH 4N0UA 5C09E 3WKML 3WXVL 2VLKA 4XP4H 5DGQA 1EDQA 2NPLX 1G7IB 3G6AB 3ILPB 4XVUD 3E6FA 4MA7H 4NJ9L 2EXWC 4C83B 1A1OB 1G7QA 1Y18A 3OXSA 4GT7A 5IFAH 4EBQH 1INDH 2HT3C 5B4MD 3VXMD 4I0PC 5HPMB 5IUSA 2NXYD 3LVEA 2ZUQB 4JR9H 4OUOA 4KDTA 3VI3E 3KAAA 4M7LL 3IDMA 3VXRA 4NYLA 2F53A 4K3DL 5GS2D 2AQ1A 2W9EL 1SJHB 1JHLH 3H42H 3MRIA 4PJ9A 4R90L 4YDIH 3IJYA 4Z18A 3N1MC 5GZNC 1CDJA 3H2WA 3IFOA 1XR8A 1LE5B 5DEFA 3REWB 1D5XB 4KKBC 3TPUA 4KHTH 1ZLWK 3GSQB 5DMGC 3QCVH 2I9TB 4JPIB 5I9QB 1YPZA 3WD5H 2GK0B 3KPSE 5I19L 3GMMA 4HUUB 5HI5C 3O8XA 2WLYA 5HVFB 5KSAB 2FYYA 4OQ1A 4XZUA 5IB1A 3T2PA 3HZVB 4QHNB 4YBLC 4D0DA 3TNNB 3WIHH 3VJ6A 3QUKA 2GEEA 3U36B 3D2UA 3V8CA 1KPRA 1R3HA 2W9DH 5B8CA 1NFIA 4YBQD 2VDRH 4HUXA 3QH3A 3WHE1 3PWVB 4YE4H 5C0EB 1KT2B 3RWHB 4XB7A 3QJHB 1BVLB 4M00A 5D2NE 1AY1L 3W0WA 4E9LA 2D7PA 2WWMC 3HPLA 3U46B 2AJXL 3S98A 1QFWI 3I02B 1NANI 1EGJL 1SJEA 4UT7L 1CZ8H 2BSSA 2JELH 1I1YA 2AV1B 3QNYB 4OD3H 5DRNA 2F58H 2GTZB 2A9MH 1JGDA 1HKLH 4H8WC 5E99H 3DO7B 2P46B 1IQWL 4PTUA 1E27A 2IALB 1Q72L 3SE8H 2ICES 1MVUB 3JZ7A 3STLB 5DLML 2VITB 1FFOB 4QXWA 3E6HA 2OMBA 1HE7A 5DFVD 5IB4B 4MDIB 5L8KB 2R0KH 1ZS8B 4XNQB 3D3VA 4NHCH 3SE3A 5CCKL 4HLZH 1E6OL 1ZWIA 2P5WD 3K2MC 5EORL 1JNNH 3R1GH 3MV7B 1BLNB 3CVHB 5B39B 5GGSA 4I8DA 4Q9QL 5F7HA 4X7CC 5C08A 4Z7WB 3IDXL 3LS4H 1X5LA 5FB8A 1MFEH 1BM3H 1JTOA 3C8HA 3QCTL 1IGCH 5CIPB 4JHWH 3BSZL 1QFUL 5EOCJ 4MJIA 1UB5B 5D7KD 4RMWA 4LCCC 2YPLD 2NY0B 5CP3A 1UEYA 2R23B 2ZPKH 2O5ZH 2VXTH 3GO1H 3M17A 1MWAB 3KWWA 5LXGH 1FZOA 4RX4A 4WV1A 4XXCA 4KRMB 2V9QA 4HZLB 4L8DB 5IJKA 2EC9U 2A77L 4LHUA 1ZT1A 1WFUA 5ADPL 1XCQB 4RFEA 1N0XL 5MEOA 3LSOA 1RQ5A 1UWEL 4UMGA 5TJWK 1JPGB 5IROC 4M7LT 3HI6H 4JEGB 4OLUH 3NAAH 4HS3A 4PJ5D 4QOKD 4PJEF 1JNHB 1C5BH 5CGMA 2VDPL 4HKXA 3LN9A 1AXIB 3D0LA 1H3PH 3RDTD 2J4WH 5HGHA 1XH3A 3MROB 2VR4A 3S37L 4ZTOL 5CAYB 4G5ZH 4WO4B 1JGVL 3C60D 4MCYB 4C4KO 4HKZA 2ADIB 1FCGA 1FCCA 3UTTA 5IWLA 4HZAA 3FO2B 4WEBH 3S36H 3QIWB 4HDIA 5K93A 1S9YA 4KK9D 4DOHB 1S7QA 4ISVB 5D5ME 3OB0H 4U1GC 4L8SC 5DRZA 4P23A 5JLZA 3STBA 2VJXA 1QACA 1T66D 43CAA 2HRPH 4PB9L 5TF0A 5IV2A 4PRDB 1TVHA 2NY1C 2X89D 3C5JB 1CI5A 2QQNL 3QXVA 1MRDH 3KYMB 3GJFB 2GJ6B 35C8H 1IAOB 1QLFB 5C6WH 1F6LL 4RBPK 1XEDA 2CXGA 1EUTA 4PJ5A 1CE1L 1GGBH 2ATPB 3A6CH 5LG1A 4MNQD 1J12A 3R0MA 2ZSVA 3EYSL 2K9UA 2XXCB 2ZUVA 1CLZL 4UT9H 5GGRA 2CLRA 2JK5B 5T1LB 3BKCL 2W9LA 4EXKA 1IEAB 1RHFA 1RUPL 4JM4H 5TDNB 4WUUE 1CF8H 3DV6B 3L3GA 4HK3J 3C60A 4P2QD 1KEGL 5CD3B 2AQ2A 3BISA 2ID5A 4MCZA 2X4TB 2BY0A 5GXBB 5JXED 3TH4T 3TYGH 1N6QH 2HH0L 2YK1L 3LKRB 3VXUA 3KVQA 5T1MB 4PP2B 3OAUH 4GAFB 2I25N 2BCKB 3T2QA 5D72H 2J88H 1RK1B 4DGYL 4CN1A 4R97C 2EKSB 1Q9WA 4GG6E 3VW3L 2VL4A 2PYFA 1ORQB 5GRZA 1AP2B 1KB9K 2FL5A 4CUCA 1AGFA 4N0CD 2VNCA 4NKDA 4CRPA 1KFAL 3V6BR 1KXTB 3DETC 3MRJA 3U4BH 3VXQA 5IJVB 3MA7B 1KIQA 3ELAT 4JY4B 4OZ4B 5GQBA 3OMZA 2W59A 3BMVA 25C8L 2V9TA 4BZ1L 3RA7L 1JK8B 1GGIL 4JVUA 4UI2A 2R69L 4XVJH 3NABH 4KKAD 1UM5L 3BIBX 1TZIA 5F7FA 2E7HA 3SPVA 3VDCA 4MMXC 1U93A 3TM6A 4E42A 3HB3C 3V0WH 5CBAB 4LRNH 3DMMB 4U6HA 2Z92B 3EDKA 1L6XA 3I6GB 3GBMH 4KI5C 5JMRA 4OZGE 4G7YL 2ARJA 4X83A 3P9WB 3OG6B 2IF7A 2XN9B 4LEXL 4LQFL 1IGFL 3BT2L 5H8DA 2DI8A 4JVWA 5DT1H 5D7IF 1MJ8H 3LMJH 1CG9A 1JI1A 2EDKA 3I75A 4ODTL 3ISWA 3KPNA 2B4CC 1WT5C 4DKEL 3GDBA 1TLKA 5B38A 3OR6B 2JB6B 3OJ2C 4JFOB 1CDGA 1U8KA 3FT3B 5FYKH 1J5OH 1WAAA 3GM8A 1U91A 3REVB 5BV7B 4PJBF 5I15H 1K8DB 1TMCB 2GTWA 4NZDA 4W4OA 4PRIE 5C09D 4MJ2A 3ZE0F 3JV4B 4NSKA 1CD8A 1ITBB 4CL7A 1IGIL 1UWXK 4HFWB 2GCYB 3NFPA 4O9HH 3ARFB 4IEFB 1QSVA 1UWGH 2I5YH 3SKNA 3X3FL 4JRXD 4L3CA 4OKVA 5F72S 1RFDH 1JUFB 2EEDA 5AZ2H 2CK0L 2AW2A 3H8NA 3ROLA 1NDMA 3CC5B 4TOYL 4QGYA 2M1KA 3X17A 2GJZA 1QTYT 4JG0L 4JFQA 2FX8H 4KQ4L 5DEZA 3P0VH 1N64H 2YPKB 4KK6C 5HHMB 3CH8A 2WUBH 3OJVC 4LP5A 2NZ9D 3FFDA 4Q9RL 4U1LA 4O2EA 4X7DC 5CJBA 4WW2F 1KPUB 5FO8A 2L0DA 1WIPA 4QRSB 4S1RL 4ALAL 5FECB 1CFNB 4M5YH 4ZQKA 4N0FA 1YEFH 1LDSA 3STZA 4XAKE 4OIBA 4DGVL 5DYOB 1FGVH 2WM0A 1X9QA 2FH6A 3QCUH 5EFIB 1RJZB 4PRHA 2ZCKH 5KG9A 2F74A 4NZTH 4ZUUA 2WUCL 2VAAB 1NGXB 1FRGL 1KTKE 4KDWA 4DZ8A 3IDNB 3MCG1 2MPAL 2R4RL 3LS5H 2ZUSA 2ZNXA 1FNLA 3U0PB 1U92A 4BM7A 1OQXA 1JZ5A 3FRPA 3BPNC 3S36X 1DP0A 2XACC 3GJEB 3VWKD 2Q3AA 5GGQH 1DLFH 3IDGB 5HY9B 4H20H 2ZCLL 5ALCH 3RL1B 2PO6C 2K7QA 4N5EC 3JTSA 1YUHA 3LV3B 5ANME 5A2IH 1T2XA 3S96A 3MLPA 1GGCH 4O02L 4YH6A 4EI6A 1KLUB 1VB9A 2HRLA 4KH2A 4U0RC 1B0WA 1CGSL 4QRUA 4YXKH 2QKIB 1PYWA 4WI8A 1ZANH 3BEVA 5JHLH 4RFNB 4X5XA 1PKQE 5EG6C 4PJHF 2UUDH 4BKLB 5DMJB 3ARGB 2JCCA 4Y88A 3QDJA 2F5BL 3U7AA 4J4PD 4JFDA 2KZWA 4PUBH 5I76A 2VQ1B 4X5LA 3HRZA 4IRJB 1DVFD 4S2SA 3EJYD 5DVLA 2WBJD 1A6AB 2VISA 1LNUA 32C2A 1ONQB 3QHZL 2SEBB 4PJDA 3VD3A 1KTLB 1RJYA 4TNVF 1D5BB 4PJGF 2ICWA 4LRIC 3VWKA 4CVZA 4I1NB 4D3CL 2YD3A 2CIIA 1WF5A 3E0GA 2Q76A 4GKNB 4Y16D 4LAQH 2VZ3A 4RWHA 5HSFA 4RMQA 1X5ZA 1UM6H 4YGVA 3MLSH 4HCRL 1X6LA 3MJGX 4PJAE 4Z77A 5IF0A 3GM0A 3MLUL 5D6CA 5ADOL 3S3PA 4X99B 4UQ3A 4PR5B 4RAUB 2A83A 2C7UA 3PE9A 4Q58C 5BRZD 5J3HD 4G6FB 4AT6A 1BBDH 5E8OA 4Z76A 1G9EA 2DQJL 1IKNC 3EOTL 4ZSOA 1EXUA 2HLAB 3FMGH 3ZTNH 1WK0A 3B6SB 3TO2B 2G5BB 3B9EA 4G8IB 5DJXB 3C6LB 2IANE 1NGQH 1UQSA 5T3XE 3GKWH 3TT1L 4ZAKC 4QWWD 1BREA 1MCEA 3PGCB 5E5MB 1KPVB 3SCMB 2P48B 2PXYB 3LIZL 5ISZA 3C6SB 2E9BA 1FVCB 1ZV5A 4TVPD 4HJJH 4I77L 4YLQT 4NO3A 3JV5A 1FG2A 3HC4H 5CEZE 2X4NB 3FO1A 4C58B 1IARB 5F7YC 4RNRB 2BVYA 4DZBB 4I18A 4CU6A 2CMRH 3MLZL 3DHMA 5D7JA 1N2RB 1ZA3A 4GAGL 1IGTB 1TTFA 1H15A 1WWWX 5E94A 5J1TC 2X4PB 1I7UA 4WWKC 3BP6B 3T0VA 2E7LA 3MV01 5IBTL 1D3CA 4MQXD 3BKJL 4NCC2 3EFDH 1MI5A 4E5XA 3IXAA 3FQWB 4J6RL 1PFCA 2C4FU 5BRZA 1OP5K 3SJVD 1EJOH 2BXZA 3DVGB 4JCLA 2KQNA 1H5BB 4LPVA 1H8SA 4XBGB 4MQSB 3TO4A 1IQDB 2X5PA 4XP1L 1JJUA 2D0GA 3ZKQD 3I50H 1FAKT 4LNRB 4P0DA 5IGXH 3IAPA 4HMCA 1PEZA 3LDBC 2DIAA 2XRAL 3RTQD 5IFHL 3BYYA 5FDWA 5J11B 4FQJL 1QSFE 4BELD 4WUUD 2D4DA 4S1QL 2IG2H 3VFTB 1HINH 5EDXA 2WWKT 4JM2B 4DEPB 1J0JA 3BHBA 5CUSH 3G5XB 3RWEA 3CSBA 4BFGA 4AIOA 1YEJH 5DRWB 1K6QL 2DD8H 4OLZL 3WIFA 5I66B 1OB1A 3LKSB 4UILH 3SDAB 4FMFA 4NO2A 1S7RB 4N0UB 3SDYL 1TQCB 2VLKB 2LU4A 2VL5A 3OKKA 1E28A 3GHBL 4ODVH 3S88L 2NY2B 1QSEE 1Y18B 3OXSB 1LD9A 5L2JA 3ZDYE 2ITCB 1W0VB 4U7SA 2Y7QA 1F6AB 4ZODA 5T1KB 1KELL 4GW1A 3ZSSA 1H3VA 4JFYB 1T03L 4JPVH 1F4YL 2DQCL 4M48H 4PRBA 3IDMB 3S34L 1AKJD 2F53B 4NYLB 3VXRB 3RAJH 2GYSA 1DBML 4PJ9B 4ZDHA 2ZUQC 3IJYB 5FHAH 2CUMA 5HHQB 1C08A 4QHLA 4GRLA 3IFOB 4HPYH 4QYOB 5DWUL 3F65A 4GXVL 1H8OA 2XQBL 4NNYA 3F58L 1ACYL 1BIHA 3QULB 1RUAH 3E8UL 4FQXD 3U83A 1YPZB 1S78D 3RVVC 3GMMB 1OAXH 2I27N 4G6JH 8FABB 1I85A 5I9QC 4XZUB 2OL3B 5TFSH 4WFED 4KHXH 5IB1B 5JQ6H 4LSRH 2R2EB 3VJ6B 3QUKB 5BMFH 4LIQH 1L7TL 1KPRB 1W8OA 4CGTA 5ICYA 1G6RL 1LO4H 4MVBD 1NFIB 4NO5A 4HUXB 3QH3B 4KJWD 3KPRE 3QFJE 5EPMA 4CDGC 1BOGA 2X9YA 2Z8VC 1JHKH 4XMPL 4JFZH 2EEAA 5C6TH 3ZT5A 4DKAA 3HI5H 4F37F 1G7PA 3MOBH 2EECA 3VFGH 5GRWA 1SJEB 4Z78A 3N50A 5LJYH 3PG2A 1MCOH 3NACH 4M93C 2BSSB 1I1YB 1NLBL 3CVHH 3OL2A 5DRNB 1RAMA 1A6PA 1JGDB 3FQUB 4NN5C 2BFVL 3MX0A 1JMZA 1HCVA 4P46A 3HCVB 5EU6A 3H9SB 5JDJA 1IBGH 4PLJD 4PTUB 4L29A 3SGJC 5CIPH 4UOW0 5INCA 1EO8H 4FFVC 5FV2A 2HTKD 3CSYA 5KW9L 3GB7A 3LQAL 3IJHA 1MRCH 4U6XB 3D3VB 3MV8A 5JNYA 4Q7DA 5HDLA 1MQ8A 1LO2H 2NY5C 1RIUL 3T0ED 2XZAL 4NO0B 1ZHBB 5GGSB 1E0OB 4XAKD 5C08B 2X70A 2W38A 3RGHA 4WY7H 1MNUL 5FB8B 4LSUL 3UTQA 4PLOB 3PGFH 4ZO6A 4XWGL 5CFHA 2HTLC 1WICA 2XTJC 2W91A 4EUPG 3QBTB 4MJIB 3NA9L 4APQA 4CNIA 1VFAB 2IQ9H 3S5LG 5H35B 4AZ8A 2PYEA 2BVTA 3M17B 3O2VH 3KWWB 3HNSL 1S5IH 1FZOB 2X4QA 1O0VA 4JHBA 4OT1L 4LHUB 1CD9B 4XAWH 5MEOB 1E6JL 1FJ1A 3LSOB 2ESVE 4V1DB 4XCCL 3O0RH 3TN0A 5E7BA 4K3GA 2ZWLT 4HS3B 1YMMD 1B9ZA 3RPIA 3T65A 2F8VA 5EZIH 1D9KD 3QISA 5HGHB 3OGCB 3QA3A 3U7WL 4A2LA 1BJ1H 3GJFH 2XOTA 1KV3A 5CSBA 1R5IA 4K9EL 3UTTB 3MXWH 4LCIL 4P57A 5SWZA 4HDIB 4QNPE 1VENA 4HWBL 1JZ7A 1CT8A 4XP9L 1ZMYA 4PRAB 5A2LH 4YHML 4CMMA 4I3RL 4UTAH 5E8NA 1HHIA 5GS0C 4P23B 3H3PL 1NUGA 2Y5EA 5JLZB 2R56L 3MRDA 4S1SH 43CAB 4R4ND 4FHBD 5IV2B 1TVHB 4WU5B 5ESAB 1NDGA 4UV4H 5HHXL 1HH9A 1KJ2L 4PJEA 1TVBA 5LAXB 5L88L 4AM0B 3VI3F 3ULUH 5D4QA 3MR9B 3WIIL 3MJ7A 1I9JL 2BDNH 1I9IH 4X7EC 1UEMA 1WBZA 2ZSVB 4G6KL 5AWNL 4TNVK 5GGRB 1NCUA 2ICEB 4GRWH 3VGEA 5SWQB 2AGJH 1D9KA 4PFEA 2Y6SD 3QI9A 3T0XA 3Q5TA 1ERNA 4ZPVA 3L3GB 3M8OH 2PCPB 4XVTH 2N7AA 2B1HL 3L3DA 4K23L 3KG5A 4XBEH 3ULUE 2OX5A 1J1XL 1AGEA 2DDQL 4XNYH 2NLJA 4P9HH 5H94A 3DX6A 3W11D 3VXUB 4GFTB 3ALPA 5T3XD 5C1MB 2NY4D 1E4KC 2J6EL 3L1OH 1RIVL 2VC2L 1S7VA 3IFLH 1BIIA 4GRWE 4FXGA 3U30C 3PWPE 4UIKL 1Q9WB 2FHFA 3HNTH 4KGJA 3TBYA 1VADB 5ENWB 2PYFB 5CEZD 2JIXD 2FL5B 4J3XA 2EDXA 2WNGA 1AGFB 3GI8H 1WUNT 2PNDA 3W39A 3AY4C 3VXSA 3NH7H 4XWOC 1GOGA 1KIQB 3IKCA 1A2YA 2W92A 1F2XK 5F9OL 1NMBL 5IHBA 1LK3H 5BVJA 5IHUL 5SX4H 4KKLC 2QQLL 4OGXL 5HPOA 1NFDE 1SVZA 3KDMA 3EHBC 4IDJL 4D9QE 3SPVB 3SDDC 1HQ4A 3BE1H 1U93B 3TJHD 4E42B 4P9HC 3U9UA 6FABL 4RGOL 4HCRA 4P3CH 1ZGLM 1RV6X 2J5LB 4LOUD 5DZOA 2WINB 2ARJB 4ZS6D 1K3IA 4FQ1L 3QDGD 4A6YL 5BV7H 1ZK9A 1CR9H 3IT8D 1CG9B 4DQOL 5KOVC 1KCKA 5DMKA 3I75B 1H3WM 2BOCA 3KPNB 4Y4HA 1ZLVK 2R15A 5B38B 3O6LH 4QRQA 3LD8B 5IIEA 1NC4D 4EEEA 4OF8A 3SDCC 4NOFA 4OCXH 5ID0A 1U8KB 3BP4B 4FFZH 3DRTA 5FOBB 3EO0A 5IT2L 4WTWA 1U91B 3MLVH 4HGKC 3LKOA 4NP4H 2GTWB 4BSVB 2DQIH 3UTSB 3TZVD 3ARBD 3H9HA 2XY1A 4M7KL 4R2GD 4BJLA 4MGXA 2AK1H 2NX5A 5BV7C 2OYPA 4AEIL 2QQKH 3NFPB 1KG0A 3SKNB 3CMOL 5D7IA 1QSED 1CDHA 1KUMA 3DUSB 1A7QL 4OKVB 3KLHC 4MA1B 4YBHA 3CFKA 4P2YA 1YN6A 4D2NA 3CDGA 2XA3A 4OV6F 5BZDA 1NDMB 3VI4E 5EU3A 3D9AL 2GJZB 4JFQB 3MRQA 2YR3A 5CP7A 3UX9B 3DVFA 2R2BA 4FFYH 2D2OA 3AGVA 2ENYA 3NCYS 4U1LB 2V9RA 5FO8B 3MJ8B 2Y72A 3BOVA 3DSFH 4PJBA 3HZYA 1Z5LA 3S97C 3GMQA 4ZQKB 1LP9B 4N0FB 2XWBA 1XIWD 4J3VA 1SY6L 4P2CG 1EHAA 4U0QB 4PRHB 3L5XL 3X11A 1IAIM 2F74B 4ZUUB 2X4RA 4FMKA 3QP3A 3QO0A 3MACH 1FZMA 4G8GE 4QT5B 4DZ8B 2V2WA 1RUML 4EXPX 4RGNB 4WEMB 1CFVH 1AC0A 5CZVL 2ENSA 4Y19A 3SHSA 1U92B 1AD9A 1S7WA 3O3UN 1XGTA 5CKAA 4FNLH 4JZJA 5DEGA 5I1GL 1MEXH 3JTSB 1YUHB 4YHOL 5IVZA 3N0PB 1CFSB 4ETQA 3SGDH 4WW2A 1PVHA 4F7TA 3FHAA 5D7LA 3S96B 4EI6B 5SV4A 4OGYH 2AXFA 2COQA 5GGVL 1MFAH 4BSJA 2VZOA 3RZCD 2DRUA 1I3GL 4QRUB 5DVNA 1PYWB 1MIEH 3BEVB 2RFXA 4AG4H 5AZEL 3Q5YA 1R3KA 3KXFE 4M6OH 4X5XB 5L7XH 1FFPB 2AV7A 5EO1B 3PP3K 4W6XB 1X4XA 4F37K 2X10A 1FC2D 1HNFA 2V5RA 1I75A 3GSWA 5T3ZL 5L6YL 2JCCB 3QDJB 1KCUH 4TNWF 1ZVSA 4RFNC 4GG6F 4XP4L 4NUGH 3HMWL 4YDJA 4S2SB 2AP2A 1LNUB 4HGWB 4NQDD 4RIRA 3QG7H 3ARGC 3TJEH 1G0XA 3EBAA 2QEJA 1RJYB 5FYLH 4IRJC 2ICWB 5IFAL 3VFWA 4EBQL 3CCHB 4CVZB 5L2KD 5IESH 5F70A 1FVEB 2LE9A 3MCLH 4KVNH 4JR9L 5F7EH 1FZJB 1CDBA 4ZUTA 1M7IA 1G6RA 4DN4H 4YGVB 4PGDA 5CZKA 5A16B 4LLYA 1TJGH 4TTDC 5CGTA 3RKPA 1JHLL 4Z77B 5I17A 4YDIL 4OCRH 5D6CB 2RBLA 3QNZA 5ITFA 4UQ3B 2YZ8A 4FQIH 5CZXC 4KPHH 2C7UB 3EKCA 1U3HC 4PJHA 2JJTA 4AT6B 5E8OB 1C12A 4KHTL 5FYLE 4LSTH 3L3IA 3D39D 2OS7A 1P4IL 4ZSOB 5INDA 1EXUB 1I1AD 2B2XH 4M6MH 4WW1A 3BRGC 3QCVL 1U36A 2ESVD 4KK8C 1C5CL 3WD5L 4AEHH 1LO5A 2WK2A 1AXSB 5CJOL 2DJSA 4TQEH 4JKMA 4PJGA 1E4XH 4ZO8A 5DJAA 5ISZB 1NPUA 4L3EA 3WIHL 4Y0GA 3ARED 2AJSH 3TWCH 2CO6B 4NO3B 4F9PC 2VDRL 3SCMC 1FNHA 2PXYC 1FG2B 5JW4M 1JZ8A 5L2KA 1T1YA 1NBQA 3FO1B 2VERN 3V95A 4ZNEA 1CBVL 2EKJA 3MNZB 3O9WD 5IVXA 1XF3A 4I18B 2OP4H 4JDTH 5JZ7C 4K8RL 5D7JB 2ARJQ 2DQFB 2CPCA 2FJFA 1GH7A 5K9QG 5E94B 3VE0A 1T5XA 4NM8H 1I7UB 4YEFA 4HBCH 1MI5B 1EEYA 3IXAB 5JORA 2DLFH 4QRRB 4Y4KA 4HK3N 3WXWH 1CZ8L 2JELL 5E5UB 3KLDA 5F3BB 2C3GA 1EVTC 2A9ML 3TO4B 2I24N 2RCSH 2YRZA 5I1LA 2GW5A 4H88L 5EUOB 4N68A 3O4LE 4HLZG 3VD4A 2Q6WA 3FN3A 4ZFFA 5C0AE 3S5LA 2R0KL 1F6FB 4NHCL 3QIUD 5FKAA 1RPQA 3T4YA 3O2WH 4P4RA 2IWGA 2QL1A 4MZ2A 4HKJA 5A3IC 5CMAB 1JNNL 2P5EB 3R1GL 4Q9CA 5F1IA 3BHBB 1DBJL 4LCWD 4M5ZL 4G6AD 3LS4L 1MFEL 1BM3L 4ZXBD 3G5VA 2Y36L 4S1DD 4JM2C 4DEPC 4IS6A 1IGCL 4KWUA 3VG0H 4OCYH 5E9DE 3WIFB 1OB1B 1SM3H 2ZPKL 1OF2B 2O5ZL 1KEMH 1T21A 3PWPD 2VDNL 1JMXA 4Y5YB 4HWBA 2VL5B 2D7MA 4PG9A 3SDAC 3VA6A 2CGRL 4CJ1A 1E28B 4Z7QE 1TQCC 2H8PA 1ND0B 5KS9E 1LD9B 3HI6L 4G9FA 4OLUL 1K4DA 2Y7QB 3NAAL 2A9NH 2WLZA 4GW1B 4U33A 4P49A 1NCAH 5GGTA 1KJ2A 4D0BA 2FWOA 3BGFC 4HULB 4PRBB 4Y4FD 5DMIH 1H3PL 2DI7A 2DWDA 4BH8A 4D9QD 1HHHB 3OTTA 2OL3H 4ZDHB 3WFEH 5C70A 4XH2A 1NGPH 1H3UA 4KDTC 1C08B 1UVQA 2X4SA 2X6MA 4QHLB 3ME0A 1A0QH 2HKFH 5C0FA 4LSSH 2HT4C 4NNYB 3RJDA 4WEBL 2ZUUA 1DSFH 4P5TA 3S36L 1Q9KA 5C3LD 2OR8A 5L0QB 4PV9A 3V7AE 5ALBH 1SYVA 4JRYE 5C0CE 4BFIA 2HRPL 4CW1A 4HS8L 3F6LA 4Y5VA 3IGAA 1D6EA 1RZKL 5KTEH 2GUOA 2X09A 5DGRA 4OCNC 1MRDL 3O8XC 1H3XA 2J6EA 3O6ML 35C8L 1HIML 4IMKA 4UINH 4NO5B 3HC0A 2F15A 4BK4A 3OKOA 5EPMB 5KVDH 1GGBL 2PTVA 4TUKH 2V17L 5FYJU 5B8CC 4FRWA 4ELMB 2GSGA 1CXIA 5B4MC 1A3LL 4XT1C 4UT9L 1R0AL 1NKRA 2NY3B 4X6CF 2NXYC 3T0WA 1G7PB 1WISA 4JM4L 3KGRA 2Q7NA 3PP4H 4JFXA 4OGAD 4XHQA 2DB8A 4JFEA 1OGAE 2LVEA 4Z78B 3PUCA 2CD0A 1P9MA 3DPBA 4IHOA 1CDCA 3LN5A 4F2MA 2ICWJ 4V2CB 2CDEA 1AO7A 1TTGA 3EYQC 5I18H 1VFOA 4HF5H 4K94H 4KMLB 4TSAH 2JJUA 3TYGL 4P46B 4YDLB 2VTFA 5EU6B 4CU7A 1T5WA 1QBAA 2X41A 3O3EA 4L29B 4XXDA 2PW1A 5JUEH 3OAUL 1CXEA 5INCB 1B0GA 3IS1X 2J88L 3GZKA 3GMPA 5CP3H 3LEYH 5I1DB 1MCKA 2GSIA 4YPGA 4YX2H 4BK5A 4MNGE 1N59A 3MV8B 4OKDA 3JWDC 4A6YA 5JNYB 3TVMD 5KJRH 1XGQB 4OM1H 3QUYA 2YS4A 1DCLA 4OTXH 5E6IB 4KI5E 3U4BL 3SE3C 2X70B 4HIHA 5TQ0L 4HK0A 4NFCA 5CKGA 4HAFA 1HOCA 2EE6A 4EI5D 2V7NA 3B9KA 3NABL 4I0CC 4CNIB 4APQB 1ZLSH 4G8GD 2PYEB 4L4VD 4LRNL 5DC9B 3UJIL 5JW4R 4ZTPH 2GI7A 4ODXA 3O41A 3VGFA 5HYSG 5I74C 3VXOB 4L9DA 2HP4A 3N85L 1JVKA 3O3BA 3W5MA 1FH5L 4WV1C 2VUYA 5DT1L 3TN0B 3VWJD 5IJKC 2G75A 3LMJL 4X0KA 5JW4N 1N0LA 4MHHG 5I1HH 5JIHA 3RPIB 1MAJA 2ADFH 4OSUH 2R1XA 1PG7L 1INQA 5E2WL 3T65B 2BNQE 3RY4A 3DOSA 4JFFA 1J0YA 3AVEA 3QA3B 4HWEH 3OB0K 1BVZA 2EXWD 4NQCD 4JJ5B 4QTHB 5FYKL 4YZFF 1TXKA 2DLIA 4I0PD 2ADJA 5D2LF 2OBGA 5SWZB 5EWIH 2YBRB 3CNKA 5LBSH 4UTBH 4CAGA 2YD8A 2VYRE 1CT8B 3ZL4L 5BOZG 2CLVA 2YRLA 5J7CC 5F1KC 4U3XA 2YA0A 5IWLC 1RJLB 1I8LA 3GSXA 5HYIA 3EYUL 2DM3A 2UZYB 4UDTA 3MRDB 3ZDZE 1SY6A 4O9HL 5GZND 1UWGL 2I5YL 3BP5A 5FA3B 1NDGB 4JPKL 5C0RL 4P23C 1HH9B 3QDMA 4RZCA 4PJEB 1TVBB 1RFDL 4KKBD 3VGAB 4C56B 4X9IA 3OF6A 5AZ2L 1PX4A 5DMGD 4ZFGH 3DARA 1I4FA 3MJ7B 3OWEA 2Q3ZA 4NIKB 1HI6A 1QRNE 3K80A 1WBZB 5HI5D 3R06A 3RZWA 4BUGA 4DUVA 5ILTL 3HE6B 1MLCB 5I8OH 3RX7A 1CL7H 5IHZA 2V2TA 3RVUD 3O45B 2LABA 4ZPVB 4M5YL 5CJ5A 3L3DB 4KUZH 4G43B 5ITBH 1BAFH 1C8PA 1OTUC 4PJXE 1RZIA 1ED3A 3C60C 3QCUL 1UH3A 2ZCKL 2NLJB 3Q1SH 5H94B 1OM3H 2D31B 4NZTL 2E6JA 3JWNC 5CEXA 5I6XC 1QG3A 1JYXA 1S7VB 2WWMD 2VLJE 3IDIA 1CU4H 2OJEA 1S9KC 3LKPA 3LS5L 3ROOA 4MAYA 1D6VH 4FXGB 3V4PL 5FGSA 4AEFA 3TBYB 3RWIB 4PGJA 4QXUL 1T66C 2OCFD 4XI5D 3RGVA 1WWAX 1DLFL 1LWRA 3VXSB 4PG2A 4Z6AT 2HMIC 5J06A 5ALCL 3IKCB 1A2YB 1FPTH 1DBKH 1F58L 2E6PA 3WFHA 5BVJB 3EAKA 5IQ9A 3VXNA 2XZQL 3SQOL 1R24B 1GGCL 1JIBA 3CDYA 3N1GC 2N56A 4QRPD 4KROB 1FNFA 3KR3H 4POZC 3U9UB 4YXKL 2Q8BH 2IMMA 4DVBA 1TETH 5JHDE 2WWKO 1NBZB 2PTTA 4K3JH 1J8HD 1P2CA 3BQUA 3O4LD 1J86A 1BD2D 2J5LC 4PUBL 3W2DH 4OIIL 4M4PA 1W0WA 1G9NH 1X5KA 3P4OA 5JXEC 3CX5J 2VXSH 2BOCB 5D2NA 4Y2OA 1URLA 5MHSD 4NKIH 2C9AA 1R3LB 3IS0X 3PQYB 4GRMA 2AI0H 3LB6C 1IC1A 5F1NA 4QRQB 4YPJA 4GMSH 5IIEB 2VZ1A 5J1SC 4LAQL 3WIHA 5ID0B 1CFBA 1WV7T 1YEKH 3DRTB 1UM6L 3LD8C 3MLSL 4N0CC 3EO0B 5E9DD 3LKOB 5DSCA 1E4XI 9CGTA 5EO0B 3H9HB 1LDPH 5D71H 1L4IA 4KJPC 5C07E 2NX5B 1BBDL 4W4OC 1KG0B 1NAKL 5D7IB 1A21A 4G3YH 3T3MF 2E9IA 5E2VH 3CFKB 5CHNA 1YN6B 2AERT 3CDGB 3LEVH 4PPTA 1NGQL 4W81A 3GKWL 5EU3B 3TNMA 1NGYA 2CIKA 1N8ZA 3MRQB 1RZJC 5CP7B 3L6FA 1FLRL 1BGXH 2VXVH 3ZO0A 5JDSB 5ID1A 4JKWA 4ODSL 4WI4A 1IJ9A 2NY1D 3S3SA 4OLWH 3L5WA 1YQ2A 3UYRH 3C5SA 5I73C 2KPNA 1NAMB 3MV9A 4QNPF 1EK3A 4PJBB 1Z5LB 2CMRL 1V3JA 2XWBB 1KN2H 2Q7YA 2VB5A 5BS0B 3MYJA 5HYFA 2C3WA 4JRYD 1AJ7H 3X11B 5C0CD 1MFCL 1WC7B 4LEOA 3DXAD 1JGLL 3EFDL 1AGCA 2EDRA 1HSBA 3QO0B 1CLYL 1FZMB 1EJOL 4P2RE 2DL9A 2X1OA 2V2WB 5HTSA 3QWRA 5D9SA 4P4KD 5ETUA 4Y19B 4MXVE 4M7LH 1AD9B 4K3DH 3FFCD 1S7WB 3I50L 3QEQE 4IRZH 4RGNC 2BVEA 1L0XA 1MQKH 4DFHA 1KC5H 4G8EA 4JZJB 2VXQH 5DEGB 1CGYA 3SY0A 5IGXL 1WEJH 5IVZB 1JE6A 4ETQB 5GGSY 4XPGL 4WW2B 4F7TB 5D7LB 5FO9B 3EYVA 2AXFB 2BNRE 2EDHA 2Y1VA 3A6OA 4WUKH 3VFUA 1QQDB 5IMOB 2IG2L 4BFEA 3GFUA 1KENH 2UUDK 3PL6A 4YK4B 5I19H 3ULUF 5CUSL 5K9OA 4XP6L 2Z4QB 2FCBA 2RFXB 5BVPL 1YEJL 1P6FA 1R3KB 2BOBA 3DETD 3OKYA 2DQTL 2DD8L 3V4VH 3WNLA 4UILL 3LQMA 4GRWF 3GSWB 5C0BA 1ZVSB 4L4TD 4R26L 3MQIA 4YDJB 3WL9A 3MRMA 4RIRB 2HVJA 3HB3D 5MEPA 2BJML 2EH7H 4P4KA 2XNAB 4QEGA 5CBEB 5KZCB 1AY1H 3CZFA 5DMYA 4FQQA 5TE6H 2NXZB 5EZJA 2VE6A 2APXA 4DGIL 4NZRH 2MJWA 3AROA 1EGJH 2DF3A 4L8CA 4CMHB 4ZUTB 3ZYOA 4JPVL 4O2CA 2GT9A 1IFHH 1M7IB 1TJIH 5F6HI 3VWKC 3WJJA 1OTSD 3NTCH 4PGDB 3RAJL 4LLYB 2UY7A 1T04A 4AIXA 5EOQH 5FHAL 4K55A 1IQWH 3QNZB 5ITFB 1FLTX 4G42A 2DQUL 3QRGH 1A7RH 1S9XA 4Q0XL 4HFUL 2F8XC 3EDJA 4NGHL 1TZGL 3ULVH 3HS0A 1MELA 1C12B 3L3IB 3B5HA 3OZ9H 4OZIE 5INDB 1JPTL 4ZUSA 4WW1B 3X12A 4GG6A 3DYPA 3FONA 5F7KC 1JL8A 1RUAL