1H3VA

Crystal structure of the human igg1 fc-fragment,glycoform (g2f)2,sg p212121
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
207
structure length
207
Chain Sequence
PSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPQVKFNWYVDGVQVHNAKTKPREQQYNSTYRVVSVLTVLHQNWLDGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSREEMTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Immune system
molecule keywords IG GAMMA-1 CHAIN C REGION
publication title Structural Analysis of Human Igg-Fc Glycoforms Reveals a Correlation between Glycosylation and Structural Integrity
pubmed doi rcsb
total genus 29
structure length 207
sequence length 207
chains with identical sequence B
ec nomenclature
pdb deposition date 2002-09-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1h3vA02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1h3vA01
1YC7A 2R4SH 1LO0L 4OF0A 2UZXB 1H9VA 2H8PA 4G7VH 2YEZB 3WIHA 3W81A 4XPHL 1IKNC 2Z92A 3TLRA 1T5WA 1GOHA 4R4NC 5KS9B 3TO4A 1RIUH 3L9RB 2YC1B 4Y1AE 1OHQA 3C5SA 4EQ2A 2ZJSH 2EYSB 3MNWB 1YPZA 4HT1L 3VGHA 1IILE 2ZG1A 3HZKB 5T5NG 4ODSH 1U92B 4ZDHB 3QAZC 1SY6A 4G9FA 1L4IA 2Q1EA 1DANT 1Q1JH 5IVXE 3IDGA 4WHDA 1FZMB 1G9NC 4RFNB 1I3GL 3VFOB 1EGJH 1BZ9B 2CSPA 2BVOB 3IF1A 4G6JH 4P5TA 4M61A 4K3JL 2FZ3B 5ILTH 1LEIB 1MCEA 1QEWA 1R3HA 5KZCD 4KI1A 4PREB 3RZCC 3KYOB 5EA0L 4RIRB 1WISA 4FN0A 1G6RH 1IARB 2YD1A 4AQ1B 1S7XB 3UYPA 4QTHB 3V7MA 1KB9K 5E8EB 3CK0H 2B4CH 3D48R 4WO4B 5MHSE 3B9KD 3CIQA 1MAJA 4I1NB 3T8XB 4L4TB 1WZMA 5IGXL 1G7PB 4JVUA 3WN5A 1FFOB 2X09A 4WTXA 4HEME 1MFEL 5DHYA 3WSQH 3GMRA 2EIEA 3ARPA 4OGXL 1U3ZA 1Q9KA 5E9DB 4KQ4L 5E6ZA 3KHOA 2HA1A 5I18L 3A6OA 1YUHA 2FX9L 4JO4L 4RMQA 1LEGA 4MJ6A 2J6EH 4CW1A 4WENB 4F9LC 3MA9H 2BOCA 3RTQD 4IRSB 2VAAA 5ESAB 3GKZA 1EPFA 3TESA 1UH2A 2R0KH 5F96L 4PRNA 3ET9F 1LO5B 5ESQB 4F7MA 4X6DA 3CFCH 5FYKH 4K8RC 3TBSA 2OL3L 1I1FA 5TGBB 5JPNB 1UJTA 3S4SG 1MHHB 5DD0H 1A5FL 1VFAB 3HNSH 2X89A 4NN7C 5FDWB 1JZ7A 1AKJA 5JLZA 4UQ2B 1INQA 3MLSH 5GGTL 3DX7B 3EDJA 3DVNB 4GH7B 1EERB 3JWDC 3HB3C 3RPKA 1VFOA 5BVPL 4KV5E 4PTTB 2KUTA 2R0WH 3SKOA 4HWZB 5CSZA 3KPMA 5D70H 2JJSA 2A77H 4LDLB 2D7TH 4YC2B 5SWZE 3DUUA 3K2MC 3ZT5A 1X5XA 4MD0A 2DQUL 5C09B 3GMMB 3OGCB 1S7TB 5F3BA 1N0XL 1F3JA 2BNRE 1NGPH 4YDJB 5C2BL 2NXYB 1GGIH 2NX5E 1HYSC 3FCTA 3QI9D 1FL6B 1AGDB 1FAKT 1Y18A 3S36L 3PL6C 3WFCL 2EDWA 1HHJB 1WAAE 2ZUUA 4RZCA 5D6DA 4N90D 3VI4E 4WFFD 1MCHA 2DQCL 4JO3L 4GQ9H 3RGVD 3X3GH 3DVGB 3WNMA 3ARWA 1I7TA 2PXYD 1U6AL 4NRXB 3MNVB 2HRPL 1RUAL 4F33A 1T7XA 4PGBB 2D3VA 3MMEB 4YFLI 4JDZA 4ODUB 1LO3H 2B0SL 1V7NL 5E1HB 4OFYA 1ZANH 2AAVA 4PRAA 1NBQA 4Q9BA 4QXWA 5J0BA 5CWSA 3ARYA 1UJ3C 3BZEB 4KJPC 2UUDH 2G60L 2D7NA 4HZLA 4D9RE 3PE9A 3R0MA 5FO9B 2CKBB 4DZ8B 4FQQA 2IG2H 1N8ZB 1A7RH 1AXTH 1A7NL 3O4LD 4QXGL 3RKPA 4NNXA 2NR6C 5C08B 4BSJA 3NCCB 4O2CA 4XCYB 5TH2A 1MH5B 5ITFA 1JWMB 1DSFL 3O8XA 3ULUE 4NQEE 2D0HA 3VE0A 1DQJB 3W0WA 2QSCH 4DEPC 1FZKB 1CFBA 2YUZA 1K6QH 2CK0L 4L4JA 2PW2B 3AS0A 2ICWJ 1CI5A 3O6MH 4KMTH 5INDB 1ETZB 1H5BC 4M6OH 2DQHL 1RUPH 4S1DC 5FKPB 2V7HB 4HDIB 3C5ZD 3AGVA 2FHCA 4UT9H 3UROR 3F65A 5L6YL 5DJXB 2J12B 5IK3A 3OAYH 4Y5YB 3OJ2C 5D1QB 3O2DL 4HIHA 1FFRA 3CVHH 4JVWA 5HGBB 5DJZB 4M48L 1YJDC 3EJJX 4LRIC 1NMBH 2NXZC 3NIGF 2AS5M 4G6KH 4DCQB 1VGKA 4DFHA 1EEUA 1AO7B 3G5YB 4ZOCA 1W8OA 5E2JA 1TZIA 1ZT4A 3MLVH 1I7UB 3DRTB 3QIBB 3NABH 4QYOB 5SWSA 4JM2C 5BS0D 3OAZK 4MA3B 3SBWC 5KANI 3STBA 4M7KL 4CN1A 3LHPL 4Y2OA 3SY0A 2VDQH 4TULH 4PRDB 3QUXC 3AAZA 4K8RH 3TN0A 3MX0A 4ORGB 3UPRB 4AT6A 1KIUA 3RWEA 2ILLA 1JNNH 3H3PL 1WT5C 5B38B 4OZ4B 3W9EB 2VZUA 5FUOL 4PBXA 3KVQA 1KJVA 5F7WC 3DURA 2Z9TA 4Q0XL 4Y4FD 1YECL 2ZOLA 1NLBH 1Y6KR 2D0FA 3MV9A 1RI8A 2DBLL 3IJHA 5DTFA 2IPUG 4XP5L 1XGQB 1U8NB 4DVBB 1OLZA 1T83A 1K4DB 2IAMD 5CEYA 3BRFA 4F7PA 2Q8BL 3I2CL 4B50A 1QRKA 5I1IH 3G5VA 4PLJD 2P48B 3HPLB 5DRXA 4EQ3A 1UWXH 2J5LC 3VXUE 2V2WB 2IPTL 1XMWA 1D9KA 1T0PB 4P4RA 2NY1B 1PYWA 1U9KA 5D1XD 1KJMA 1PZUB 3VDCA 3C9NA 2D03H 3PGCB 4TUJB 3ZZ1A 4X6FA 2OSLB 3ROOA 1RZGA 3CNKA 2DLFH 4I77H 5JHDE 3BKMH 1T1YB 4H88H 4OUUB 1WZLA 4HK3J 4P46B 3EYUL 1MHCA 4H1LG 3PP4L 1DQMH 5HDOA 5JIKA 5DK2B 4QXUH 4XAWH 5SWQA 1WV7T 1EXUA 3GRWL 4OLYL 2FGWL 3GSWA 4DN3L 4OCYL 1B4JH 5F8QC 3ARXA 4AH2A 5JXEC 5AYUH 1A0QL 4PJ9B 2A6DA 2HT3C 5CUSL 2YRLA 4I2XA 3D69B 2P42B 2EH8H 2AJVL 3OPZL 2EE9A 3EO1B 1TITA 1NEZG 5FCSH 1F90L 4WJ5B 5HVGB 3TBYA 4OZIF 1DCLA 4PGEB 3ZO0A 3TVMC 1WEJL 2FJGA 2A9NH 3UPAA 2GITA 1QSZA 4UIMB 4HIXL 2DIAA 5MP6H 1LNUA 3HAEH 3ZYZA 3QDME 1Q9OA 4GLRI 4GLRH 5DVNA 4L8CA 1WK0A 3MRJB 5JW4N 3OKLB 1QNZL 1JGLL 1R0AH 3MREA 5D2LF 4XBPB 5GGRA 4NWTH 3INUH 2H1PH 4FQLH 1JHKH 1KGCE 4K3EL 2ED8A 4CVXA 3STZA 4DVRH 3T4YA 1CXEA 1YJDH 5F9JA 3B9DA 1AQKH 5BQ7A 2YPVL 3SO3B 4L3EE 5EU5A 3SDXA 4OFVA 4KUZL 1TENA 1J8HB 4Z7OE 1XR8B 1J9CT 2CMRL 4RMVA 5IF0A 3HMXA 3T0DA 1OPGL 4TTDD 2DI7A 2IEPA 4J1UA 1HSAA 4GMSL 1A1OA 2XA3A 3SDYH 3O45B 1E0OB 3LV3A 3P30L 2OM5A 4B7IA 5EUKB 1SJXA 2BVTA 4MMZC 3TZVA 4XVTH 4D0CB 4JHWH 2HJFB 4NPYA 2BNUA 2DMBA 2IANB 4X9GA 3ROLB 3EOTL 5FYLD 4C59B 3IU3B 2Y1VA 4Y16B 4RWHA 5T3ZD 5HI3C 2P47B 4Q6IC 1XF2A 2E9WA 3HCVA 2WANA 4KPHH 5EOQL 3VFSB 5I1CH 4UV7H 5GRZA 4UINH 2EXYD 1VEOA 5IMOB 4ZFZB 2F9BT 4JFOA 2K7QA 2FO4A 5D2NE 3HE6C 4HBCL 4U1HB 4RNRB 4DK3A 4DOHB 5INCB 4U49A 1XF5A 4WHYG 1BQHB 1T03L 4U1JA 5AG8A 3BEWB 4BZ2H 4OD1L 1MIEH 3LN5A 3KPNB 4XVSL 1I1RA 3QXDB 3QDGA 3QHZH 2D7PA 2BSRA 1FNAA 1C5DB 1HIMH 4EUPH 4LCWE 3JWOL 2CRZA 4DN4H 3WNNA 3X17A 3BKYH 2OI9B 4PJHB 2DKUA 5GGVY 4LNRA 5KAQG 2QADD 1S7UA 4Y7MA 5J89A 1I8KA 3T65B 4J3VA 4LCCC 1CLZL 4RBPH 1OAKL 3KAAA 3Q6GL 1OAZH 4S11A 1KEGH 4RGND 1NFDB 4OF6A 3MV7A 3ULVE 2D9CA 4RDQG 4I13B 3V6FB 4LGRB 2EEDA 3SGJC 1RPQA 3U7YL 1MY7A 3S4SA 1SJHA 5A3IC 4XP1L 4BFGA 4BQCA 4EBQL 4KJWD 5I2IB 1VFBA 4TQEH 5E8DH 3U30C 3SQBA 3PWVB 3GZKA 2X4NA 4XX1G 3OL2A 3L3OA 4P2OA 4Y2DC 4KK6C 1J10A 2R2EB 5GISH 1U8MA 1QRND 4PJCB 1UB5B 2XN9E 1Y0LB 3U4AA 5D7LB 3GSXA 4LSSH 4POUB 3GMPA 1DUZB 3ZDZE 1S78C 3D5OF 5T1KD 1HI6A 3DX6A 1KNOB 2HWZH 3VFWB 3IXAA 1JGVL 2E27L 3MLXH 3NCMA 2K7PA 5EZLB 5HGHA 3K74B 3QCUH 3QO0B 4OLWL 2FL5B 1NCTA 3QRFM 1FIEA 1WFTA 3LKOA 4NM4L 1UCBL 3K8KA 3WLBA 1MUJB 2MCPL 4LKXA 4MA8H 1FYHB 4QOKB 4QCIB 5I30H 2NY6C 3VXNB 3IDXL 3ZKNC 1N6QH 3QAZB 4G6ML 3I6LE 1HWHB 1CLYH 3KYKL 4XAKD 2WUCH 3IS1X 1UWGH 3H8NA 4GBXD 3D85D 3DV4A 1DBJH 3QNYB 3BSZH 4NKIL 2KPNA 4Q9CA 1MREL 1KPVA 4OKVA 4P3CL 2AJZB 1V3JA 4IM8A 5E5MB 2Y7QA 2VL4A 4OGYL 3VXSB 1ZLSL 3GIVA 3RZCB 5HJ3A 2R29L 5D7SH 4LPTA 4UDTA 3FTGA 3DO7A 1NAMA 1T5XB 1FSKC 2Y23A 3LEYH 4KFZC 2ZKHH 3ILPA 3QEQA 1OTUD 4PTUB 4FZ8H 1I1CA 4HK3N 4HAFA 1CF8L 2D31A 3WKML 5B4MD 4I4WA 4JN2A 1P4BL 1SVZA 4G3YL 5DFWH 3CVHB 5C3LD 1FNGA 2ADIB 2VLRA 3MCKB 2EDYA 4P9HC 4KTEL 3VGDA 3ARGA 3G6JF 2VR9A 1K5NB 4PRPD 2WZPD 3N0PB 4UZGA 2YPLD 2A1WH 4UQ3B 1RJZA 1BQLH 4H8WC 4U1SB 4G6AD 3U2SB 4HFWA 2DQFB 4BKLB 1OGAA 1CYGA 1FE8H 5D9SA 1IGJB 3W5MA 4N5ED 3V5KA 1TVHA 4X4YA 5DD6B 1I3GH 3BPNC 1HKLL 4ZD3H 2DD8H 1U8KA 2BSTA 4V1DE 5I15L 3ULSA 2EE2A 3UYRL 4NHCL 5C0FA 3KYMB 2OK0L 2GAZA 2NY5C 4NN7B 1WSST 3LSOA 1HE7A 1FNLA 4RAVB 3UEZA 1QSEB 5I1EL 4HULB 4XVUC 7CGTA 5SV3A 5D93C 4D94A 2VN4A 2A73A 2Q6WA 4Q9RH 1OY3B 4OSUH 4EOWL 2EYTA 4LLUA 1FFNB 2VDOL 3OSKA 5KSUB 5CJBA 1JWSB 3RWCA 4X6CE 2MQ0A 3E1F1 5ANME 5C0CB 1JWUB 4G7YH 4LCYB 2AXGB 3CX5J 1QSFA 3M17B 2YKLL 4V2BA 5BRZA 1PY4A 3KXFA 1A4JA 3BAEH 1QFUL 4R2GD 4R7DB 4PJFF 5BV7L 1PY9A 5D8JH 1G9NL 4OZHB 4H20H 5B38G 1V7MH 4UT6H 5L9DH 3SDDA 3ZL4H 1FIGL 3FFCB 5EU6A 2XA8H 1LDSA 3PL6B 4XNYH 4AEHH 1Z5LA 5JW4R 1I9RL 2DMKA 3FQWA 1U95B 2HFEB 3DSNA 4LSUH 3MJ8A 4S1SH 1CIUA 4L8BB 3UTOA 2JE8A 5K9OB 1RIHH 3JTSA 1HILB 3UXFA 4R97C 1U8LB 3OB8A 5TQ2H 4MNQA 1YEDB 5LCVH 1RUML 1UQSA 4FA8A 2P46B 3ZDYF 4FQ1L 3CDGB 1T22A 3MODH 2WMPA 4GW5B 1MLBA 2FJHB 3HKFA 3QPQD 1UJ3B 2VLKE 1CDIA 5ADPH 3QJFB 5IVZB 4HW6A 4KRPC 2CLVB 4OM1H 3U4BL 1YDPA 3BZFA 2MNUA 5FV2A 1XEDA 2HP4A 1OWRM 4JY5L 2EDJA 3BVNA 4LSQH 3LQZA 4P2QB 3V4PH 1ZT1B 1JTPA 1T6WA 3MJ9H 3P9MA 3MV8B 1CD1A 4H1LA 4DEPB 1HXYA 4JDTH 5HHMD 3DUHA 3U9UB 2GJ6B 3DGGB 5LXGL 3HAEB 4DUVA 3QHFL 1H5BB 4ZPVB 3DROA 3IRZA 1I7ZB 1S7RA 5J1AA 2YUWA 5J8OA 5E6IC 5I9QC 1ZTXL 3P0VL 5FF6A 3JVGC 3DUSB 1CK0L 3AXLA 5D7JA 3T3ME 1NEZA 3PJSB 4EVNA 3CUPB 5E2VL 2H32H 4P9HH 2NXZB 1FG2B 1N7MH 4HJGB 5IB1B 5E0QA 5EBWB 3IDIA 1A6WH 1MWAL 3E3QC 4H8WH 4LMQI 4JM2B 1IBGL 5GS3A 1BD2D 2EH7L 1EFQA 1MEXH 4DGYL 2AABL 1RULL 2V2TB 4PLKD 3CSGA 1G9MC 3U48A 1R5WB 3EGSA 3QUXB 5KOMC 1DN2A 1JN6B 3RIFK 4TVPE 5SX4I 5SX4H 4H0GA 3PWLB 1YEJL 1IKFH 2P5WB 4YEEA 1MI5D 3BX7C 1U8JB 2NY5H 1R5VA 3QIWC 1JVKA 1A7PH 5LWYL 3TBWA 4P4KC 4IDLA 4QHMA 4OCWL 1RUQL 4X7TA 2ZWLT 3DPBA 1KTDB 4JRXE 4HGMA 4U31A 2OL3A 1KC5H 4Z5RB 5IJKA 5LJYH 2YXMA 3O9WC 4Z8FH 1ORSA 3BDYH 5CZKA 5FYLL 3E0GA 5BMFH 1JPST 2RAMA 3ZE0F 4JPIA 5GGRY 4I0KA 3B2VL 3V0AC 1PX4A 1UYWH 5KS9A 2QQNH 3L9RA 2YC1A 1ZS8B 2I9TB 2GJJA 3N85L 3T09A 4A2LA 1HH6B 2EYSA 1ADQH 3MNWA 3CDFA 4WW1B 4X83A 2J5LB 5CEZE 3HZKA 4JFEB 3NIDE 1U92A 2VTFA 4ZDHA 4DFIA 2DJ4A 2AEQL 2VZTA 1NFIB 1IQWL 4ZUTB 1A3LL 3SKJH 2CH8A 1T21B 3LKPA 2QQKL 2L4OA 35C8H 3IT8D 4I0PD 3VFOA 4EUPB 1BZ9A 2BVOA 4NQDB 2MCG1 5GGUA 2Q86B 2FZ3A 3OG6B 3OZ9L 1LEIA 4PREA 3KYOA 4RIRA 1SEQL 2MPAL 4LFHD 5J7CC 3ETBF 2B1AH 3MTRA 1VKXB 2OTPA 1S7XA 5E24E 4JLRB 4QTHA 5E8EA 2DBLH 1BQHG 3BH8B 3QQNA 2F5AH 4XP5H 3JTTB 1T3FA 3T8XA 3MRLB 3GSUB 4L4TA 5JHLH 1G7PA 4HC1L 1A6UL 5GGSB 5JMRA 1FFOA 2RFXB 3KNBB 2GQHA 3EO9H 4HS8L 3QEUB 3VDBA 1EJOL 4GJTB 5E9DA 1IL1B 4MNGB 3BN9D 2WSKA 3VWKC 2P7TB 4CNIB 4N0YH 1UM4H 1NCCH 3H7BA 4ZO8A 12E8H 2BNQD 4QGTA 2QEJA 1BM3L 1QSFE 3TVMB 4IRSA 4XXCC 5ESAA 1M7IB 5L88L 3KS0J 3AM8A 1OT1A 1Q72L 4OCMC 1YEHL 1LO5A 1YYMH 5ESQA 5B39B 3D3VB 2I5YH 3HRZB 1ES0B 4JHAL 4XPAL 1MRDL 5TGBA 2DYPD 4ZAKC 4TSAL 3HC4H 5JPNA 5TE6L 1MHHA 1VFAA 5CLWA 1F6AB 1DLFL 3ZLQC 5FCUL 5FDWA 3WHE1 3BHBB 2UY6A 3EYUH 1YPZF 3O4OC 1M05B 4UQ2A 3RA7H 3BRGC 3HMWL 2ZUVA 4JFDE 3DVNA 2ZCHH 1G7IB 4PTTA 5DC0A 3EJZD 2VWEE 5ISZB 3MNZB 4HWZA 4LSDA 5I8OL 4WEMB 2NZ9D 3O2DA 1P4IL 1MAML 3O3DB 2QBWA 5F7HA 5C09A 5GS2H 3OGCA 1S7TA 3MRBB 4D9QD 6FABL 2CR6A 1G9MH 5ECJE 1JHLH 4QLRA 1FL6A 1AGDA 1XFPA 4PRHB 1K2DB 5F1NB 2OCFD 1B0RA 4JFFD 1HHJA 3FB6A 3RGVC 4MCZB 1RFDH 1DQDL 1IAIL 3DVGA 4ZUUA 3TEUA 4NRXA 1UACL 1K4CB 2VYRE 4M5ZH 4PGBA 1L0QA 5F7EL 3MMEA 4ODUA 1YYLL 2DQDL 4E5XB 1JCKA 4R6UA 2YD2A 4Q6IB 2ZG2A 4LHUD 2DKSA 5HHQB 5EU4B 5FYKU 3DSFH 3S6CA 1F97A 3BZEA 1YNKL 5A40E 4FQXD 5GS1C 3HE6B 5FO9A 4GMTH 4X6DF 5DRWB 3IFNL 4WY7H 2CKBA 1GIGL 4DZ8A 1D5MB 1DQQB 1WBYB 1N8ZA 1GSMA 3ZYIA 4FTVB 3S37X 5DQJB 5C08A 1Z9MA 3GBLA 1MH5A 1UM6L 1JWMA 4X7DC 3F6IA 2XZCH 3NCBB 2R8SL 5D1ZC 5JQ6H 1DQJA 1NDGB 4GXUN 3V4VH 2V9TA 4PD4J 1FZKA 4S1RL 5DFVC 4PJIE 4PR5B 1UKSA 3RUGE 2RB8A 5CZVL 2PW2A 1XF1A 3P77B 3WJLC 3MFFB 5INDA 1ETZA 4LCCB 4EN3C 4L4VE 5FKPA 2V7HA 5KANG 5GRUH 1JF6A 4HDIA 5DMIL 3OXSB 3C60D 3FZUC 5DJXA 4YZFE 4HZAA 3F7PC 4F58H 3MJ7B 5FO7B 1VGEL 3LZFL 4Y5YA 1I3UA 2F8VA 3LIZL 2H2SD 5FA3B 5D1QA 2YPKB 5D71H 5EZIL 4PJGE 1LILA 5HGBA 5DJZA 43C9B 1K3IA 3SGKA 1MCBA 5IHLB 3REVB 4DCQA 3H3KA 2V9RA 4LLMB 4MLIA 1AO7A 3G5YA 3U30B 3GRWA 2W9DL 4XNQB 3C6SB 2K1MA 1I7UA 3DRTA 1T03H 3QIBA 4MJ4A 1WZKA 4QYOA 4Y2DB 2NLJB 4UTBH 2XTJD 5B3JE 2EDOA 4FQJH 4U4BA 3UZVB 3ARED 2YA0A 4PRDA 4NNPH 3V0VB 4ZOAA 4XCCL 1A6ZB 5T1LD 1TJGL 3NGBC 4YE4L 1AI1L 3U0WL 3UPRA 5KSBA 5B38A 4OZ4A 5DQDH 3W9EA 5FYJD 2YN5A 3JUZA 4XP4H 2X41A 1YEGH 1HINL 1UGNA 3DMMC 1DL7H 3RU8H 1OM3L 3T2PA 1CU4L 1JRHI 1JRHH 4P2RB 3NH7H 4MAUH 3F6LA 2NY6B 1XGQA 1U8NA 4DVBA 1CL7L 1K4DA 3HI1B 3MO1B 4ZFFB 4U6VH 5IMMB 1BMGA 4P59H 2R15A 5D5ME 4LAQL 1IC4L 3HPLA 5AEAA 2QQLL 5C0JB 4CAGA 2V2WA 1IGCL 2WQRA 4Z7UE 5HGAB 4EXPX 1V3LA 3RKDD 1MQKL 4C54A 1YEKH 4ELKB 1MNUL 3CGTA 1FSKB 3PGCA 5KVGL 1CQKA 3BYTA 3FQUB 5E2UH 1JGVH 2OSLA 2W91A 4HPYH 3EJYD 1T1YA 2R0ZL 4IOIB 4OUUA 5D72L 1KXVC 4LPVA 3PWUA 5KSAC 1S9YB 2A83B 1UZ6E 4NZUH 2H32B 4P46A 2IQAB 4LARL 3B9AA 5DK2A 5DUPL 1YMHB 1EX0A 2QSVA 4HWBL 3HAEG 4MXWL 1QHOA 4LKCB 2CO7B 1E4XI 1E4XH 1RVFH 1SMOA 2HJKB 3SJVB 3L7FB 4F7EB 1W0WB 2P5EB 5ACLA 3BPNB 3D69A 4WFHE 5E2WH 4D9LH 3EO1A 5AZEH 4KHTL 1WWCA 2DOCA 3EYSL 1K85A 4WJ5A 1HK6A 4HFUL 4HMDA 5AZ2L 4OLZH 4PGEA 4KU1A 2SEBB 3GJFA 5D93B 4AJ0A 1RK0B 2R0LH 5B8CC 1A6VH 4E41E 1QLEH 2XV6B 3MRJA 3L95A 3OKLA 3D0LB 3L5HA 4X9IA 2JCCF 5JW4M 2G75B 4XBPA 3K7UA 3QDJE 3L7EB 1GPOH 4PS4L 5D7IE 3H9ZA 4JDVB 2VQ1B 1PG7L 4MDJB 1P7HL 4HGKC 3KWWB 5AAWA 1LO4H 2EZ0C 1HCFX 1CGSL 5E2TH 1IFHH 4GAFB 4KKBD 5CP3H 4S0TD 1EJ6A 1KCUH 5MEQB 4P3WA 4POZD 5B21A 4LEXL 3U0PB 1XR8A 2ID5A 3VCLB 2Z0BA 1MJ7H 2ARJQ 3BEVB 1EGJA 4LVEA 1P84J 1FH5L 4JHBA 1FRGL 2EDFA 1X5YA 3BZ4B 4R97B 4HCRL 1RMFL 4Q58C 3WNPA 4U6YB 1Z0NA 3O45A 2EEBA 3V6OE 3I02B 1XGUB 1X6LA 3MLRH 5EUKA 3QQ4B 1H15B 4WWKD 3UTZB 4D0CA 2QQQA 2HJFA 2GJZB 3C2AL 4P57B 2IANA 4NOFA 4NJ9L 1AXSB 5IFAL 3ROLA 3NAAH 4RISH 4KRPB 1GL4B 2V9QA 4Y16A 4KTYA 5F7MC 4APQD 1QFWM 5IBTL 5L2KE 2DDQL 1L6ZA 1NGWB 3UC0H 4EUPG 1N6VA 1KIPB 2F74B 5BV7H 4OCSL 1L7IL 5IMOA 4ZFZA 1GXEA 3P9WB 2HLFC 5JUEL 1F4WH 2J6EA 4ERSL 1J1OL 4FOMA 5FUCC 4F3FB 5H37H 1RZ8B 1BQHA 2FBJH 2J88H 4XC3H 3UTTD 2IH3B 2FH6A 3G6DL 3BEWA 4MVBD 4LL9A 5BJTB 2PO6C 3TT3H 4B5EA 4QT5B 1IZJA 1T66D 2ARJB 2W0KA 3RWGA 3KPNA 4L5FH 3QXDA 5JQHC 1I9JL 4LF3B 4RMUA 1RZIB 5E6IB 5I9QB 1C5DA 3GO1L 4XNMB 4TPRL 1MRFL 1RUMH 4JKPL 2E9BA 1X9QA 5I1HH 3ZMRA 2OYPA 1JYVA 3T65A 1QUNA 4ALAL 3SDXF 1RIVL 2R1WB 3Q1SL 1NFDA 4K2UL 3PHQB 4Z0XB 1OAQH 4JPVL 1KCRH 5B39G 5KSBE 4Q74A 2BCKB 2UV3A 1B6UA 1KB9J 1BAFH 2EXWC 2VJXA 4R4FH 5DEGB 2PYED 1XF4B 2HTKC 4UV4H 5I2IA 3FAWA 1G7JB 5T5NF 3BKJH 3IDMB 3TH4T 2W59A 3PWVA 1MF2L 3O2WL 1U93B 5JIPA 3QIWB 2RJMA 4RWYH 4QRRB 4P4KB 5DC4B 4N68A 3MRPB 4HKXB 1YEFH 2X7LA 4PJCA 1AY1H 1Y0LA 5D7LA 4XCFL 4PGDB 4N8VB 1DUZA 5IFHL 4XBEH 4Z78B 4LSPL 2DQGL 4EZMA 3O9WB 3DXAB 1KNOA 3VFWA 2UY7A 4PUBL 3U7AA 1SVCP 3AROA 5EZLA 1IKNA 3QWOA 5C6TH 4OFDA 3QO0A 5JXAL 1S9VB 1WFNA 2FL5A 3K4AA 3TJHD 4U1KA 5FK9B 1F4XH 1MUJA 3TPUB 3ZTNH 5HYJD 4QCIA 3ZSSA 3VXNA 4PP2B 2AABH 3OWEA 3WFBL 4Y8DC 5ICXB 4HJJL 4PJ5D 1SHMA 1NQBA 2WV3A 3TF7C 3QNYA 2DQIL 4LNVA 4LLWB 2AJZA 2ESVB 3VXSA 2AK4D 1NBZA 3W2DL 4NUGL 3RZCA 3NZHL 2ZSWB 3C6LC 1FO0L 2ZPKH 2Z91B 1C16B 1KCSH 2CXKA 1T5XA 2CIKB 4UB0H 4FQIL 4LDOB 5I1GL 4ZFGH 1Q94B 2UWEB 4M7LH 4ODHH 1CDYA 2ZP0T 3E8UL 5T3ZH 4P99A 4WW2C 1RU9H 3CVHA 4C4KT 2ADIA 1JNLL 3MCKA 3TA3C 3OKKA 1K5NA 1CTNA 3V95A 1NFKA 2D0GA 1SM3L 4OI7A 3VWKB 4YHKL 4G5ZH 4UQ3A 1KTRL 3BPOC 3PDDA 4RFOL 1C8PA 1ZGLA 4U1SA 2YRPA 2F53D 4F9LA 5CZXC 4MQXC 1MHPH 3U2SA 2DQFA 4BKLA 2CRMA 5C8JB 3OBAA 3RVXD 1IGJA 1JZ2A 4ONFH 3MRQA 5DD6A 2ZUQC 3S3SA 4PRBB 4ZAKB 4JGUA 1JZ3A 2BOBB 3KYMA 3QA3B 1KLGB 5EBMB 4MJID 4RAVA 3PP3K 4Y0GA 1QSEA 2F54B 3O4OB 3MRHB 2AJUL 4OT1H 5FYJL 4WVRA 2AEPH 1U3JA 1RV6X 4AM0A 2O5YL 1FFNA 5KSUA 3D18B 3STLB 2NY0D 3PWPA 5C0CA 5KJRL 1JWUA 3EAKA 4LCYA 2AXGA 3FKUS 3M17A 3TYGH 1I1AC 5IW1B 1NH6A 1EJOH 4RAHA 3WFEL 1PD6A 3TJEL 4N90E 4LSVH 4R7DA 4WFFE 1KULA 4OZHA 3MGAA 4M9PA 4NZTL 1ZHBB 3H0TB 3WXVL 1QKZH 5FXCH 2ZZUT 5EBLB 1EHAA 3QUKB 5J3HC 3RJQB 3PL6A 2BVQA 4LGSB 3RGVB 3LMJH 2G5RA 3VW3L 2CJUL 3A6BH 1U95A 3VFRA 2HFEA 5DD3H 4L8BA 4OF3A 1WWWX 5K9OA 2BP3A 1HILA 3HR6A 5I1AB 3VXMD 3NCEB 5J6HB 4JN1L 1W2KT 1KN2L 1YEDA 1UM5H 5DK0B 2Q8AH 5GSVB 32C2B 3CDGA 4KK8C 5KN5B 1T7YA 3O4LE 2XI9A 2FJHA 1UJ3A 4XCEB 5GRJH 5GS1B 5IVZA 2YA2A 2CLVA 3GIZL 1MAMH 2YN3A 2EE3A 3FOMB 3MRGA 2CXGA 2VABA 1D7FA 3QPXL 4P2QA 1ZT1A 2AP2A 1JPTH 4XB8A 1W0YT 2WLZA 3ZE2E 5I1JH 1IT9H 4K7PL 4BK5A 3MV8A 4K3DH 2XXMB 4NN5C 4ZPTB 2FX7L 4MA7H 5EWIL 2J8UB 3U9UA 3DGGA 3HAEA 4WI6A 1K9TA 1PG7W 4LPWA 4F2MB 4KI5F 1H5BA 4EN3B 1F42A 4U1MB 4ZPVA 5IESH 1F4YL 4IDJH 1I7ZA 3T3PE 1B3JA 2YBRB 4JHZA 2P44B 1XT5A 1BGXH 2EDTA 1JJUA 1U3HC 4ENED 3DUSA 4DK6A 3RIAF 5BS0E 4NC2B 2GUOB 2GT9B 3PJSA 3CUPA 4MXVE 4LRIA 5C0AD 4FFYL 1FLTX 1FG2A 5EFIB 5HVFB 4HQQH 4HJGA 4NKOB 4YBHA 1FGNL 3F12B 5EBWA 1JL8A 2EE6A 2HG5B 4UBDC 2VXSL 4NC1C 4JM2A 1EO8H 3VXRB 5HD8D 1P53A 3QHTC 3SBWA 1BECA 2DB8A 4XTRC 1W72L 1UM6H 1OP9A 1JBJA 1R5WA 3QUXA 5ALBH 1UB6B 2DWEB 1DZBA 1CFQA 1JN6A 3NGBB 4K9EC 4NM8H 3M1BA 2P5WA 4ZTPH 1WT5A 1U8JA 1M1SA 4GKZB 1CZ8H 4M02A 4RMWA 3O6LH 5HI4C 1F58H 1Q8MA 5KG9B 3DMMB 3HPJB 1KTDA 3H42H 4HKBB 3TO4D 4FABH 4D8PB 3CFKB 4Z5RA 3BI9X 2CUHA 5I66B 4WUKH 1TVBA 5F93C 4G9FD 2QSTA 4JFQB 3ARBC 2NTFA 4O02H 4GRWF 2CIIB 1MCPL 1ZS8A 4ISVB 4TRPH 4YWGH 2I9TA 1OSPL 4WW1A 2V5TA 1YEEL 5E99L 3SPVB 4JFEA 2OTUB 4P5TD 1X6NA 1TCRB 1WIPA 4OQTH 1G7LB 2XWBB 4C56B 1NFIA 4ZUTA 4K71C 3U4EB 1T21A 5DA0B 5AWNL 5IW3A 4RGMC 1QP1A 4EUPA 3ZT7A 2YOCA 1AJ7H 2H26B 4NQDA 2XZAH 2Y5TB 4OJFL 2Q86A 5KSAB 2VZ1A 1A6PA 2B2XL 3VFUB 1WBXB 1TDQA 1VKXA 3IFPB 5KSVB 4E42B 1CVSC 1P9MC 4ZNEE 3LRHA 4JLRA 3DARA 3BH8A 1PAMA 5C0BB 2Y5EA 3JTTA 3PGFL 1MCIA 3S34L 4ZO6A 5T1MB 3ECBA 3MRLA 5GGSA 3QQ9C 2DL2A 3RGHA 2RFXA 4AG4L 3CSBA 3KNBA 5JXEA 1QSEE 1BQSA 4O00A 3QEUA 1A2YB 2Y6SC 1IL1A 3C08H 4LAQH 5ALCH 2R56L 2BFVH 4QGYA 2P7TA 1NBVH 4CNIA 5KW9L 5FM8A 4JJ5B 1QG3A 4NZRH 1XGYH 3PWPE 2X89D 2AEIT 3EOBB 3TVMA 3DX8B 1M7IA 1NCAL 1AKJD 3KLDA 3F7VB 4L9LA 5AD0B 2NY2C 1D6VH 5B39A 5B8CB 1JZ4A 5LQBH 3D3VA 3BGFB 3HRZA 3IJSB 1ES0A 1ULVA 1CD8A 2KDGA 4JANB 1TQCB 1N6UA 3MXWL 3IB4A 4W4OC 5KS9F 3FMGL 1P7QB 3K8MA 3U6RB 3BHBA 4M3JA 4G9DB 4MB5A 1M05A 4OIBA 5EB9A 1J1PL 3EYOB 4FRWA 1J18A 2C26A 5HHVH 1Q0XL 1PEZA 1G7IA 1N4XL 2NYYD 4OGZA 5EN2B 5ISZA 3MNZA 4KZEL 1UH3A 4R26L 4N8VG 3KJ6L 1G0DA 2X1XR 3TH3T 3O3DA 1S7WB 1IEAB 1IC5H 1KGCD 4OFKA 2IQ9L 3K80A 5DJYB 1VERA 3CZFB 3MRBA 2M26A 2ATPB 2R39A 3NBNA 1N5YH 2G2RB 2A2QT 3UTQB 1EIBA 1ZEAH 4OGAC 1RJLB 3S3JA 4PRHA 4K9EH 1K2DA 5FYLE 2VB5A 3X13B 5F1NA 1XCTB 3QUMB 3QXAB 1A02N 4OFYD 2X05A 4MCZA 1ORQB 2PTTB 1QBAA 1F2XK 4GSDL 2N1KA 4ZSOB 4DW2H 4CN4A 3SHSA 4FQCL 3W11C 4O2FB 5HGGS 1K4CA 4Z77A 4E5XA 5KAQF 4Q6IA 2O5ZL 5I8KL 5HHQA 4YHLH 5EU4A 5CSBA 3QWRA 4OV5B 4FNLL 4NP4H 3K4DA 3HE6A 4C57C 4RDQF 2HKHL 3O8XD 3L1OH 5DRWA 1R6VA 4IS6B 1D5MA 3IAQA 5DT1L 3W0WD 1DQQA 1WBYA 3QUYC 3GK8H 4GFTB 1UG9A 2C1PB 5GS0D 2XZQL 2CDFB 3NTCL 4FTVA 5DF0A 2PO6B 1FH5H 5DQJA 1FRGH 2RCSL 4K23L 1KACB 1CDHA 1FFQA 3GB7B 2IBZX 3EDFA 3IDJA 4BELD 1LD9B 4JFHE 3UTSB 3T0BA 1B2WL 4PR5A 4GXUM 3P77A 5IM7B 3MFFA 2YK1L 4LCCA 4YHOL 4YXKL 1KBGH 3FO0H 3OXSA 5HPMB 1GH7A 1XR9B 2XTLA 2XWTB 1HCVA 3MJ7A 5FO7A 1T2QL 1TJHL 1AQDB 4N0UB 3SGJA 5FA3A 5SWSD 2YPKA 2JELL 3DOSA 2LV4A 1QRNE 4KJQC 4FFWC 3REVA 4LLMA 3TT1H 4XNQA 3TN0D 3C6SA 5ACZB 1S9XB 4Y2DA 3ZKSD 3UJJL 2NLJA 1MJUL 2VXTL 4XWGH 1D6EB 4NO0B 2VIRB 3WS3B 2EDDA 3LS5L 1LP9E 2NY7L 3V0VA 3OR7B 4LIQH 4KKAD 5TPWH 1RZKC 1A6ZA 4Z7NF 4Y4HC 3MV9D 1UXWB 2FB4H 3QUZC 2E9JA 3LPFA 3L3HB 1I7RB 3G08B 4GXVH 1NCBH 3W82A 4PJ7E 3FB8B 1RD6A 2X44D 2HVKB 1MCLA 5GHWL 1EEYB 4R3SB 2RQ8A 3GMOB 4P2RA 4W6XB 3HE7C 2RIKA 4NFDA 2B5IC 3RZWA 1WTLA 3HI1A 5C92A 1D9KD 5IVNA 4X5LA 5IMMA 3PGDB 3MJ9A 4YX2H 5CGYD 5IB5B 3TP4A 2JB5H 3O2WH 5C0JA 1FNSH 5E4IA 5HGAA 1FLRL 3C6LB 3HUJE 1X5GA 3QULB 1DE4B 1HHHB 4MAYC 4ELKA 2EDBA 1YY8B 2XQYK 5IFHH 4IOFC 4JFZH 4CDHA 3FQUA 4PRPE 3R1GL 1EMTH 3KPQA 4KUCF 3CMOH 1NDMB 2YPLE 3CCHA 1N64H 4G42B 3NOIA 4WW2B 1KTLB 1I1YB 4IOIA 4GRLC 2ICCA 5JXAH 1S9YA 2A83A 3KR3L 4PRIA 5D6CB 3S88L 5IMLB 4NCC2 3U9PH 4BUHA 3TA3B 2IQAA 1NCWH 1OTSD 1KF9B 5E08L 1J05B 1YMHA 2IGFH 2DLEA 3BPOB 1CXLA 4LKCA 2J8HA 2QR0B 2KL6A 5JTWA 4F57H 2HJKA 3SJVA 3ARFC 3L7FA 1XIWC 3CLEH 4JO2L 4DGVH 4F7EA 1W0WA 2LU7A 3GUTB 2EC9U 1QFWI 1QFWH 2P5EA 1NEUA 2ZUQB 3L5XL 2DQIH 4PJBB 3QFJB 5FA4B 5C07B 4FQ2L 3F58H 3ZDXE 2EYRB 5A2JH 3W2DH 2KQMA 4NQCB 4LGPB 4NUGH 4NSKB 4ZQKB 2SEBA 1AC0A 5JNYB 5E6YA 3REWB 3WIHL 2BVEA 1RK0A 4ODBD 4PJXE 1AGFB 3D0LA 1KJ3H 1T6VN 2YA1A 3WD5H 4ELMB 2G75A 4GAGL 1U8OB 1LO2L 3B9VA 3L7EA 1I1AB 4HG4K 4CU8A 2WP3T 4JDVA 1SY6L 2ICWI 1ADQA 3LEVH 2FR4B 3QRGL 4Y88A 3VI3F 2FO1A 1CFVL 4F7TB 1S5IL 4ZS6D 2I60L 4J3UA 5MEQA 3QIUC 5EH1A 1UC6A 4NGHL 1DBKH 2ZSVB 3VCLA 2BMKB 5ETUB 3TZVD 3S36X 3BEVA 3RQ3A 1NC4B 4HMCA 5I1KH 1FNHA 1NL0L 5HHOB 4UTAH 3BZ4A 5TFSH 1RZKH 3NCJL 4U6YA 5IHUL 1RHHB 3I02A 1XGUA 3T0EC 4FXGB 3QQ4A 1H15A 3UTZA 5H37G 1EUUA 1XZ0B 2XIDA 2ZNWA 4KAQL 1FPTL 2GJZA 4P57A 3CDCA 1IJ9A 2VE6B 1CGVA 1AXSA 3S5LB 3DBXB 3BOVA 1WZ1H 4R8WH 2A0LC 5HDQH 1NGWA 5EULV 3WFEH 3KYAA 3OTTA 4RRPG 5HHME 2H6PB 1NLDH 1CVRA 1IC7L 2F74A 1H3TA 3D87B 4ZMAT 1J11A 5F3HA 1VESA 4TSCL 1VHPA 2NW3B 1DBAL 3QDGD 4F3FA 2WBJC 4OLVL 2IH3A 1J0JA 1PSKL 5FUZH 4CU6A 5KOVC 5BJTA 2WK2A 2DJUA 4QT5A 1OGTA 1JPGB 2ARJA 2OR8A 1NSNL 4LF3A 4X4XB 3CX5K 4XGZB 1RZIA 1OAUL 1QBLH 2G9HB 5E6IA 4QRPB 3VXPB 3MV7D 4XNMA 4YHML 4S1QL 4P9ML 2DF3A 3LS4H 3JVGA 1YNLH 5IHZB 1BD2E 5DURB 1T0MB 1WJ3A 1YQVH 4AMKL 2BC4B 2R1WA 2V5MA 4D0DB 4OTXH 3MLUH 2EDXA 4HEPG 3PHQA 1CBVL 4G8GB 4Z0XA 4RGOH 3MQIA 3U1SL 2NY3D 3WS6C 3PIQB 5GGSY 2BCKA 5E8PB 3DIFB 3QCTH 1LK3H 4P2OD 1MI5E 3VH8B 3HI5L 4WUUB 1WF5A 4XC1H 2ZOKB 2O26U 3P4NB 1QFPA 3MRCB 2XZZA 4XP9L 2YD5A 5DEGA 3RHWF 1XF4A 2BJML 2HFGH 3V6ZB 3I9GH 4LDEB 2FECL 1Q0YL 4YR6B 2OLDA 3NACL 5EUOE 1G7JA 3IDMA 3GBNH 4X99B 5EWIH 2M2DA 4BSWB 1U93A 5HDBF 3QIWA 4DUXA 4QRRA 1AR1C 4P4KA 3P11H 3MRPA 4HKXA 5C0IB 5EIVA 4JRYB 4PGDA 4N8VA 5JOFB 3KPOB 3LH2L 4Z78A 3O9WA 4MXQC 3NMEA 3DXAA 3BD4A 5DVLA 8FABB 3KPSB 5CLTA 4WI8A 2X6MA 4EI6B 4TVSa 3SKUD 5HVHC 3TPKA 3ARBB 3MA7B 4LLQB 5MENB 3V7AG 5JPMB 1X5JA 3TPUA 1U8PB 2VLJA 2HTLD 5TDNB 3VMNA 4DKAA 1E4JA 5ICXA 1VEMA 4PRIE 4K71B 1PQZB 1IEHA 5GS0L 3MLWH 3UJTL 4HJ0D 4PJHF 4RGMB 1HSBB 3SE9H 3QEQD 4LLWA 4QEGA 4QF1A 1GZPB 2DBJA 3V8CA 4KMQA 2XT1B 3H9SB 2ESVA 3U82B 5IB4B 1NUFA 4JKWA 4BYHA 3L3JB 4H0HB 4NKMB 5HHXH 3MLPA 1OOAA 1NFDF 4JY6B 4TN9A 2ZSWA 1IM9B 4JPKH 4G8EB 3BGMB 1C16A 1ZVSB 2VLRD 4NWUL 2CIKA 3GHEL 4LAJH 2EIDA 2A9ML 3ARGD 1V3MA 1DJSA 1G0XA 1R3IH 4G43A 1Q94A 4O2EB 1UA6H 4Z7WB 1PKOA 2UWEA 4M1DL 5JW4Q 1FYTB 4WO4C 2C4FT 1MFNA 2BNQE 3SOBH 4KHXL 1A21A 3BP4A 1OGAD 1WIOA 1FZOB 5KVDH 1BFOB 2LTQB 2FEDD 3OAUH 3QJHA 3VWKA 3B2UC 5JDJA 1N5AB 1X5AA 4PJCF 2HMIC 1E6OH 1VADB 3F7YB 5FGBA 1M7DB 4XXCA 2VDRH 1MFDH 4YFLF 1MCJA 5C8JA 4I9WD 3VFTB 2NY2B 4GS7C 4TYUA 3FN0H 4PRBA 4ZFOB 4ZAKA 1KJ2H 4PJ8C 3KLHC 4OJFH 2BOBA 1MELA 2VUOA 2VXVL 2E7BA 3QA3A 1KLGA 1LDPL 4FG6D 4KI5D 4WTWA 4WV1A 3RPIB 2F54A 1QSFD 3X3FH 3P2TA 5DMGD 3MRHA 3SE8L 2X1OA 4RFEB 3KXFD 5BRZD 3WMSA 1KELL 3NIGE 4NRZB 1CCZA 3TWCH 1TETH 1FVEB 1X4YA 5DUML 5CCKL 3FB7B 4D9QE 4X6EA 3DETD 4X7SL 2H9GB 3TFKD 4HS3B 3D18A 2N4IA 3WEXB 1NANI 1NANH 3SDDD 3STLA 5EU6D 2OR9L 4O58H 5IW1A 4OCXL 5LVEA 4JFFE 4GKNB 3UJIH 2ZCLL 3WJJC 3THML 4B53A 1IGMH 4KVNL 1FQ9C 1NGZB 4Z7VB 5F21B 1YMMB 1ZHBA 3G9VA 3H0TA 1E4WH 4WI4A 5EBLA 4PLNC 4YXHH 4L3CB 3QUKA 5KBNC 1WICA 2QV2A 5BXFB 4MNQD 3C8KB 4LU5H 1P2CB 1JGUH 3ZT6A 7FABH 1YQ2A 4HF5H 5IFJB 3CFDB 1KCLA 4IRZH 3MXWH 2BVYA 3IAPA 4JG1H 3RL2B 3CXHK 5I1AA 1UVQB 1FNFA 2QSQA 3OG4B 1S7QB 5SX5K 1TMCB 4JQIL 3IDUA 1BVKB 5GSVA 32C2A 4EDXB 5KN5A 3GMLB 3P40A 4FQXB 1G7QB 3K8LA 1AXIB 1YN7A 5GS1A 2YD6A 1GC1C 1RZ7L 2BY2A 4NKDB 1BVZA 4JPWH 5EPMA 1EAJA 5FHAL 1CWVA 3QUYB 4MB4A 3FOMA 4KWUA 5I19H 3BH9B 4XVJH 1VENA 3GSVB 5C3TA 3FQNB 3WIIH 5KVFL 2VSCA 2R4RH 3T0WA 1I8IB 3FOLB 5D1ZA 5IT2L 3MZTA 3RVVC 4NIKB 3WXWL 5F1IB 2E8ZA 1KSRA 4YGAB 2J8UA 4LLAA 3WJLA 3IETB 4F2MA 4LSTL 5D7JD 4EN3A 3CFJB 4U1MA 3RP1A 2ZG3A 3VXTB 5J4MA 2J8OA 3IGAA 3ULUC 2YBRA 2X40A 1JGEB 2BY1A 1NCUA 4OZHF 1K8DB 4UNVA 1V5JA 1A7QL 4KC3B 2GUOA 2GT9A 2ICWB 2NNAB 2XTJE 4UIKH 2IF7A 4XNUL 3GSNH 4XPBL 5EFIA 1CS6A 5CINL 4NKOA 1QO3B 5HI5D 3F12A 3HMXL 4U0QB 4ZG1A 4NFBA 5TDPA 4OZIE 2HG5A 5F7UA 1VPOL 4M1GH 3S37H 3VXRA 4OD3L 3ZE1F 3DI2B 2RCSH 5FYJE 3VG0L 3MGTB 4AEFA 4J6RL 4BA8A 1UB6A 2XYCA 2DWEA 2PW1B 3M8OL 4Y4HB 5H35B 5D2LE 3QUZB 2VLJE 2HKFH 2V17L 2OP4L 1ACYL 3I3EA 3TV3H 1ONQA 4GKZA 4QRUB 1A4KB 3ARQA 5KTEL 5J13C 5TF1L 2YK1H 1OP5K 2FJFB 5KG9A 3DMMA 2GTZB 3HPJA 3EFDH 4HKBA 1R24B 1KEML 4D8PA 1G84A 1NGQH 1BHGA 4NYLB 1GHFL 3HE7B 4DKFL 4YJZL 2JELH 2B5IB 3UO1L 4OAWB 3TM6A 2VR5A 4I48A 1DBBL 4WTZG 4JZJC 5GJSH 2CIIA 1MOEA 4ISVA 4TNVF 1IE5A 3BGAA 4MD4B 2DLHA 3TCLB 3GI8H 1YY9D 4QRQB 3SPVA 2OTUA 2VXTH 4OZGB 3FFDB 1TCRA 3BDXA 1WBZB 3V0WH 3VFNA 4OQ1A 1G7LA 2XWBA 4C56A 2EIBA 1GGBL 4MAYB 4W70A 2W9EL 3S5LG 1G6VK 2GCYB 3U4EA 4DQOL 1GVIA 3Q48A 3HLAB 1KENL 3CAFA 1HNFA 1GZQA 2VLLB 4YDLC 3VGAC 2ZUWA 1J5OL 4RRPA 1HYRC 3LQAC 1OL0A 3HA0A 4OB5L 2H26A 2Z35B 4L4TD 5KSAA 4GRLB 1H0DB 3VFUA 5JORA 3IFPA 3QNXB 5KSVA 4XMLH 2FEEL 4JM2F 2JIXB 3MACL 5E9DD 4NOBA 1J0KA 3A67L 2NZIA 5E94B 3NCYP 5C0BA 3WFDH 5JW3H 3IS0X 5T1MA 4HPOH 1GC1H 1QD0A 4OBRA 4NO2B 4UT7H 2F58L 3ARFB 4BSVB 4PJAB 4F7CA 5I16A 4IRSD 2Z8WC 1CN4A 1A2YA 1HQRB 4CVUA 4DKEL 4MD5B 4PJ9C 3EFFB 2DWDB 3P0YL 5ITBH 3FT4B 3IDNB 3PABB 1KPRA 4JJ5A 1L9MA 3Q5YA 1M71B 2O61B 1JYWA 3P4OB 4QHLB 4Z95H 3DX8A 5J9PB 3N06B 2AW2A 2VZSA 5AD0A 1U0QA 2GSGB 1RAMA 5B8CA 1A7OL 1D5BB 3ALXA 3IJSA 2BDNL 3R1GH 4YDKH 3AB0C 4Y19B 3BO8B 4BZ1H 3VH8G 2XY1A 1JV5B 3ULUH 6CGTA 4GG6B 1P7QA 2EICA 1MIML 3IFOB 3U6RA 4PB0H 3VFPB 4G9DA 3OB0K 4OF7A 1AIFB 3EYOA 2J1KA 4XB7A 2KZWA 4J4PC 5FKAB 5IQ7L 5C09D 4Y4KC 4PJDB 2NXYD 4BH7B 3J7HA 5EN2A 1CGXA 1ZLVK 4YH6A 2MHAB 3SDAC 1AE6L 3QIUB 5C86A 3LN4B 2E7MA 3L5JA 1RURL 3ZHLA 4R90H 4LOUD 1JK8B 5DJYA 1NC2A 2FD6H 3CZFA 3RVUD 3K4ZA 2ATPA 4NJAL 3KDMB 1NAML 1A14H 4LCIH 3MCG1 2G2RA 4AEEA 3UTQA 2MTPA 5DJAB 3RWJB 4Z7QF 1RJLA 2QTEA 3X13A 4QWWD 3B4NA 1NGXB 1XCTA 3C5JB 2O5XH 3QUMA 3QXAA 3T0EB 3WIHH 4M4PA 4ACPA 1IC1A 1ORQA 3QXVA 2PTTA 1KB5H 5IHBA 2OJEB 4YLQT 2F5BH 4EI5A 4ZSOA 3UMTA 3VD9A 2GI7A 1EK3A 1HZHL 4X80L 2XRAL 3DV6B 4LLYB 3MLTB 3ZSTA 1RUKH 4H5SB 4M7LT 3AY4C 2C1OB 3QXUA 3UTTE 3FN9A 1U8HB 4OV5A 4U1NB 1TNMA 3CSPA 5C08D 4XH2B 4NNYA 3ILQD 5T1DL 2AGJH 2HT2D 3LQMA 4PP1D 1MRCL 1L9NA 1XH3B 4JG0L 1IGFH 1S8DB 1P5UA 4IS6A 4JKLA 4R4BB 1J87A 4U1GC 3T2NH 5GGVH 2C1PA 4PLOB 4KROC 4UU9B 2QHRL 1FL5B 2CDFA 2PO6A 1KJ2B 5E70A 1QLFB 5D2NC 3GB7A 4X4ZA 1T1XB 5HY9B 3NA9L 1LD9A 3LQAH 3OJVC 3UTSA 3LD8B 1I9IH 2I25N 2E5EA 1OAXH 5D1QD 5C9KA 5IM7A 3G6JE 1OTTC 4KUCD 4L1DA 4PY7B 1JI1A 3BE1L 5FECB 5HPMA 2PYEE 4YUEH 1XR9A 2XWTA 3WUZA 4XPFL 4KKCD 5L7XL 4C55A 1AO7D 4OM0H 2FHFA 4M1CD 1AQDA 4N0UA 3QIBD 3MOBL 4KTDL 1IC7H 2F19L 3D39B 3RWIB 3AS2A 2WQ8A 4AZ8A 2FX8H 3H3BC 3PWJB 3ULVC 1QA9B 1RJYB 4Q9QL 5I76B 4ZTOL 5ACZA 4DAGH 4TSBL 1PSKH 2B1HL 3U7WL 2EDEA 1FCCA 4FZEL 3EYQC 4ZS7L 1D6EA 1S9WB 4F8TA 3WS3A 2PYFB 4JR9L 3S35L 1MCOL 1TJIL 3EW3B 3OR7A 2IMMA 4WEUD 2Y4SA 1UXWA 4K7PY 3L3HA 1I7RA 5HYJE 2A6IB 1F3RB 5A16B 4OLUL 4ZUSB 4M93C 3QG7L 5LBSL 3EZJB 4PJFE 1FVCA 5HVHB 4AMKH 3GI9L 3KS0H 1D5IH 3FB8A 1FORL 4PJ5E 1KCVL 5J57B 5L8JB 1CBVH 4XNXL 1EEYA 2YZ1A 4R3SA 5FDYA 3GMOA 5F97E 2PNDA 3MOAL 1GGCL 2NMSA 3HI5H 4YXLL 5TQ0H 4HHAB 5IP4A 2AK4E 5BZDB 1VACB 2HH0L 2NY1D 2VDKH 2BJMH 4Y1AB 3BT2L 2IMNA 3PGDA 5C6PB 2ICEB 4XWOC 1H3GA 3H9YA 5J1TC 5IB5A 2ADFL 1CE1L 1C5BL 4M7JH 2PR4L 4YBLC 1YC8A 3C8DA 3IFLH 5IROC 3C6LA 3ZDYE 3QULA 1DE4A 4NQXB 1HHHA 2L7UA 3OXRB 5TDOB 2XWJB 3TCXA 1OP3K 4P46D 5IVXB 1YY8A 1N59B 3K2UL 3A0OA 2J3SA 4TUOA 4U1LB 1KLUB 5FOJA 3I3BA 3NFPB 4WEBL 5CJQH 5IBLC 5C7XH 2LU3A 3VG9C 1NDMA 2AJXH 1JHTA 4G42A 1FBIH 4WW2A 1KTLA 1I1YA 2V6HA 1T04B 2F53E 2BSED 4YO0B 5DSCB 5D6CA 5IMLA 2YS4A 3GSNB 2AV7B 4YQXL 3LVEA 3TA3A 1E6JL 2VISB 1IGIH 3SKNB 1JI2A 4XRCB 4F9PC 4XI5D 1J05A 5CHNB 5FIEA 4KY1H 2QR0A 2APFA 1TTFA 4M5YH 4FP8H 1KTKE 2ED7A 2Z31C 3ALPA 3VRJB 3CC5A 4MJIE 1TZGL 3JV5A 4GS7B 3GUTA 4K94H 5DFTA 4PJBA 3BPCB 2ORBH 3QFJA 5FA4A 5C07A 1P6FA 2P43B 3QBTB 2P8MB 1KG0B 5I1LB 4JEGB 2ZCKL 2ZUYA 4PJ8B 4YAQB 1JPSL 2EYRA 1JE6A 2VITB 4NQCA 4NSKA 2VDNL 4ZQKA 3IU4H 2VDMH 3ZKMD 4BK4A 3NIFF 1QBML 2AJYL 4MLSA 5JZ7C 2WWMD 1G9EA 3QH3B 4ZOEA 1A3RH 3WBDA 1AGFA 1I3VA 4MQTB 4YDIH 3V52H 3SCMC 5F7DB 3HTLX 1U8OA 3SEPA 2WIMA 3TNNB 1I4FB 1I1AA 3MCLH 3QT2A 5DLMH 5M95B 3VRIB 1PGRB 3WO3B 4M62L 1OW0C 4YFDB 3DTXB 2FR4A 5K9KB 3CFIC 2MKWA 5A2IH 4OCNC 4F7TA 3ULVH 3O3UN 4OQTA 3QNZB 5SWZB 3AS3A 3VXME 3RFZC 3HNTH 4ZXBC 3TZVC 1MCRA 2BMKA 4I3SL 4O5LL 2BNRB 5ETUA 3DYPA 1NC4A 4LHQB 4LASL 2NX5B 3GSOA 1KPUB 5HHOA 2IAND 4MS8C 4JZOB 1C1EL 3ZE0E 1DEEB 1QPXA 4Y16D 1PW3A 1L7TL 4JO1H 4FXGA 1DVFC 4XHQA 5C0RH 1PVHA 3MZGB 3SQOL 3VFVB 1XZ0A 1HWGB 2YZ8A 3MLYH 4NBZB 2VE6A 4X7SH 1MFBL 2QKIB 3DJ9A 3NFNB 3S5LA 3DBXA 1BX2B 4O9HL 3FO2B 4A6YH 1J1XH 2IFFH 2H6PA 1ZVHA 5FYKD 5DO2C 3CLFH 3BUTA 1D5XB 4UDUB 2OZ4H 2E8YA 1EHLL 3GKWL 2NW3A 2XOTA 4JB9H 1II4E 2IPUK 1LK2B 1KN4L 1G7MB 4ONHB 1UZ8B 3UAJC 1WLHA 2R2CA 5LGJA 3LCYA 4X5XB 3A6CH 4LQ1A 2Y07H 4CMMB 1JPGA 2CDGB 4I3RL 4X4XA 5C0AE 4NQEB 3S8WA 4XGZA 1LE9A 2G9HA 4QRPA 3VXPA 3WYRA 2FHBA 3WUWB 4QTIH 1U3HA 3GHBL 2I9LB 5GIRB 5IB3B 5IHZA 4M4RA 1WTGT 3RDTC 1T0MA 2BC4A 4QO1A 4F8QA 2RHEA 4D0DA 4G8GA 4N0CC 4KK9C 4HV8A 4WCYH 3VA2C 3PIQA 3V4UH 4KK5D 5DMYA 5E8PA 3DIFA 3VH8A 1FGVH 3GNMH 4WUUA 3FO1B 3MRCA 1XGRB 1KIQB 1F8TL 5DJ8B 2D7QA 5CKGA 3R06B 4DGIH 1IZKA 5D7LD 4RSVA 4GAJL 3V6ZA 3PXJA 5IT2H 4IMLB 2ENYA 1RZFH 4IJ3C 1KCKA 2AEWA 4X99A 3NPZB 4BSWA 5JA9A 1YPZE 1KB5B 1AFVL 1ZLUK 3RAJH 3HNVL 2AJ3B 5DJ6B 5J13B 5C0GB 1VDGA 4ZOBA 5C0IA 4UOW1 4G9FE 3O6KH 3QEGL 4JRYA 3NFSH 4R4ND 5K33A 5JOFA 1MSPA 3O3BB 3KPOA 5TE7L 2F8XC 5C0NC 4YK4B 5DK3A 1O7SA 1ZLWH 8FABA 3KPSA 3TC9A 5T33H 2XFXB 1AH1A 2AI0L 4EI6A 1A7QH 2CKBL 3X12B 4XP6H 1CFNA 3ARBA 3MA7A 4JZJB 4LLQA 2C3VB 3HMXH 2DI9A 1BFVL 2JCCA 5JPMA 3CZJA 5IEHB 3WKNA 1U8PA 5FO8B 1CLOL 3RNKB 3MUGA 4UILL 4BM7A 4WI2A 1QEWB 2WUBL 3O2VH 5TDNA 3VXSD 4XPTL 1U3YA 3RZCD 1PQZA 3O6FC 1R3KB 4J6RH 4LRNL 5GRWA 3VGAB 4YDLB 3M8OH 3HC3L 1HSBA 5FHBH 2V17H 4KVCL 1GZPA 3VXUB 3H9SA 5JDSB 3E2HC 5IB4A 4IRJC 4TUKL 3L3JA 4NKMA 4YHZL 5KTEH 4JY6A 4X7CC 2DQTL 1IM9A 2CGRH 1INDH 3BGMA 5CILL 1BOYA 1ZVSA 2AJSL 3EHBC 1P9MA 4HXAH 2IJ0C 5JR1H 5ADOL 4X6DE 1BEYL 2V7NB 1BIHA 4O2EA 4ZYKB 4CW1B 4Z7WA 5JHDB 1H3PL 3F7QA 3SDCC 25C8L 4O4YL 1FYTA 3ARDC 3O0RL 3DHMA 3OKEB 4HX1B 4OI9A 3BD5A 4HWEH 3IJYB 5F88A 4X6BB 1BFOA 1EH9A 4KQ3L 5DR5L 2VDPL 4K8RD 5F9DC 1ZSDB 3C87A 1N5AA 5C0DB 1VADA 1DFBH 1YN6B 3O3EB 2EDLA 2Z8VC 1M7DA 3UBXI 1A64A 4L9DA 5LGHL 3WHE0 1QSED 1INQB 3VFTA 5T5FH 3AB0B 4OLXH 4ZFOA 3HB3D 4W4OA 4NHUB 5DDHB 1CD0A 5ESVB 3KPMB 2Y9RT 4HK0B 3PWPD 4FFVC 1EFXA 5C0CD 3BWAB 4FQPA 1DQLH 3RPIA 4MD0B 3RX8A 4M6MH 5BO1L 4J2XA 4M43L 4RFEA 3BQUC 1PLGH 1AGBB 2V5SA 3QDMB 4Y4KB 4NRZA 5E7FA 3A67H 2EDHA 1FVEA 4JCLA 5F71A 3FB7A 4AEIL 5IQ9B 1PG7X 1HYSD 3MBXL 2H9GA 5DRZB 4HS3A 3WEXA 3SDAB 2JB6B 4YHYC 3PL6D 4X4MA 3HS0B 2J4WL 1IGTB 4GKNA 4HXBH 3KPRA 4P5MB 1X5ZA 1NGZA 4YBQC 4Z7VA 1INEL 2VWEC 1YMMA 4L3EB 1MFAH 3EOYG 2Z8SA 3OJDB 4L3CA 1OP3H 1Y6NR 4BQBA 1UWEH 4GW1B 4FFZH 4I5BB 2Y36H 1CLCA 2DTMH 5BXFA 3C8KA 3DNKA 2WAHA 1P2CA 5EORL 2UWEF 3X11A 3NA4A 1G6RB 5IFJA 1C12B 1Z3GH 1DP0A 4KKLC 1BP3B 5TE4H 5HSFA 4KJPD 5EOCJ 3RL2A 4J8RA 4TVPH 4PB9H 1UVQA 1MIMH 1QYGH 1DBML 1S7QA 1T20B 5KVEH 5CAYB 3W0WE 5L8LB 4NNXB 1BVKA 4EDXA 3GMLA 1G7QA 2K9UA 2NR6D 4P2QD 4JM4L 5E5RB 3QSKB 4RQQB 4M6NL 2NW2B 4NKDA 4YGVB 5I8CB 3MV8D 3WLWC 5DD1L 3QUYA 4U1GB 4YNYB 5L2JB 3BH9A 4XMKL 4KROB 3VMOA 4D3CH 3GSVA 2VAJA 1WWBX 3CVIL 4S1DD 5D2NB 3FQNA 3MXVH 3MYJB 4OLEA 2VC2H 4XPGH 1I8IA 3FOLA 1J0IA 4G8FB 3PV6B 3QO1B 3LB6C 5F1IA 5CEZH 3E6FB 3K46A 2OR7A 2BXYA 5DD5H 1JZ5A 3IETA 5SWSE 3ARZA 2A74B 2Q3AA 3CFJA 3VXTA 4X80H 1RIUL 1VGKB 2NXZD 1FDLL 2ZJSL 4LCWB 3VFGH 1JGEA 5D7KE 2N7BA 2OJZH 2AV1B 4L3AA 3DWTA 3QDHA 4OUOA 4JFHD 4ODSL 1IEBB 4JM2D 2NY4C 3BJLA 1K8DA 2ICWA 2NNAA 3AMKA 4JFXB 4QHNB 5EC2B 4P48A 1RZJL 3L3KB 4X7EC 1Q1JL 3VD5A 3QUXD 4AENB 1J0ZA 1QO3A 1EGJL 4JG0H 1OCWL 5MEPB 5GZOC 4LSRH 1OAYH 4G6JL 1NMAH 1YEIH 3MV9E 5ILTL 2P5WD 4YEFA 5F9OL 5GGQH 4H26B 2E6JA 2ZOLB 2L0DA 3T4AB 2GSIB 3K0WA 3MGTA 4X7FC 5GJTH 2PW1A 1MPAH 2ENSA 1ZA6B 3CK0L 2B4CL 2JCCE 4Y4HA 5H35A 1S3KL 3QUZA 4PV9B 1C5CH 2WP3O 4F7PB 4M03A 5C0EA 4M93B 4QRUA 1A4KA 4U3CA 3WSQL 5DWUH 2XN9B 1U2CA 5CD5C 2FJFA 3DI3B 2GTZA 5BZWB 1BVLB 1R24A 4LLDB 5L7XH 3H9HB 1SBSH 2YMXH 3BKCH 4KZDH 4NDMB 4NYLA 4A6YB 5GPRA 3HE7A 2J6EL 1EAPB 3MA9L 3WFHB 4JFED 4AL8H 3MBEC 1T4KB 4OAWA 2W0PA 4EDWH 2R0KL 3D9AH 3HI6H 2I07B 2NTSP 3QCVH 3MJGX 3CFCL 5FYKL 2J8UF 3MGOB 3OKNB 3GBMH 4HUXB 4I18C 4HG4J 4MD4A 1CICC 4GKSB 3TCLA 2W60B 2D2OA 4DZBB 3I50H 4QRQA 5DD0L 4L8SC 4NQDD 4AIOA 3HNSL 1KFAH 4OZGA 2X4RB 3FFDA 4FZEH 1WBZA 4YBLB 4CADB 4MAYA 2IBBA 4KDWA 2GCYA 4JFYB 1NKRA 4B0MM 3HLAA 3VD3A 1VCAA 1Z9LA 4NBXB 3RRQA 1ZGLM 3VG9B 4I2XE 4KJYB 1UH4A 1LO0H 2R0WL 1IVLA 2Z35A 3KGRA 5D70L 4GRLA 2A77L 1NJ9B 2D7TL 3B5TA 1H0DA 5IWLC 5JXED 2GIYA 4XPHH 3QNXA 4MJ2A 2JIXA 2HT3D 5BW7C 1NGPL 3U46A 1GYAA 1OF2A 1GGIL 2BX5A 5E94A 1OB1B 4HT1H 3OAZH 1F4AA 3SE4C 3OHXB 3GMQB 2Z31B 5GZNC 4NO2A 3ARFA 4BSVA 4PJAA 1XIWA 5M7QA 3TVMD 5DMKB 1HQRA 1KLFA 9CGTA 2CDEB 3X3GL 3D3VD 4OIIL 5DZLA 3WUWG 3I6GB 3EFFA 2DWDA 3FT4A 4R7NB 3IDNA 3PABA 2PCPB 2O61A 3RVWC 3P4OA 4K3JH 4QHLA 1LO3L 2XICA 1ZANL 3L5IA 3RVTC 3WNOA 5MI0C 3KLSA 1ZOXA 5EA0H 5ABDE 3SDXE 2GSGA 4LEOB 3KPRE 1D5BA 1JGDB 4V1DB 4Y19A 4MQSB 3BO8A 4XZUA 1JV5A 1UXSB 3SCMB 2J7LA 4XHJC 5ISZD 4GG6A 5IGXH 4LCUB 5FGRA 2IG2L 4OIAA 3WDIA 3G9AB 1A7RL 1MFEH 5ENWB 1AXTL 2CLRB 1KYOJ 1AIFA 4OGXH 4WGVB 4CMHC 2LVCA 5CJOL 4KKNA 4PY8J 4KQ4H 4ETQA 5I18H 4X6CB 4BH7A 2FX9H 4JO4H 5ANMB 2MHAA 2QSCL 3QIUA 4PRHD 4BFEA 1UKQA 3LN4A 4ZXBB 3TZVB 2FIRT 1K6QL 3ISWA 5F96H 3O6ML 4KMTL 1JK8A 4M6OL 3GSRB 3KDMA 3T77B 1AD9B 2OL3H 2DM3A 3GJFK 1DR9A 4UT9L 4OCRL 4QWWC 2VDNH 1BLNB 5DJAA 3RWJA 5F89A 1A5FH 1Z6JT 2X1WL 3V5DB 3VFMA 5HI3D 1NGXA 3C5JA 3M07A 1DVFB 4P23C 3OGOE 5CP7B 3CVHL 2OJEA 3N50A 1PKQA 3QWRD 4L29B 2VLMD 5GGTH 1NMBL 2GY5A 4G6KL 3DV6A 5A2LH 4LLYA 3HE6D 1IGYB 1V8HA 5BVPH 3WO4C 1HNGA 3QDGE 3MLVL 5HYFA 4PYHA 1URLA 5H94B 3V6OC 4H5SA 4U1JB 2M1KA 2DQEL 2C1OA 3T0XA 2R9HC 4ZNCD 1TFHA 4FTVD 2DQUH 2VLKB 2VDQL 4U1NA 4TULL 5F9WC 4PP1C 2W38A 1N0XH 2X1PA 5C2BH 3EZ8A 4K8RL 1XH3A 3UBXB 3V6BR 1S8DA 3MC0A 2WBJA 3MV7E 4R4BA 1EEZB 1JNNL 3BYYA 3S36H 2GKIA 3WFCH 3VGGA 3HG1A 2DS4A 2Q7YB 4K7PX 3CPLB 1W8NA 4UU9A 1FL5A 2Q76B 1A1NB 2DQCH 4JO3H 1KJ2A 5C70A 3IKCB 3RHWK 1NLBL 1QLFA 3RWFB 3PQYA 4JQXC 1T1XA 5HY9A 3GJEB 3NCYS 1U6AH 3JWDL 2HT4C 5BCAA 2HRPH 1RUAH 2C9AA 1F2QA 2B0SH 1V7NH 1T1ZB 4WI9A 3SQOH 3VWJC 2HYMA 2ADJB 3RDTB 3SGEI 3SGEH 2KBGA 1KT2B 3BIKB 4PY7A 5A3ID 1T80A 5I1IL 5FECA 1Q9WB 2G60H 4O9HH 3N1MC 1BWWA 3WS6A 3RNQB 5DA4A 4WU5B 4Y2DD 4UOJA 2ITCB 2DIJA 4KK6D 3HZMB 3RWIA 3D39A 1A7NH 3GSXB 1BIIA 4S10A 4QXGH 2D03L 2NPLX 3CX2A 2PETA 5HVWA 4U6XB 3PWJA 2VXQL 1QA9A 1S78D 2RBLA 1RJYA 4U2YA 1DSFH 1FFPB 4IJ3B 1XGPB 5I76A 2DLFL 3K1DA 4I77L 4AYFA 3BKML 4H88L 2I27N 4JAMB 2CK0H 5EO1B 3GSQB 2PYFA 2OTWB 1DQML 2DQHH 4MZ2A 5DQ9B 2DLIA 1HH9B 4XAWL 2D7OA 4C83B 5L6YH 3TGXA 4P2RD 2A6IA 2NY6D 3FQXB 5A16A 3ZKND 1B4JL 4ZUSA 3O2DH 5FM4A 5AYUL 2YEZA 1BBJB 1EHNA 4JRXB 3DV4B 4HUNB 1T2JA 4M48H 2EH8L 4XCNB 1CDCA 3QEQE 5CD3B 3K1KC 4HHAA 5BZDA 1N0LA 4CDGC 1VACA 3D2UB 1F8TH 1IAIM 2A9NL 4R0LC 4M7KH 1X5HA 3O6FB 2ZUXA 3BIBX 3LHPH 5MP6L 3RBGA 2VLRE 4Y1AA 1OT2A 4HWUA 2ICEA 4CUCA 1IMHC 1FZMA 4JN2B 3E2HB 1R0AL 4IRJB 1T2XA 4RA3A 3H3PH 3MUY1 4NWTL 3INUL 2H1PL 3OXRA 5FUOH 4PRID 3QFDB 2XWJA 3ARGB 1JHKL 4FQLL 5TDOA 5IVXA 5TE7H 4Q0XH 3Q0HA 1OGAE 3X14B 2N7AA 2XG5A 4U1LA 1YECH 5HHPB 1RJZB 3NFPA 1YJDL 3UPCA 4U6HB 1AQKL 4WHTB 4E0RB 1SYSB 3SDCB 3B9KC 4M6AA 3TO2B 3ARDB 2UUDK 1O5DT 3FRPG 4WO4A 1T04A 3TH2T 4YO0A 5DSCA 3SJVD 2X5PA 3GSNA 2Q8BH 2AV7A 3I2CH 4R9HA 4I9WE 2VISA 3CXHJ 3SKNA 2EDNA 2P5ED 4XRCA 3ME0A 1RQ5A 4X8XA 5CHNA 4LPCA 3IXTB 4QKXB 1XF3B 5CIPH 1Y6MR 3MFGB 3SDYL 3CFBB 2IPTH 1F3DJ 1QHPA 2ARWA 3RTQC 4KI5E 3HR5B 4XVUD 3UYOD 4XVTL 4JHWL 5BRZE 3KXFE 3BPCA 3OQ3B 2P8MA 3O81A 1KG0A 5I1LA 4PJ8A 4YAQA 4IIQC 2VITA 3JWOC 1QSFB 4FXKB 4B41A 5EU6E 3OAYK 1XCQB 4KPHL 3BQUB 4UV7L 4UINL 1N26A 4P5KB 3PP4H 3QH3A 2MSPA 2UVEA 3DX7A 3DHJA 1NBYB 1JPFB 2FATL 3GRWH 4KGJA 4OLYH 4C58B 2FGWH 2X70B 4YHYB 4OCLC 3OF6A 1I4FA 4N9GB 4DN3H 5FGCE 4OCYH 4BZ2L 4MNQE 1VFMA 1E4KC 4JFDB 1A0QH 3BP7B 1D3CA 2VL5B 1PKQE 3VRIA 1A3QA 5CUSH 1MIEL 3DTXA 3GMMA 3OPZH 2AJVH 5K9KA 1BOGB 3QHZL 3FRUB 4YDJA 3QI9C 1EHXA 1F90H 3QNZA 5SWZA 5HHNB 5IJVB 4JGJA 4DN4L 1UQSB 4ODXB 3BKYL 2P4AB 1WEJH 1ZXQA 2BNRA 4HIXH 4WW2F 2X9WA 3B5GA 2NX5A 4U2ZA 1KPUA 3WFZA 1KEGL 1PX3A 2QJDA 2PXYC 1K3ZA 1HOCB 1QNZH 3TYFB 4KRPD 1JGLH 1TXKA 4JZOA 1EO7A 1DEEA 1WAAA 4LP5A 4PJEF 3MNVA 5AUMB 3HG1E 5DS8B 3VFVA 3D25B 4GRWE 4K3EH 3MBXH 1U8IB 2QKIA 3PQYE 3NFNA 1FC1A 2AKRB 1BX2A 1HXYB 4TQEL 5IBUB 4PJBF 1B6DA 2YPVH 3FO2A 3LPWA 2WIIB 1UWXK 2LAAA 4KUZH 5GISL 3EBAA 2CMRH 5EZOL 1XGTB 1BF8A 4LSSL 1D5XA 4UDUA 1OPGH 5EOTB 3CH8A 4JKKA 4XCYA 2GW5A 2HWZL 5E6ID 4X98B 1LK2A 3TIDB 4GMSH 5I6XC 1G7MA 4ONHA 3MLXL 1UZ8A 3MSPA 4G6FB 3P30H 3KYNB 3QCUL 4ELMF 4LLVB 4X5XA 1CFTB 3K81A 4CMMA 3BDBA 2CDGA 3B83A 3C5ZC 4HKJB 4NQEA 1H3UA 4MA8L 3EOTH 5EU7E 3TBTB 4PJIB 3B8YA 5I30L 3RUGB 3WUWA 1N6QL 5CBEB 2NY4B 3ZHDA 2I9LA 1MCNA 5GIRA 5IB3A 5GS2D 4L4VB 1CLYL 1X4XA 2WUCL 5EOQH 3RWDB 1DBJL 1FN4B 3BSZL 1R3LB 4M8QB 4DUWA 4HBCH 4G80B 1R5VB 4UI2A 4PJGB 3CD4A 1IRAY 3QIWD 1PJ9A 5D7SL 3FO1A 3G5XB 4MA3A 2BSSB 3GJFH 4P4KD 1XGRA 4QRRD 1KIQA 4NQVB 5DJ8A 3R06A 4OD1H 3LEYL 1BFTA 2HVJB 2OL3B 2ZKHL 3PHSA 4IMLA 4XVSH 5KS9E 4TNVK 1ORSB 4JQVC 3O9WD 3MRKB 4FZ8L 3DXAD 5F6IB 2HFTA 4JPIB 2C3GA 3JWOH 4ORGA 1KB5A 2BRRL 1HHKB 2AJ3A 4ODWB 5DJ6A 2H3NB 2UZYB 5C0GA 4Y4FC 4Q97A 1FDLH 3O3BA 1CLZH 1OAKH 3Q6GH 2A1WL 1BQLL 3SE3C 2VLJD 5GSRB 2XFXA 2WNGA 3OKYA 3LRSB 3MBEB 2KQNA 1MCWW 3CH1B 2IAMC 1RY7B 3U7YH 1FE8L 3X12A 1RZJH 5BV7C 3LKPB 4JZJA 4XP1H 2C3VA 2XACC 1OCWH 4ZD3L 4EBQH 2DD8L 4I18B 1BF2A 1CICB 4PLJC 5LAXB 5IEHA 5GGUB 3JBG7 5FO8A 3RNKA 4L8SB 3IDYC 3MRDB 5E4EC 2ESVD 5E8OB 5F9OH 1A7BA 1C08B 1EV2E 4L4TE 1WC7B 1JMXA 2X4OB 5D1XC 1R3KA 1LEKB 5D5MB 4Q9RL 4OSUL 4BH8B 2XKUA 1S3KH 1T3FB 5E9DE 4TUJA 3VXUA 3CSYB 2X42A 4Z7UB 5JDSA 1B0GB 2JJVA 4G7YL 4PG2C 2DM2A 2E27H 3I3DA 4NZDA 4PBVC 4JVPA 3BAEL 3UBXG 3ARRA 2WWKT 5GXBB 4AIZB 4OLWH 4YHPB 5D8JL 4NM4H 4H20L 1UCBH 1V7ML 3VWKD 3H7BB 4PIRF 2MCPH 2V7NA 4ZYKA 4UT6L 5I17B 3QZWB 2X4TB 5JHDA 5L9DL 3ZL4L 2XA8L 4XNYL 3IDXH 1JZ6A 2VKXA 4G6MH 4AEHL 3OKEA 4HX1A 3IJYA 1QR4A 3KYKH 4X6BA 4LSUL 3Q5OA 1GAFL 4S1SL 3MRNB 4PJ9A 4K55A 5GRYA 4NKIH 1ZSDA 4XX1E 4ZAKD 1RIHL 5EUOF 1MREH 4P3CH 5C0DA 1YN6A 2APXA 1PDKA 2IALB 3O3EA 2GYSA 4OGYH 5TQ2L 1ZLSH 5K9JL 5LCVL 5MI0B 3B8SA 2F54D 2R29H 5F9AC 5F7KC 5CJXC 3MODL 4UIMA 5C09E 5ADPL 4I8DA 1DUYB 3BGFC 4RBPK 1Z9SA 4NHUA 5DDHA 3P73B 5ESVA 3DX9B 4ZUVB 1TQCC 4OM1L 4NT6B 4HK0A 1CF8H 3WKMH 3DO3A 3LEXB 1P4BH 3MRIB 2AQ2A 3BWAA 4G3YH 1A47A 4E41B 4J4PA 4MJ5B 3QDMA 1AGBA 2GTWB 4KTEH 4Y4KA 4CMHB 4LSQL 3V4PL 3PF2A 5FV1L 1SQ2N 3IRPX 5IQ9A 3LKNB 3MJ9L 5F7NC 5DRZA 3SDAA 1KXTB 3QDJB 4J12A 1B0RB 2JB6A 4JDTL 3FB6B 5D7IB 3HS0A 3VXQB 1E27B 3QR2A 1IGTA 4J7RA 3JV6B 4OIIH 1J8HA 4P2CG 4QNPF 4P5MA 2Q7NA 4WWID 4Z7NE 4ZUUB 1HKLH 4IHOB 5DJ2B 3HC0B 4TTDC 3MRFB 4L3EA 5I15H 3UYRH 4NHCH 3OJDA 2OK0H 4NQUA 4DJMA 4GW1A 4I5BA 1BREA 2R23B 2C5DC 4P23B 4Z7WF 5HYQB 4O51B 5I1EH 1G6RA 1MVUB 1C12A 1OARL 2EIZB 2DQJL 1NKOA 4P9HL 3PHOB 4EOWH 1N7ML 5C08E 2VDOH 4MB3A 3S7GA 2GHWB 3WO4B 2KZ1B 1A6WL 4H8WL 2GEEA 1J0YA 1T20A 3IU3A 3S3PA 2WINB 1MEXL 3AY4A 4BFIB 3GGWB 4NCC1 2YKLH 4X0KB 5CJOH 3L3GB 1QFUH 5F9WB 2EXYC 1CQYA 3VFSA 1G9NH 1TPXC 2E9IA 2D9QB 5CIPB 4RQQA 2YD8A 2NW2A 5D1ZD 4YGVA 4QRSB 5I8CA 5L2KB 1FIGH 1IKFL 4U1HA 1BJ8A 4RNRA 2F8OA 3JXAA 5DFVD 5INCA 4YNYA 3S9DB 2NY5L 5L2JA 1A7PL 3F5WB 1I9RH 3MR9B 2Y06L 2OMBA 3L3DB 3FRPA 4EN3D 1DLHB 5D2NA 3MYJA 4B7LA 4OCRH 4UNUA 1CT8B 1KC5L 1WUNT 1T0NB 4URTB 1E28B 2PN5A 3FZUD 4Z8FL 4G8FA 3PV6A 3QO1A 3BDYL 2PKDA 2NQCA 5BMFL 2DL9A 3E6FA 1AO7E 1Q9LB 2MKLC 3VWJB 5CGMA 2IADB 4EJ1C 2QADC 5I1DB 4PJHA 2A74A 4FQ1H 1UYWL 3IVKB 2QQNL 1FV1B 1MFCL 5GQBA 4RGNC 2OQJB 4LVNC 1NMCC 4LCWA 4QHUB 1ADQL 5ICZB 1P1ZB 2VN7A 4P2YA 2AV1A 1G1CA 3U4BH 4Z7VF 1H3VA 1IEBA 2DQEH 4WGWB 5EO0B 3VXRD 3V6FA 3SKJL 4JFXA 4QHNA 5EC2A 2DMCA 3L3KA 4JY5H 35C8L 4KJWC 4AENA 2FNBA 5MEPA 5KSBB 5DVOA 3MLZL 1GOGA 1U58B 4R96B 3VRLF 5K59F 5A2KH 3OKOB 4H26A 5LXGH 4GG8B 1PBYA 2B1AL 3QHFH 2KH2B 2GSIA 3T4AA 2R2EA 3DVIA 4NBYB 3DMMD 3EO0B 1L0YA 1UB5A 1ZA6A 3JWDH 1LQSR 4HIEB 2F5AL 3OKMB 2P8LB 4PV9A 5JHLL 5K9QI 2V5RA 1ZTXH 4P3DB 1MJJB 3P0VH 2XN9A 1CK0H 3EO9L 4HUWB 4H0IA 4F15C 5E2VH 3VI3E 5BZWA 2FRGP 1BVLA 1ODAA 4LLDA 2R1YB 3H9HA 3RI5F 4N0YL 2BERA 1UM4L 4NDMA 1NCCL 4A6YA 1MWAH 1EAPA 12E8L 3WFHA 2DTSA 4QOKA 3VGFA 3W39B 1T4KA 1IBGH 2EH7H 4DGYH 4R0LB 4LPYA 1RULH 4C56D 3FHAA 2OZ4A 4XBGB 2I07A 1YYML 3CU7A 5HTSA 1QQDB 2I5YL 2VXQH 4GBXC 3MGOA 3OKNA 4HUXA 4GKSA 3HC4L 2W60A 4DZBA 1ERNA 5EBGA 1L6XA 4ZO9A 1QOKA 1YEJH 3PWUB 2X4RA 3I84A 3ZTJH 5IROA 4CADA 5KZCB 4U3HA 5E5MA 5KSAD 3GFUA 1U36A 4Y5XC 3OX8B 5LWYH 4JFYA 3RA7L 5IBUG 4OCWH 1EVUA 1RUQH 3BW9B 5F1OB 1OTUC 2ZCHL 4KJYA 4U1IB 5C0BD 3B9KB 4PTUA 5B4MC 2YD4A 1D5ZB 5FYLH 2W9LA 1I8LC 1NJ9A 2HJLB 5DJ0B 2X9XA 3B2VH 5DHVH 2FLBT 4K7FB 4F9PA 1G9ML 1MJ8L 1JHLL 3U0TB 4LPUA 4N1CA 3N85H 1OB1A 5FFLA 3OHXA 3GMQA 4G6AC 2Z31A 1IAKB 3DECA 5IOPB 3RTQB 1Z2KA 3GJFB 3QXWA 2AEQH 4L9LC 5DMKA 1IQWH 1C7TA 1RFDL 1A3LH 4N5EC 4WU7B 5SV4A 2CDEA 3CFEB 3L95B 5BOPA 3VU2A 2QQKH 3I6GA 4R7NA 4IIQB 2PCPA 4M5ZL 5L0QC 2LE9A 1P7QD 3OZ9H 1K8IB 2V2XB 2HLAB 3K3QA 1SEQH 2MPAH 3VGEA 4LEOA 1J8HE 3ZKQD 1JGDA 3DSFL 3QYCA 4V1DA 4K3HA 3VJ6B 2EZ0D 1UXSA 3SCMA 4GMTL 4WY7L 4F80A 4YFEA 1JWSA 4HC1H 4LCUA 1A6UH 4BFBD 1SYVB 5ENWA 2CLRA 5I73C 4HS8H 4IMKC 4R2GC 4OZGF 1NC2D 1OW0A 3P3YA 2XZCL 4X6CA 5ANMA 3QI9B 2AQ1A 2IANE 1GJIA 5HDBE 2D4DA 1I9EA 5JQ6L 1WIUA 3V4VL 3SKMB 3FFCA 2W65B 4RX4A 1BM3H 3G6AB 4ZXBA 1G0YR 5L88H 1Q72H 1YEHH 3N9GL 2K3TA 4EI5D 5GRUL 3GSRA 4MHHI 3GM0A 4JHAH 1T7WA 4XPAH 3T77A 1AD9A