3ROOB

Murine class i major histocompatibility complex h-2kb in complex with immunodominant lcmv-derived gp34-41 peptide
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
99
structure length
99
Chain Sequence
IQKTPQIQVYSRHPPENGKPNILNCYVTQFHPPHIEIQMLKNGKKIPKVEMSDMSFSKDWSFYILAHTEFTPTETDTYACRVKHDSMAEPKTVYWDRDM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Immune system
molecule keywords Murine class I major histocompatibility complex H-2Kb
publication title Nitro-tyrosination of the immunodominant LCMV epitope gp34-41 alters both its capacity to stabilize H-2Kb and the molecular surface of the MHC complex, affecting TCR recognition
rcsb
source organism Mus musculus
total genus 14
structure length 99
sequence length 99
chains with identical sequence D
ec nomenclature
pdb deposition date 2011-04-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3rooB00
3PABB 1YY9C 1GAFH 4PJHF 4AT6A 1T03L 3WNNA 4UAOB 5EO0B 1QKZL 3LKSA 3OF6A 4TN9A 1WFTA 3AMLA 4X4ZA 3RJQB 3T2NL 4JDVB 1HYRC 2NTFA 2KQMA 2IH1B 4L5FH 1SJHA 4PLJC 4Y4KA 1CQKA 1B6UA 4ZXBA 1VFOA 2DAVA 4QYOB 2Y6SC 3N1GC 5KW9H 4PPTA 3BKCH 2W9EH 1YEHH 4XC3H 1KLFA 4DN3L 4LSPH 2WBWB 3C5ZA 3C6LD 2R56L 4KHTH 4GG6B 2E27H 5LQBH 1HKLL 1U6AH 4XAKD 4QRUA 1FZJB 1JF1A 2BNQB 4KKAC 1OGAB 1GOGA 5FM8A 1ZGLP 1RFDH 2J8UA 1FORL 2GUOA 4NNXA 4OCYL 5DRWB 5BXFA 2IBBA 3LEYH 3NIDF 4RIRB 1MFBH 4HGKC 3GJFA 5KN5A 2YPLE 3UTTA 3GKWH 4JRWA 1JTTA 1IAOB 4NQDE 4HC1A 5DUBB 5L2KA 5I2IB 3SQOH 5KZCB 5I73B 1TQBC 5HY9B 4DOHB 2NY0B 5HHME 1KCVL 1OM3H 4MJ2A 3S34H 1S7RA 3G6AA 4FHBD 1W8OA 4Y89A 1MCPL 1OAKH 2VRAA 1CICC 1TJIL 4EXKA 4JFEB 3H6JA 5TE6H 4JY6A 2AGJL 4QF1B 3GIVB 5EO9A 3MODH 3T1FB 1SMAA 5CEXA 1WT5C 3FO1B 1F2QA 5CJ5A 3KYNB 5J0BA 2W65A 3DURA 5D1ZA 3RUGB 3FFCA 2AK4E 3DMMB 2P5WA 1S8DA 1LMKA 3QUKA 5E5MA 2P7TA 1H5BB 5I1DA 2BMKB 1I3GH 2ZZUT 4GRLA 4JO3L 1SBSL 1OPGH 1JPTH 5HDBE 3GGWB 3PWNB 1XF2A 3KJ4C 3DVFA 1GIGL 4JLRA 4MDJA 4R7NA 2FGZA 5LG1A 3SKNA 5BRZB 4DGVH 5BV7B 4YHOL 4G9FE 3EOTH 4N0CD 4N1HB 3P0YH 4FFVC 3VGEA 1DBKH 1JZ6A 1KCRH 3HUJB 3WSQH 5MI0C 1YYLH 4TVPH 3IU4L 1FV1B 2PXYB 2X4OA 1I9RL 1X5IA 2EYSA 1WISA 3C5SB 4F80A 4NKIL 5J3HD 1MJ7H 1KCUH 3VMOA 3O6MH 2Z8WC 5FKPB 4U7SA 3S9DB 4MD4A 2R4RL 3QQ4A 3LSOA 3V7AG 1NEZA 1I1YB 3N1PC 1NEZG 1DBBH 4F7MA 2DQEL 3CXHK 4OTXL 2X4TB 4AENB 3D39A 1Y6KR 5BOZG 1JK8B 3UPRA 4JZJA 1N7ML 5HHOE 3EYFB 3TWCL 1LEGA 3ZTJH 3U6RA 1T0MA 3EDEA 3OR7A 3GSXA 1G9NH 1HHGB 5CS7A 3TYFA 5B8CB 1UCTA 3JV4B 2V7NB 2R0LH 4U1KB 4V1DA 1II4E 1NMAH 2GJ6D 3DETC 4DGYL 3QDMD 1UKSA 2FR4A 2QJDA 2VXVH 5L88L 3OKNA 1MVFA 4X4XB 4H5SB 1S7TB 2CDGA 4F3FB 3SGJA 2CGRL 4ZD3L 2J88H 2XWBB 2FNBA 3QJFB 1C5DB 5ITFA 2YRPA 5CWSA 4Z95H 4E41B 5IJVA 2FSEB 2IAMD 4MAYA 5KSBB 2VLJB 2IPUG 5F96H 3MRNB 3O0RH 3MV7E 1CDHA 2NY3D 2P42B 4DZBA 4MJ4A 1B4RA 3OGOE 3UTSD 4XMKL 2VR5A 3L5XL 1CD1B 3B9DA 2AXHA 2Z0BA 4P23C 1JP5A 2OL3L 2NX5E 2EZ0D 5D6DA 3F12B 4O51B 4KWUA 4OLYL 1FVCB 3AREB 1QFUL 5F9OH 2FDBP 1QHOA 4OF5A 4PTUA 3QWOA 3CUPA 3QIWB 3MBEA 3Q5OA 3SE9L 4LKCB 4TSAL 4O00A 4AJ0A 5E2UH 3QPXH 4C56B 3DGGB 2Y06L 5D2NC 4N0UE 1G84A 5DRZB 4TSCL 4PJBE 3V52H 2G2RB 4RGND 4YDVA 3SKMA 3QUYB 4HH8A 3TNNA 1J5OH 2WAHA 4PD4J 3U36A 4CGTA 5IMMB 4YXKH 1KIRA 4HUUB 1IL1A 1BQSA 2HWZH 5D1QD 4AEEA 2NXYC 3OJ2C 5DMGC 3D48R 3OPZL 3KS0H 5FO8A 1XGTA 5F44A 3I3BA 1TCRA 3HI6L 2KZWA 4I9WD 5L7XH 4K71B 4LSTH 1GHFH 5IB5B 2QQKL 1LE9A 5JW4Q 3LDBB 1BOGB 4OUOA 4PJ8D 4UV7H 5DJCA 4XNMB 2Q6WA 2C7UA 4JQIH 4NM8L 3VRIA 3G6DL 3KPRA 4I2XE 2BNUA 4PV8B 4NUJB 4LRNH 4HDIA 1RUAL 5D9SB 3QP3A 3SCMD 4P4KD 4MVBC 1MF2H 1OP9A 1FGNH 1JWSB 1F6LL 1H15A 2QKIB 1ZT4A 2VLMD 2AJUH 3SOBH 5T1LA 5IB3A 2H8PB 4PJIA 2Z91A 5IP4A 1L6XA 3GI9L 1OTTD 3QXAA 1BLNB 1KTLB 4IRJC 4HWEL 5IG7A 4HX1B 5IW1B 1QQDA 1BQUA 1Q9WA 4GOSA 3QAZC 3CXDH 2BK8A 3MOQA 5TQ2L 4TULL 5D5MB 5T3XE 3KYAA 4XNQA 1FNEB 1BX2B 1DN0A 1PG7H 1PJ9A 1TITA 1U8PA 3U2SB 3EOAB 3F58L 3LS5H 4LPUA 2F9BT 2IF7A 4H0GA 4X8JA 4WWKC 2HFGH 1D9KA 4OKVA 4NKDB 4YDJB 3TO2A 4QHLB 3T65A 2Q76B 1NMBH 4XBEH 2J8UF 5I18L 2YUZA 4FFYL 4WW2C 3L3KB 5AWNH 5F71A 4QHMA 1N5AA 3Q6GL 2VH5L 2RR3A 4C57C 1YEDA 4L3AA 5GRZA 4M4PA 3P30L 5DQDL 5HYEA 1E27B 2ZOKB 1HI6B 4F33A 4EEEA 2Z93A 3HAEB 1WBZB 4UOW1 4JPKL 1CICA 4NJ9H 3HNSL 2R0WL 2PYFA 1AD0A 1RUML 3F62A 4BK4A 4DGIH 5GGVL 1CG9A 1QD0A 2J12B 4U6YA 3UJTL 4S1SH 5IMOA 4PRDA 1NCTA 4FFWC 4PP2B 3SGDI 5DEFB 4KV5E 3HMWH 1KNOA 3VXRE 5ETUA 2XQYG 3MSPA 1OY3B 1NC4B 1QFWM 4L29B 3MR9B 3QHZH 2ADJA 2BOBB 4CRPA 1L7TL 5EC2B 3NIFE 2EDNA 1PLGH 3MV8B 4H8WL 1OAUH 3UZEA 4UDTA 3MRDB 3O6KH 5L6YL 1J05B 1V5JA 5CKGA 3LOWA 4MSWA 1VSCA 5GGRY 1GPOH 3RZCC 4HLJA 1EO7A 5EBWB 3TO4B 4NQVA 4GRWH 4GW5B 4X98A 3VGFA 4OLVL 2EE2A 3CFKA 3ULVH 2DM3A 1AD9B 4H25A 4JY4A 1P4BL 4F7EB 1C08A 3BD4A 2ATKA 3TBTA 3DV4B 4K7FB 1R24A 1N8ZA 1ROWA 2CRMA 2VDMH 4DFIA 5DI8A 3E6HA 3PWVB 1FL5B 5SV3A 3KYKH 4ZFFA 5GGRA 1UENA 2C1PA 4MNHB 3RWFB 1A1NA 2ZCHH 5FF6B 1KXQE 1P7HL 4N9GB 5EPMA 5F1IB 2AEQH 3QO0A 5F88A 4FG6C 4Z7NE 1LO5B 4HIIB 3LS4L 2XFXA 2FIKA 2I07A 4G6AC 4KKBC 4YFLI 3F7YA 3FO2B 1KFAH 4Y4FB 2CO7B 3ESUF 4ZPTB 5CHNB 4WWID 2E9BA 4K07A 1CFNA 4NUGL 1NLDL 3OKDB 3P73A 4M48L 3UC0H 3BH9A 2UYLB 4MAUL 3FQUB 4QHUB 4YFDB 1UWGL 2H32B 5CP7A 4ZFOB 2QQLL 1FYTB 1WAAA 4ZTOH 1NGPL 2BSRA 4K8RL 1M7IB 3EJZC 4YEFA 1YMHA 3BMVA 2P44B 4WEBH 4PJ9B 4ZAKD 4OD1H 2H9GA 4F37K 3RWEB 1W0YT 4QRRA 7FABL 5J4MA 2IQ9H 5CJQL 2A83A 2Y23A 3F8UB 2BCKB 3V6OE 4XCEA 1EMTL 4P2RB 1HIMH 2F53A 1T0PB 3VI3F 4APQA 2X4RB 4GKOA 3X3FH 2DQCH 2E8YA 4CL7A 1GGCH 1FL3B 1RHHA 1JNLH 1YZZA 1CF8L 1XF1A 1YNKH 5D1XB 5ICXA 2V2WB 2ZUXA 1N6VA 4ISVB 4QXGL 4OI7A 1R3LA 5JZ7D 1UB6B 4XP6H 1Y6MR 1RZGB 1EXUB 1T1XB 4XNZB 4HS6A 1E28A 3TJHD 3QUXC 4PRHB 4WU7A 3PWLB 4CU8A 1TTUA 1J8HD 4U1HA 3HZMA 5EFIA 3QEHA 4I3SL 4MJIB 1KJVA 3PWJA 2M8XA 4NRXB 5I66A 2E9IA 4GSDL 2VYRE 4L3CA 4U1SA 3DWTA 3FQRA 3E3QE 4M8QB 4HULB 3P4NA 3O4OB 4JN1L 1SJXA 3K3QA 1UH4A 3LN4A 3R4DA 4MQTB 5DMKB 4XRCB 1JPSH 4UDUB 4PRIA 2H26B 2DQDL 4OSUH 4HEPG 1T22A 4J8RA 4LPVA 3QO1B 1JTOA 2O5XL 3SDAD 2G60L 4W6WB 4M5ZL 4OCLC 4PGEA 1SJEB 5D2NA 1G7PB 5T1KA 4N8VA 4MA1C 3VMNA 3K4AA 4N8VG 4M62L 5HGHA 1VFBB 1H3PH 3CFCL 3H9HB 1FG9C 4W68A 1G7MB 3WFHA 5BV7H 3MLZH 3BZDA 3BEVA 5DDHA 2XKUA 3PJSA 5C0DB 3L3JA 3C2SA 5DVOA 1E4WL 3NPSC 4GKSA 1RULH 4B41A 3LAFA 4G8GE 3MOAL 4XWGL 2EC9U 1A7NL 3GNML 1ZLWK 2ZKHL 5DMJB 3OAYH 2VZSA 2F54B 3KNBB 1RURL 2APXA 3ARBB 4NNYA 4GRMB 1ULVA 4XBGA 3GMNB 2QADB 4OZHA 1XZ0A 1HXMB 3ABZA 3MXWH 1LO0H 2AQ3A 3LIZL 5DJYA 5KSUA 2KBGA 3ZHLA 2ADFH 1RJLA 1CD0A 3BDXA 3U1SH 4FQ2L 5C0BE 5H2BA 4NQXB 3MO1B 4R0LA 4KVNH 3MREB 2W1NA 4W70A 2VXTL 1EJOH 1Q94A 35C8H 4PJIF 3Q0HA 5KG9A 1N26A 1U58A 1YN7B 3QG7H 4KH2A 5IB2B 1NQBA 1JWUA 4Y1AD 3B6SB 1KIPB 5FO9B 1X5FA 2IFFL 3F65A 3GRWL 4LLWB 2GJJA 2RQ8A 4UIKL 4KKNA 1A7OL 4JGMA 4PJHB 2DBLL 4L8DB 4PJEA 3IDXL 4IIQC 2A0LD 3JTSB 3VXME 2VE6B 1JGEA 1N0LA 1NSNL 2XICA 3JWOL 1I8KB 5IMKB 3KXFD 1NMCC 3FTGB 1KBGL 3TBSA 4DKDC 2D31A 3UROR 1RPQA 5GGUB 4MA7L 4NDMA 1DE4B 2YXMA 1RU9L 3QJHB 5J56B 2FWOA 2HH0H 2X5PA 5JW4M 1MHCA 3ALPA 5IBUG 1SQ2N 3U0WL 4GLRH 3MQIA 2X9XA 3UBXB 5C08E 2W9DL 3QEQE 3AMKA 4LLVB 1S7WA 3VWKB 5FCUL 3QH3A 3CSPA 3C6LA 2DQGH 5ID1A 1U8LB 3QHFH 1R0AL 1I7UB 4ZTPL 3RWDA 2KH2B 4K9EC 4X9BA 1QBLL 5C0EB 4OZFB 5FKAB 1U8QA 5JQ6L 1UYWH 2OZ4A 1ZSDA 1DQJB 4RFEA 5DC4B 2R2BB 3SKOA 3OX8A 2WMPA 3L5WB 5IESL 3QEGH 5FOBA 4DQOH 1OQOA 3ULUH 1GZQB 2CIKA 4GG8A 1GXEA 3TVMB 1FJ1A 1WWWX 2B1AH 5EB9A 1UWEH 1SEBB 3CDFA 4MD5A 3FT4B 4KI5E 3TFKC 2R1XA 5D7KE 1RUPL 4R2GC 4PR5B 4NBXB 2FYYB 3FO9B 1I7RB 1U93B 2VUYA 2DQFB 3RZCA 5GHWL 5FDYA 5MEOB 3QUMA 2ZWLT 1YEFL 3NN8A 5FK9B 1SY6L 1K3ZA 5D6CA 5C07E 4QXTB 2NY7L 4Z7OF 3D3VB 3UTQB 1YEJL 1W72L 1ADQA 3MRIB 1JNHB 3QQ3B 1P4LA 3QI9D 3U30C 1DDHB 5ANMA 2HFEA 1A9EB 3E0GA 3M07A 1ZHBB 4YQXH 2G5RA 1FVEB 4LCCC 5ABDE 1PSKH 4POZC 5KVDL 1NCUA 2YD9A 1UH2A 4IS6A 1RZ8A 2ICEA 3PP3K 5CBEB 1NJ9B 1EEZB 4K3HA 4ONGH 3KYMB 2HVJB 2Y25A 5FGCE 3OAUL 1C7TA 2J5LB 1K2DB 3RWJA 1ADQL 4PJAA 5CZVH 1ND0B 5C0CD 3T2QA 4ZPVA 3ZE0E 2IFGA 2Y9RT 2QHLA 3F5WA 4L4VA 4P2OB 4Y5YC 4OLWH 5ADPL 1EO8L 2CK0H 2X70A 1NUDA 1Q9KA 2XWJB 4YHKL 5T1MB 3C8KB 1T04A 5TGBB 2IG2L 1XEDA 1K9TA 3I50L 5EIVA 3PWPE 4GW4B 5C8JA 1S5HB 3WLBA 5FYJE 1WAAF 1MCHA 4XI5C 2AVGA 5CJOL 5CEZD 4KK9C 1F4WL 5HHVL 3HPJB 3PL6B 4IMKA 4GUPA 5F3HA 1FSKB 1LEIB 1MI5A 5DGQA 3B9AA 4BUGA 1JWMA 4DTGH 2GEEA 2P5EA 4Z76B 4LLQA 4XCFL 5HPMA 4PFEA 1A2YA 3BGFB 2MCG1 2Y07L 4JRXA 2V17H 4UQ2B 5A3IC 1B0GB 1TETH 5SWZB 3KJ6H 4F15C 3QIBB 3GO1L 3D2UD 4K55A 2NPLX 3JSSA 1VGKA 2G5BA 3RIFK 4JO2L 1FP5A 4GMTL 5A40E 5DT1H 3HAEH 4Y2DD 4I0PB 5FM5O 4AZ8A 1QSEB 1AHWB 2DKUA 2B20A 1ZOXA 4NQCD 1T3FA 1F4AA 4S0SD 2EXWD 4CN6A 1PZ5A 4U05A 3BP7B 3EDJA 5I8KH 1JZ8A 2J4WL 2W0KA 2R4SL 4CKVX 4YBHA 5C0AD 3X3GL 2B1HL 3R06B 1DVFD 2RFXA 4IOSD 3WFCH 4LSUH 1KG0A 1QSFE 3NTCH 4PBXA 3IDIB 2BOCB 3SDXE 3EJJX 2C1OA 5IFHL 3PDOB 2FZ3A 2GJ6A 3EO1B 3T0XA 1IAII 3DROB 3PHQB 4HUWA 3H7LA 3ILQC 1FFPB 4PLOB 3EYUL 3HC3L 3HLAB 3RKDD 1S9WA 3WFEH 5BVJB 1MCOH 5C0FB 1JBJA 4ZNEE 3HE7D 4BH8B 1I1CA 1H0DA 1ZVSA 1KJ2B 3MJ9L 4MXWL 1U8MB 1OD9A 4PG9A 3QCUL 5DD5H 5JW5A 4YHIB 4YBLC 4LEXH 5DEGB 2NY2D 2IGFL 1JGUH 3CU1A 4XNYL 3BPLC 4M7LH 1VPOH 3RGHA 4EQ3A 5M94B 1EHLL 3QFDA 5C9JA 5JTWA 3B2VH 4AIZA 4MCYA 4XPBH 5FV1L 4B0MM 2EDOA 4LCWD 3ARDC 5I1AB 3AXLB 4P5TD 3HA0A 5HDLA 3HR6A 5F6IB 4M6NL 3AB0C 3QRGL 3AGVA 2BVQA 4Q97A 3BD5A 1UCBL 4UIMB 1RZIA 3LY6A 3RVWD 3BP5A 3NFSH 4IOFD 1NCCH 1RK1A 3MV9E 4ZUUA 4OZHF 4PY7B 2XQBH 5DRXA 3BQUB 3P4MB 1RUQL 3U0TA 5EIQA 1LD9B 2XA3A 1VEMA 4FXKB 4ZS6C 3PV6A 2NCMA 4LLDB 5DA4A 3FFDB 4DK3A 3S37L 4HIEA 2Q7NA 1J1OL 2YD2A 4TVPD 4N8CH 2DQJH 4JKWA 3K81A 4D8PA 4X4MA 2WUBL 4S1DC 3IJHA 1EA9C 1TXKA 3L5JA 4IIQA 5FA3A 1D5MA 3UP1A 2ZUYA 1VACA 2XY1A 5LGJA 3DVNA 1IM9A 2OBGA 3D9AL 4AT6B 2DI7A 1XGYH 2FB4L 4PJEF 5EZIH 2R8SL 3SCMA 4HD9A 2IJ0C 2Y1VA 1OSPH 3LKSB 4ONHB 3SHSA 43CAA 3VXSE 2NTFB 1ACYH 2VDKL 5I74B 4OZIE 3C60A 1SJHB 4Y4KB 3RGVB 2MTPA 4ZXBB 3S7GA 3GHEH 4P3CL 3WXVL 3O2DL 1J7VR 3JWDC 4ETYA 2VB5A 3QUZC 5JOPE 3C5ZB 5DHVA 1IAIL 2RCSL 2AJXH 3O45A 3W39A 2BVEA 5BS0E 4QRUB 1JF1B 4M5YH 2BC4A 4I4WA 2JJSC 3O41A 1QLEL 3OKOA 2ARJQ 1KENH 4NWUL 3ZL4H 2J8UB 1BEYH 2GUOB 4NNXB 1RIHH 3BE1L 1TZGH 5BXFB 4PJGA 4DN4L 1BF8A 4YWGH 4HUNB 2FO4A 2P49B 3GJFB 5KN5B 5E2VL 3MLWL 3UTTB 3RPIA 5TJWK 1U95A 1MY5A 3TT1H 5L2KB 4JDTH 3EYSH 2NY6D 5IM7A 5E6IC 1KXVC 3T0DA 1AE6L 3V4UH 3JVGA 1S7RB 2B2XL 3G6AB 4UBDD 2NZ9D 5I8OL 1NBVL 1SBBA 4Y0GA 2CPCA 1T7ZA 2GQHA 1NANH 4JY6B 4QO1A 4HUVA 3BVNA 3DXAA 5EO9B 1E6OH 3RVTC 5CEXB 4Q9QL 4HGWA 2PTVA 4LCCA 2VWEC 3TYGL 2W65B 3DURB 3BIKA 4M1GH 5D1ZB 2X10A 2E3VA 4XWOC 4UV4H 4NO5A 4H1LA 3FFCB 4GXVH 2P5WB 1S8DB 4H1LG 1LO2H 5JDJA 3QUKB 5E5MB 2P7TB 5I1DB 3W0WE 1A7QL 4GRLB 2YA2A 5DGRA 1P6FA 2ICWA 1I7ZA 4YZFE 3W9DA 4JHZA 1X44A 4ODVH 1XF2B 5IQ9A 1G7HA 1MFEL 2VKWA 4JLRB 4MDJB 2V5MA 2APFA 1CQYA 4I1NB 4R7NB 3SKNB 5L8LB 4PJAF 3TZVC 2HJLA 2QEJA 2XZCL 1JGVH 3QA3A 4RWHA 4K23L 3WFZA 3OL2A 1ED3A 4HUXA 4YXHL 2X4OB 4QXUH 4XP4H 4L1DA 5EU6D 4KZDH 2EYSB 1Z5LA 4A6YL 2DQHH 4WFFE 5K9JH 2VMFA 4LQFL 2F19H 1R3IH 4M93B 1A22B 4MD4B 4FQCH 3QDGA 2A73A 3QQ4B 3LSOB 4XX1E 1NEZB 3WLWC 4E0RA 5FM4A 4RMWA 1V3MA 4Y5VA 5E8NA 4F7MB 3F7QA 4M1CD 3S36X 1KB5L 2BY3A 4P59L 3D39B 3UPRB 3RHWF 3MJ8A 5EUOA 1AQDA 2F5BH 2G75A 3UJIH 1EAPA 2FL5A 4JCLA 3QNYA 1LEGB 1F6AA 4LVEA 1G1YA 3L3GA 3U6RB 4LPCA 4OZFH 1T0MB 1BZ7A 3OR7B 4PTTA 3GSXB 2M1KA 2P48B 4QGTA 3LKRA 3TYFB 5DVNA 1VFUA 4K7PL 2GI7A 5FHBH 4V1DB 4ZAKA 3BWAA 1DLFL 1OARL 1D5IH 4PS4H 1UGNA 2DTML 1AGCA 2LU7A 3DOSA 3EDKA 3WDHA 2FR4B 2OMNA 3ROLA 1RMFL 3OKNB 2JCCE 3MPCA 1JNJA 1ZK9A 3ALXA 1CI5A 4S1RH 1JI2A 2CDGB 2A6IA 1DP0A 4QNPE 1S7UA 3H8NA 5ITFB 5CWSB 2H1PH 4JM2C 2D7QA 2V5TA 4G7VL 4MAYB 4Y4HD 4G7YL 4M9PA 1Q72H 3K0WA 3T0VA 1KGCD 1J8HA 3DSFH 3GDBA 4DZBB 3S4SA 4C55A 1KACB 1UH3A 1F11A 1YEKL 2AP2A 5DR5H 4CNIA 5JA8B 3S4SG 5DO2C 1VADA 3ARDA 4TQEH 1W0WB 4P5KA 4LDOB 5GISL 4Z7VE 1KELL 1ZTXL 3NZ8A 4UOW0 4UNTA 2AJVH 4KI1A 1SM3H 4PTUB 3QWOB 4Y19D 3CUPB 4OBRA 3CH1A 3MBEB 4L9LA 5I1KH 2I26N 5DUML 4G6FD 4H8WC 3AU1A 3P9MA 1D7FA 4YDVB 3SKMB 3TNNB 4LSQH 2ZUVA 3HI5H 3U36B 2COQA 3D0LA 1KIRB 5T3XL 4DW2L 5GGQH 1IL1B 2DICA 4XC1H 4ELKA 4XCCL 1QBML 4HW6A 2ZG2A 1BOYA 4RWYL 3ULVD 3KPSA 5FO8B 1XGTB 2LV4A 3O2WL 1TCRB 4I0KA 3DI2B 5F89A 1I75A 1ZGLM 5J06A 4OQTA 1I8IA 4XPAL 3BFOA 1LE9B 1JGLL 2HT3C 2CKBL 3HNTL 3V95A 5EOQH 2Q6WB 1G6VK 3OAYK 4D9QE 2C7UB 3VRIB 4GAJH 4DZ8A 3KPRB 2BNUB 1KC5L 4U1NA 4HDIB 5J6GA 1LO4L 3GI8L 1PKOA 1UM4L 1H15B 1ZT4B 4KKCD 5I1IL 1CD8A 4W6XB 5ACLA 1MPAH 3HRZA 5T1LB 5MP6H 2PR4H 3X17A 5IB3B 4R26L 4PJFE 4PJIB 1GGYA 1IBGL 2Z91B 1MRDL 3QXAB 3TN0A 2APTA 3OJDA 3QUZA 4TTDD 5IG7B 1YJDH 2DIBA 4Z0BH 4UT6L 3B8YA 1QQDB 2OP4L 1Q9WB 4FQLL 1NEUA 4ZUWA 4P9ML 4DKEH 2BNQD 4XNQB 2JKXA 3ZKMC 1DN0B 1U8PB 4NC1E 1OGAD 1FG2A 2FGWH 5TF1H 4X8JB 4ZOBA 4NT6A 4Y16C 5DQ9A 4GJTB 1RY7B 3PGFH 5C0NC 1D9KB 4OKVB 3MUGA 3ZYOA 3SO3C 3TO2B 3T65B 2LTQC 2H2SD 1KJ2H 1M1SA 3MOBH 3BISA 3ZKND 5KZCD 4HFUH 4PJGF 4QHMB 1N5AB 1D6EA 2YD7A 5E8DL 2XN9A 4KGJA 3DYPA 1L0XA 1BP3B 1YEDB 2F74A 4YDIL 1HHHA 4YNYA 1A6ZA 1TVBA 4H20H 3K46A 4F33B 2PYEE 3OXRA 2Z93B 1DQML 1U3HC 4JFED 5DEZA 4PLKD 1CICB 2PYFB 3ARQA 3TA3C 2ICES 1P2CA 1AD0B 1E4XI 4MNQE 5B3JE 4OV5A 1INDL 5C2BH 5F21B 1CG9B 4B53A 4M43L 1U8JA 4U6YB 2YA1A 3FZUD 1CE1H 5IMOB 4PRDB 3HG1A 1XF3A 4X5LA 2UZXB 4ZODA 4O58H 5FGSA 4XVJL 1KNOB 1LNUA 2BY0A 2VDNL 1MNUL 1F4HA 4FQXA 4J3UA 5IOPA 5ETUB 2BNRE 4HT1L 1CXLA 2ADJB 3MYJA 5K9QI 1R3JA 1TVHA 4NWTH 3KJ4B 1F8TH 5GRWA 5BRZD 4N0YL 5JLZA 1IC7H 3SDYL 3OKLA 3NABH 4UDTB 4KUCD 3FB8A 3HNVH 4MHHI 3DPBA 3HHRB 4MSWB 5EZOH 5KVFL 1RI8A 5HGDA 1UG9A 5MI0B 2XNAA 3MV01 2PXYD 4NQVB 4X98B 5D70H 5E6ZA 1UKTA 2OMBA 3CFKB 4ODUA 4OM1H 3CSBA 5EU3A 1INEL 4H25B 4JY4B 2VQUA 4KDTA 1C08B 4LU5L 1JPFA 3WS6C 4OIIL 3T0EA 4JFFA 1IM3A 2ATKB 3TBTB 1EK3A 3DRQA 1R24B 1N8ZB 3FN0H 5DI8B 4MB4A 4XZUA 4V2CB 3E6HB 4OD3L 3SE8H 3C08L 4YC2B 3N06B 4X83A 3MRRA 5GGRB 4RDQG 4JCMA 5HHMD 2C1PB 4FQ1H 1F45A 1A1NB 4P4RA 5EPMB 5F88B 3QO0B 1FAIH 4IRSA 2XFXB 2FIKB 2EE6A 2I07B 3F7YB 2HLFD 5GS1C 1OTUD 3I84A 3VGGA 4HIXH 1CFNB 2BY2A 2EDXA 3P73B 4KKLC 2X09A 4FABH 5EUOF 3BH9B 3NPZB 5J13B 2WSKA 3B83A 1AKJA 4U2ZA 4LARL 3RBSA 5CP7B 2ZCLH 4LFHG 5DJAA 2BSRB 5C6TH 1FNAA 3L6FA 1YMHB 3N85L 1C5BL 2XA8H 1IGCH 3DO3A 2H9GB 4CUCA 1RHFA 2OI9B 4I13B 4QRRB 3JWOC 5GGVY 3VRJA 2K9UA 2A83B 3QIUC 1WV7T 4XCEB 3GB7A 2F53B 4OCWH 4APQB 4M7JL 4G9FD 3LQMA 1NCDL 1WJ3A 3N1FC 5KVEH 3GM0A 3NGBC 3SBWA 1JHTA 1RHHB 4E41D 1CR9L 1JZ2A 1WTLA 3CX2A 2VZOA 4XBPA 2VLJD 5ICXB 4OI8A 4KRPB 1MFCH 1E4XL 1RZJL 2OJZH 4Y2DA 1R3LB 5CEZL 3CVHL 4HS6B 1E28B 1G9MH 4WU7B 4NQCA 1BZQK 2VISA 4U1HB 5EFIB 1XT5A 5I1CL 3QEHB 4D0CA 1QRNA 1KJVB 3PWJB 1HNFA 4P23B 3G5XA 5CSGA 5I66B 4L3CB 3RTQC 4U1SB 3FQRB 1IKFH 3ARED 4JG0L 3IVKA 3Q48A 5C86A 4UUJA 1OTSC 3P4NB 3LN4B 5I19L 2Y36L 3DX9A 3QIWD 2RB8A 5I0ZA 2GYSA 4TUJA 4PRIB 3ULUD 3IU3A 4C56D 5KW9L 1T22B 2EEAA 4J8RB 3BKCL 5KBNC 2XTJB 4OGXL 2W9EL 1YEHL 5C3LD 4XC3L 4PGEB 4LSPL 5D2NB 5T1KB 4N8VB 3ARRA 3QUYD 1S7SA 4DK6A 5LQBL 5HGHB 1FYTE 4G6JL 5GZND 3DX6B 4PUBL 4Z78A 3WFHB 3ZO0A 4LRIC 3BEVB 5DDHB 5F7HA 5EULV 5DS8A 2C4FT 4OT1H 1Q0XH 3PJSB 5GRYA 3L3JB 1A3LL 4F9PC 1Q8MA 3LEYL 3NA9H 4P2RE 1MFBL 1IT9H 1MHPH 2NYYC 4GKSB 5ERWA 1W8NA 4JM4H 5I75B 1BPVA 4LCWA 1G7JA 1T2QH 3SQOL 3HE6A 5I1LA 3RZWA 2IMMA 4KGLA 5E2WH 4XBGB 1UT9A 3H9ZA 5HI5D 4OZHB 1XZ0B 4S0TD 5GRJH 4JFHD 1OAKL 4OAWA 5DA0B 3BIAX 5KSUB 5DJYB 3GFUA 4LVNC 5GSVA 1RJLB 2YUVA 4KAQH 5H2BB 5TE6L 3ARZA 3MODL 4CJ1A 4R0LB 3D6GA 4UTBH 1AR1D 2X40A 2B5IC 3LV3A 1G6RA 1Q94B 4Y2OA 1O0VA 4EI5A 4KY1H 1Z0NA 1N0XH 3B4NA 2FHBA 2FHCA 3L9RA 3QXVA 4F7TA 4Z7WE 1U58B 5IVOA 1Y18A 1OLZA 3UAJD 2CD0A 3FB5A 1JWUB 2ESVA 4NN6C 1I3GL 4UMGA 1OPGL 3B9KD 3GIZH 3IKKA 1DL7H 3T0AA 4PJEB 1RVFH 3MUY1 4NQUA 4DGVL 1JGEB 3FOMA 4NKMA 3EOTL 3NA4A 4M6OH 2OXHA 3U4EA 4D0DA 2R9HC 4KUZL 4TUKH 5J9PA 1F6FB 1DBKL 5I8EA 1S7VA 1FE8H 1KCRL 1ZANH 1A14L 1YYLL 4TVPL 1RD6A 3TBSB 1L7IL 2D31B 4AK1A 1ZVYA 3EFFA 4NDMB 3ETBF 5IBUB 4PIRF 3REWA 5EWIH 4M7LT 2Q3ZA 1IFHH 4G9DA 5GRXG 3MLXH 4JJHA 1MJ7L 1KCUL 1U3HA 5FYLE 8FABA 2AV7B 3O6ML 1C7SA 1SYVA 1S7WB 2C3HA 3SE4A 3QH3B 3C6LB 5ID1B 3BD3A 2MNUA 4Z8FH 3RWDB 2ZUSA 5L8JB 4RSVA 1U8QB 1ZSDB 3OKEA 1JYVA 2KQNA 4YPJA 2QHRH 1QYGL 2E6JA 3SKOB 3OX8B 5TFSL 4D9RD 1NCAH 1T1ZA 2Q3AA 1NFKA 1UACL 5FOBB 1G0XA 1GGTA 2CIKB 1CGXA 1B2WH 2FCBA 4GG8B 3SY0A 2YS4A 4JANA 1FJ1B 2DWEA 2X1XR 3MV8D 4MD5B 1SEQH 1OLLA 1WITA 2R1XB 1DEEA 1G9NL 3AUVA 3FRPA 4JPWH 4BZYA 1CXKA 1EHNA 3ARFD 5CBAA 4AQOA 1NMAL 1MLCA 3AC0A 3MRPA 3TO4D 4JKPH 5EZJA 3RZCB 1TIUA 3A6CH 3QUMB 2VXVL 3NN8B 1PEZA 5TPWL 3BUYA 3ALWA 5DMYA 5SWSE 4KJQD 4HIHA 5ISZA 3SDDD 1YYML 4ODHH 3WS6A 4TOYL 1P4LB 2DM7A 2QBWA 4P48A 5ANMB 3PHSA 2KL6A 2J88L 1EZVY 2HFEB 2IAMC 43C9A 5I30H 5E5RB 2PTTA 3HMXL 4OCSH 5F96L 3EDDA 3VI4F 3VFVA 3L95A 3O0RL 3ME0A 4B50A 1RZ8B 2ICEB 2OS7A 4RDQF 4KK6C 3U46A 3Q2CA 4Y4FD 1MELA 4TNWK 3TT3L 4XTRD 2C3VA 3RWJB 4EZMA 4PJAB 1IC5L 4ZPVB 5EU5A 3F5WB 3QDJA 1DFBL 4L4VB 5F9OL 5FOJA 1NKOA 5I1HL 2X70B 1Q9KB 3BJLA 4M7KH 2XG4A 2Y4SA 4XVUC 1T04B 1QP1A 2UVEA 2HJFA 3QPXL 2OTPA 3CLEH 4PJ9D 1BIIA 3QSKB 3ZDXF 1A3RH 5C8JB 5EU6A 3WLBB 5HYJA 3NZHH 3S37X 3SKJH 4OZGE 2IPTH 1J88A 1AO7A 4GUPB 5F3HB 1MI5B 4YXKL 4QT5A 1JWMB 3JBG7 2AQ2A 2P5EB 4LLQB 2DD8H 3A67L 1S78C 1A2YB 5HPMB 2VNCA 5E1AA 3K2UH 3K4DA 4JRXB 5D1XD 2X7LA 4JG1L 2A74A 2W60A 1A1OA 1RJYA 1VGKB 4JFOA 4PRHD 2G5BB 1GHFL 1R6VA 2EDYA 5HHXL 4ORGA 3RWIA 5JHDE 4UV7L 1T3FB 4HH9A 4MJID 5CJXA 1PZ5B 3DHMA 5J6HA 4XXDA 2YZ1A 5AD0A 1G7LA 5FYKE 1MF2L 4QY8A 3P11L 5K93A 2YZ8A 4NKQB 1FGNL 2RFXB 1WWAX 3RVVC 1KG0B 2FX8H 5I71B 2AJUL 5IVXA 2C1OB 4L8SA 2FZ3B 2GJ6B 2CXGA 3DJ9A 1T6WA 5KOVC 1MCDA 4HUWB 3OJVC 4BFIA 2WBJA 3O9WC 3UJJH 3FN3A 5JOFB 1S9WB 3KVQA 4LASH 4Y8AA 3CXDL 1EBPA 4BQBA 1J10A 1XR8A 3BX7C 5E4IA 1ZVSB 1PG7L 1BGXL 4I18A 3MNVA 3LS5L 3MBXH 4IRZH 2WNGA 4PG9B 5KANG 5GS2H 4LPTA 5C0IA 5JW5B 1XFPA 1YNLL 4Y4HA 3IJSA 3OGCA 4JRYA 1YEIL 4XBEL 3TH2T 1RK0A 3NPSB 4NZUH 3QFDB 4CMHB 5C9JB 4AIZB 4MCYB 3ZYIA 1KJ3H 1RJZA 3C8HA 4WI6A 2AEWA 3E8UH 3ARBD 2P43B 1IC4L 3NCCB 3BOVA 3G08A 2Z9TA 3IAQA 1FIGH 2BVQB 4LNVA 4JN2A 4XHJC 3LQAC 3TNMA 3PGCA 1RZIB 3ZYJA 3BP5B 3KPTA 1RK1B 4ZUUB 4D94A 2ED9A 5DRXB 1FZOA 1QFPA 1HINL 4RMTA 3GSOA 3U0TB 4R4FL 4MLSA 5DHXB 3PV6B 2IC2A 3K8MA 2ZUWA 4OLUH 1T5XA 5AAMA 2FBOJ 3HMWL 1J0KA 4HIEB 2J6EL 3MACH 1CK0H 3H3KA 1NGZA 4D8PB 3IJHB 5FA3B 3FONA 4IIQB 1D5MB 3I85A 4U1JA 1VACB 2EDTA 1IM9B 5LGJB 1IGMH 3O6KL 4GMSL 2MQ3A 1BJ8A 1KSRA 2AJSH 1TTFA 4JDVA 43CAB 3ULVL 3NCYS 4MJ5B 4WTWA 4Y5XA 4X8XA 5ECJE 3C60B 3S98A 5ICZA 3HCVA 3SDCC 1MFAL 3VXUE 2LVCA 3ILPB 3HPLA 2CRYA 2D3VA 4G5ZH 4LCUA 5K33A 2VDML 2JLLA 3VWKD 4BFBD 1DBAH 5IGXH 2D9QB 3MLTA 1YMMA 3QBTB 3VFNA 2DMBA 4FQHB 4J1UA 5DHVB 3S3JA 2YKLH 2ZCHL 3T3PF 3LEVH 3CVIH 3QQNA 2OX5A 3O45B 1ERNA 2LE9A 3W39B 4A2MA 2AEQL 2Q8BH 1T7WA 1A7PL 2AQ1A 2BC4B 1KFAL 4I4WB 4ZUVA 5T3ZE 3O41B 3OKOB 2WWKT 1MFNA 3BYTA 3R8QA 4KJWD 4NIKB 1I1AC 5IK3A 4HEME 4PJGB 4M8VA 5CIPH 1G0YR 2FO4B 1N5YL 2NR6D 4ZTOL 3RPIB 1U95B 1CDCA 2OJEA 5ACZA 2HRLA 1R5VA 3B43A 4H88L 5L9DL 5MENE 4OD1L 5IM7B 4LBEA 1U8HA 4FQJH 2IQ9L 5IROC 3TV3H 1T89C 3D3VD 4JFEA 4QTHA 5EN2A 2XZAH 4NN5B 4OLEA 2GITA 1WUNT 1HIML 2AKRA 1XIWC 2M2DA 4RAVA 3OKYA 3FO1A 1GGCL 1YECH 1IQWH 4HUVB 3BVNB 1JNLL 3DXAB 4ZSOE 1YC8A 4HZLA 4GBXC 3BN3B 4HGWB 5JZ7C 4LCCB 4I0CC 3BPNC 1MCEA 2VLRD 3I6LE 5GJSH 4JPVH 4MA8H 4NO5B 4H1LB 3EYQD 3QEQD 3ZTNH 1FIEA 3LD8C 4AG4H 4GLRI 5DJ8A 5DC9B 2PETA 2HT4D 3VGAC 2ICWB 1I7ZB 4PJ5E 3W9DB 4P2OD 3MLUH 4LLUA 2FBJH 1EBAA 1G7HB 3QQ9C 2QLVB 5IQ9B 4HBQA 1HSBA 1OT2A 1E4KC 2HJLB 1JPSL 5ILTH 3GK8H 3SDAC 3QA3B 1Y0LA 2DQUH 2VLKE 3D69A 5DTFA 1FNHA 2A1WL 1ED3B 4L3EB 4N90D 4HUXB 1BAFH 2V5YA 5SX5H 3FCTA 4GAGL 3PL6D 1Z5LB 5DJDA 1JHKH 4YX2H 3H9SE 2YPLA 4NQDA 1CN4A 5BV7L 3MLZL 2E7CA 5L2KE 4O02H 4BM7A 3TPKA 3QDGB 5BZDA 1OW0C 2A73B 3QIBD 1NFDE 3NIGF 5IWLC 4E0RB 4MQXC 4Y5VB 5E8NB 4HWBH 4N5EC 5HHQA 1DANU 5FA4A 1P7QD 3L3DA 4KTDH 4BUHA 1UM6H 3MJ8B 5EUOB 1AQDB 3CSYA 1JYXA 2G75B 2KUTA 3MXVH 4HPOH 5EOCH 1EAPB 2FL5B 3AS0A 3HB3D 2ARWA 3QNYB 3RVXD 1F6AB 2HKFH 3MRLA 3L3GB 2OQJA 5E70A 3MXWL 3WUWG 1LO0L 1WLHA 1BZ7B 4JPIA 4PTTB 2AK4A 4BQ8A 5IVZA 4Z77A 1MJJA 3LKRB 3FAWA 5D4QA 4JFZL 4ZAKB 3BWAB 5EZLA 3MUJA 4JFQA 4KVNL 5IVXF 3GMMA 1AGCB 1MJUH 2CSPA 1S7TA 35C8L 5I17A 3VG0H 5ALCL 3ROLB 2O5ZL 4GQPH 5INDA 1ZGLA 4G9FA 1HWGB 4F3FA 3GJFK 3WS3A 3NCBB 1NCNA 4NO0D 5E95B 2A6IB 1OAYH 1ZA6B 4NKOA 4Q58C 1S7UB 4EQ2A 1HQ4A 2FATH 4OM0H 3WV0A 3KPLA 1L0YA 1QBBA 2E6PA 5CP3H 3T77A 4ALAH 3QUMH 3EGSA 3BPLB 4WO4C 3WYRA 4AEHL 1MRFL 1J8HB 1B9ZA 3EDFA 4P3DA 1IZKA 5D7LE 3S4SB 4CNIB 1F11B 1JTPA 4LHUA 3B2UD 5D2LE 3WN5C 2XTLA 4LHUG 1VADB 2YMXH 3ARDB 4P5KB 2EC8A 4UU9A 1T83C 3SGKC 4K2UL 2A6DA 3NZ8B 1MFDH 4KDWA 1BWWA 3CH1B 2A6KA 4L9LB 1FQ9C 1L9NA 5KSAC 3BKYL 3RBGA 5HHOA 3BQUD 3WIHH 1JYWA 3O8XC 1JRHH 3DRTA 2VZ1A 2O61A 1WQVT 3AU1B 2ID5A 3P9MB 1UYWL 4CMMA 2RHEA 3QFJB 4JHBA 5KSVA 4P46A 3D0LB 5BW7C 3QEGL 3X14A 1A3QA 5AEAA 2Q8AL 4ELKB 1KV3A 4DQOL 2OR9L 3ULUL 5CEYB 5E5UB 1OHQA 4F9LA 4I77L 3KPSB 3BN9C 4GRWF 3O3UN 4DVRH 4C58B 5F89B 4FP8H 1I8IB 2GHWB 4PV8A 3P0GB 4DZ8B 4F2MA 3OF6D 3FRUA 1ZS8A 1I8MB 1JMZA 1AGFA 4U1NB 1NL0H 5ID0A 4E9LA 5J6GB 2VWEE 2LU4A 5J1TC 4YFEA 3CFBA 2BHZA 3MV7A 4U1LA 1QA9A 4Y4KD 3RGVD 5ALBH 3REVA 2P4AB 1NGWA 4ZXBD 3HRZB 3SDCA 1A6WH 5DVLA 2BVOA 5E08L 1U0QA 4DKFL 2GTWB 4CU6A 2DLHA 3TN0B 3QUZB 3OJDB 3C5ZD 1HHIA 4YQXL 4R8WH 1MRCH 1PSKL 1HWHB 3STLA 4ZUWB 4WFGE 1N6UA 5F8RC 4ONGL 3MV9D 2ARJA 3MZGB 3B9KA 3CMGA 4F57H 4NT6B 4HS3A 4N0UA 5KVGH 5CZVL 1NGQL 4MJ6A 4U6VL 1AJ7L 5E9DE 4PJBA 4YR6A 4AEFA 3MUGB 1AQKL 4WV1A 1I1AA 4KROC 1OAQL 2QQNH 4OLWL 3T04D 1SJVA 3UTTD 2CK0L 5I6XC 3BAEL 1KIUA 5D96B 5C09E 3IRPX 1D6EB 3MCLL 2XN9B 1RZJC 1RZKC 2A9NH 2IPUK 2F74B 1HHHB 4YNYB 1G1CA 1A6ZB 1TVBB 1CGTA 3OXRB 2JELL 2VXUL 3LRGA 1Z3GH 1P2CB 4I2XA 4OV5B 6CGTA 4M1DH 4WUUE 1AC6A 2V17L 2Z8VC 1GGBH 4PP2A 2FEDC 2R69H 2XY2A 3GSNH 5D1ZD 3MCKA 3HG1B 1XF3B 4YE4H 3H3BC 4XB7A 4IJ3B 4O2FA 5DT1L 3FFCD 3V9FA 2P5WD 5IR1A 1LNUB 1A0QL 4FQXB 3WEXA 2BOBA 5I8KL 3IFNH 5TDPA 4RNRA 5IOPB 3RJDA 3P2TA 1DVFC 5JOPD 4J2XA 5D7SH 2D9CA 5F97E 3MYJB 3WFCL 4LSUL 4WCYH 1TVHB 4HK0A 3NTCL 2VC2L 4JEGB 5J12C 5JLZB 3PF2A 3ARFA 4OF8A 3FQWA 1PX3A 2J3SA 3OKLB 3FB8B 5JNYA 3W2DL 1MVUA 2XG5A 4UB0H 5DD1H 5IB4B 5HGDB 3WO4C 3U9PH 4R3SA 2XNAB 3CCHB 3HE7C 2EDFA 4E5XA 4ODUB 1X5HA 5EU3B 4CVXA 3SDDA 4K7FA 2BHYA 5EU7C 4F8TA 4HWUA 1JPFB 2N56A 5DD0H 2BFVL 3T0EB 4JFFB 3DRQB 1JZ4A 1KLUA 4XZUB 1PKQE 1MREL 4LEXL 2WP3T 1BJ1H 1JGUL 3MRRB 5EBLA 1BBDH 3V4PL 1H3GA 1VPOL 3QWRD 4WJ5A 4P4RB 3D39D 1E6JL 3B2VL 1E0OB 4XPBL 5CHNA 5TQ0H 4IRSB 3WIFA 3CH8A 3N0PB 5DRNA 3H7BA 3QZWG 3OXSA 3JV6A 2OTWA 5ESQA 1MCQA 5B39A 1FNFA 3FQNA 4PBVC 2D7OA 1CXFA 1ZHLA 5B39G 4NHCH 3MGOA 1B3JA 3BDYH 1AKJB 4PJCE 2QSVA 4IOFC 3NCJH 2J7LA 3NFSL 5DJAB 1KTKE 4JFYA 3VFUA 4V1DD 2ICCA 3VXRA 3L6FB 2XQBL 4KQ4L 4U3XA 2BX5A 3MLRH 2C3GA 2IANB 3WKMH 3VRJB 5F7LB 1WF5A 4EN3A 4J4PA 1WEJH 3I9GL 2X44D 5HDBF 1HCFX 4OFVA 3GB7B 5L0QB 3KDMA 5TE4H 1ZV5A 4GS7C 1U36A 1JZ3A 2DQJL 1JHTB 3MZTA 3GJEA 1BQHA 2IMNA 5LGHL 4QOKE 1BQHG 4MAYD 4XBPB 4WEUD 2OK0L 2X1PA 2GAZA 3O6LH 1ORQB 2XXMB 4Y2DB 5F7EH 3VFGH 1P84K 4RAHA 4NQCB 4XMLH 2VISB 5IKCA 4NRXA 1IAMA 5EZIL 3T0BA 1TENA 4D0CB 1QRNB 1OSPL 2CR6A 2UUDK 3G5XB 1FPTH 3WIIH 2B4CC 4WY7L 3VU2A 3IVKB 4YHML 1ACYL 4UUJB 1OL0A 4HV8A 5E24E 4WHYG 3DX9B 3MBED 1DJSA 4TUJB 3GHEL 4FNLL 3IU3B 2EIBA 1VCAA 2XQYK 5KSAA 3AM8A 2AAVA 1G9NC 5A2JH 3UBXI 1S7SB 2VDPH 4JQXC 1Q38A 1WAAE 3I2CH 4CVWA 5CINH 2DKMA 4Z78B 2CR3A 2PO6A 4JJ5B 3RL1A 5BW7A 5KTEL 1W0VA 1LK3H 1J1PH 1XMWA 3SGEI 2Z4QA 4ONFH 1KENL 1BEYL 9CGTA 5DS8B 2W0FA 3T2PA 4L1HA 1B0RA 4U0RC 5MHSE 3V6OA 4YWGL 5T33H 5ERWB 1T03H 5FUOH 1YY9D 3BZEA 4RFOH 1CIUA 1CZ8H 4LCWB 1T80A 1SMOA 1H3WM 1G7JB 3IS1X 2IH3A 2NY6C 3HE6B 4Q0XH 3T2NH 5I1LB 3EYSL 5JXAL 1BBJA 5FO7A 1MQKH 4LSSL 3V4UL 4P3WA 1F90L 5T1LD 4PGDA 4OAWB 4NQXA 1U41A 4P2QE 2WUCL 1FFNA 2Y6SD 5GSVB 3BP4A 3U7AA 4JAMB 5KJRH 3FMGL 3M17A 3LKPA 1E6OL 2DLTA 2R56H 2EEDA 3M1BA 1ZXQA 3MRQB 3LV3B 1HKLH 1G6RB 3UDWC 1K4DA 4EI5B 4HZAA 2K1MA 4M1GL 3L9RB 4UV4L 4F7TB 4D0BA 4U6XA 5DHYA 3O6FA 1Y18B 1X5GA 1CDJA 1FORH 3FB5B 4QRSA 4ZO8A 2ESVB 1P69B 1S9VA 1D9KD 2WQRA 5IFJA 1WCBA 1QPPA 3TP4A 3FOMB 4NKMB 4PJBF 3C2AL 1U91A 3U4EB 3FTGA 4D0DB 5J9PB 1X5LA 5I8EB 3IFLH 1S7VB 4XPGH 1N64H 3TBWA 2MFNA 3PQYE 4MDIA 3I02A 3EFFB 4XP4L 1MCPH 1CYGA 1Z9SA 3REWB 1VDGA 2DQHL 4G9DB 2NY1C 4G8GA 4JFDE 2EYTA 1CICD 4ZOAA 1U3HB 2AGJH 8FABB 4LIQH 1I4FA 1SYVB 4CADB 3TA3B 1N6QL 4L4TE 4FQCL 4D9QD 1ZT1A 3OG4B 1F5WA 4KRMB 1RZFL 4OF6A 4Z7UE 5JXEA 3S8WA 2VXQH 4M1CC 3L5WA 3NVQA 1Q0YH 2W92A 5C0RH 2RJMA 1UC6A 1CXEA 4W4NA 1C8PA 4MS8C 3OKEB 1WBYA 5C0BA 1T1ZB 3I3DA 5A43C 2F5BL 4JO3H 1SBSH 2JJVA 5IMLA 5F9JA 4ZYKA 3DVGA 1GIGH 3SY0B 4HFWA 4JANB 3R1GH 2DWEB 2BERA 2I60H 1I7RA 1UJ3C 2CLRB 5E99H 5IJKC 5GS2D 1DEEB 3T09A 4YK4C 4FFVD 5CD5C 1OAZL 5CBAB 5FHBL 5FGRA 1MLCB 3MRPB 1D5IL 5EU4A 5EZJB 1FO0A 4ENED 1MSPA 1T20A 5E4EC 3GMOA 4P2YA 4PJEE 3PP4L 3IS0X 4NKIH 3VXMA 3BUYB 3MNZA 5ISZB 4OQTH 4S1RL 3IYLW 5F9WB 6FABH 3RY6A 4LEOA 43C9B 1WSST 2VLRA 2PTTB 3IDMA 3MCG1 4KJPD 4OTXH 3VFVB 4F7CB 3OQ3B 3L95B 1Q72L 5JW4N 5I15H 1NGYB 5C08A 3QEQA 1N7MH 1Y6NR 3MRHA 5DR5L 2APWA 3U46B 2OYPA 1VENA 3TWCH 2C3VB 3O3EA 3JWDH 4S2SA 4TQEL 5AZ2L 3FB6A 1H3XA 5EU5B 4XAKE 4ODTL 4HG4K 1QFWH 3C87A 3QDJB 4YBQC 5T1MA 3IAPA 3AY4A 4UT7H 1SM3L 1GC1L 3K7UA 3ECBA 5E00A 2HJFB 3DETD 1LP9B 1YY8A 1BIIB 3CSGA 5E2TL 1UWXH 5EU6B 5HYJB 4QRRD 4WGVB 5J8OA 4Q6IC 2VSDA 5JIKA 4NRZA 4G3YH 3ZKXC 3WHE1 1AO7B 2F53D 3HI5L 3L7FA 3S5LG 1A02N 3QXWA 4QT5B 3NIFF 4PYHA 2AXFA 2CGRH 4XC1L 3QCTL 1OSZA 3QISA 5E1AB 4QRPE 1AI1H 2FJHA 1M7DA 2X7LB 4KRPD 1PZUB 2A74B 5C07A 2W60B 1P7QA 1A1OB 1RJYB 4JFOB 5GRUL 3RWIB 5JPNA 4HH9B 4P23D 4WDIA 5J6HB 4XXDB 4Z7QF 1G7LB 4B7IA 3MJ6A 3RTQB 1QFUH 4O2EA 4KKCC 1XH3A 1Q9OA 1TQCB 1SHMA 3CLFL 3CNKA 3IXAA 3SE9H 1MCFA 1MPAL 5IVXB 4PRID 2PR4L 4HS8H 5MP6L 4X6CE 1FFPA 4NM4H 4L8SB 2MQ0A 2XTJD 2Y06H 4TTDC 2IWGA 4YHYB 4BFIB 5ACMA 4LVOB 2WBJB 2DI8A 4Z7NF 5T1KD 5C7XH 3BIBX 3MLYH 1A1MA 4DKEL 3MRCA 4QTIH 1MCIA 4I18B 4NO0A 3A6OA 1WGOA 5C0IB 3PWPA 3OPZH 5TF1L 4M4RA 5DMGD 4BSWA 3PGFL 2W0PA 5J1SC 4Y4HB 3PWUA 1I85A 3IJSB 3VFPA 3OGCB 2H2SC 4JRYB 2X4UA 2QQKH 3BZ4A 1BIHA 1RK0B 1KJ2L 3MOBL 4C4KO 5I73C 3S36H 4HFUL 2X41A 3LB6D 4KMTL 1RJZB 2NY0C 1CE6A 1RUAH 2A9MH 4HQQL 5TDOA 3BMWA 1IGFL 3TPUA 1U92A 3G08B 4MVBD 1CL7H 4JN2B 4PLKC 2J8HA 1MIEL 3TNMB 3PGCB 4ODXA 4XXCC 2NY4B 4KXZH 4F8QA 4HWEH 5C2BL 4RMQA 4IRJD 4S10A 1V7MH 3VRLE 1FZOB 3FZUC 5FECA 1SVZA 3OTTA 1PY9A 1MAML 3GSOB 2W07A 1QSFA 3UDWA 3DMMC 4XPFH 3SDXA 2V9TA 1T5XB 3F58H 4O58L 4TNVF 1AGEA 1K6QL 3MUZ1 1H5BC 2ITDA 4GRWB 3QDME 4ZDHA 1LQSR 1QZ1A 2NTSP 2VAJA 3I3EA 4X6BA 3W82A 1FFOA 1NGZB 4Q9BA 3OB8A 4ZNEA 1ZLUH 3IT8D 5F6HI 4NWTL 1F8TL 5I18H 3FONB 1IC7L 4U1JB 5F1OB 1QFHA 3TM6A 4KRNA 3U9UA 3Q6GH 1KUMA 3HNVL 4ONHA 4YGAB 1QOKA 4YIQA 1VB9A 5D70L 1DQDH 3RGVA 1HN1A 4Y5XB 3RHWK 4TYUA 4EDWH 1JHLH 4PGBA 3UTSE 1DLHA 5ICZB 3HNSH 2R0WH 1ZEAL 4GXUM 4R6UA 3HCVB 5AUMA 1RUMH 5GGVH 3CGTA 3HPLB 4LCUB 3O4LD 4X80H 3FN0L 3LKOA 2K7PA 3MLTB 1YMMB 3VXTA 3VFNB 3OAZH 4O2CA 4J1UB 3O3AA 4HCRH 1MCWM 4FQ1L 2WWMC 4FFWD 5IF0A 3DHJA 3EIFA 1GOHA 3OMZA 1FAIL 4RAUA 3MV9A 4M00A 1P1ZA 2DMKA 4ZUVB 4RGNE 4HIXL 4G8IA 1X6LA 2WBKA 1XR9A 1R5WA 5IK3B 4XP1H 4PRBA 4H8WH 4WFHD 1KTDA 5IIEA 4N68A 5L6YH 3TBVA 2LVEA 3GBLA 5C6TL 2OJEB 5ACZB 3RZCD 4OLVH 5JORA 1R5VB 1UVQA 2XA8L 4I9WE 4GH7B 1BD2D 2FIRT 2Z35A 5TE7H 4LBEB 1U8HB 1QLFA 1P4BH 1NUGA 4QTHB 5EN2B 1VGEH 2CUHA 2GITB 2E5EA 4OCWL 2AKRB 1LILA 4N5UA 3EBAA 4RAVB 4HC1L 4RBPK 3WHXA 2VABA 4HZLB 3V4VL 2VLME 1J1XL 3VXSA 1T2JA 5E0QA 4OZIA 2OJZL 3WJLA 4ELME 3LS4H 1G9ML 2QTEA 1JJUA 1WZKA 2R0ZH 3T1WA 5C9KA 3VD7A 1NLDH 5DJ8B 1XGUA 2DF3A 4M6AA 3AREC 2EDBA 2BSED 4MAUH 3X11A 4RISH 3F7VA 4L4VD 4PGCA 1IKFL 2QQLH 4LLUB 1G6RH 1NGXA 5BS0A 3N9GL 1HSBB 4NC1C 1TJGH 5DK2A 5JW3L 2D7NA 3EJZD 1Y0LB 2XZQH 3D69B 3WDJA 5GIRA 5DTFB 4JO1H 2MCPH 1BFTA 7FABH 5BQ7A 2CJUL 3A0OA 5LVEA 3EO9H 3FCTB 3WJJA 4Q6IA 1HILA 5GZNC 5DJDB 1MI5D 2YPLB 2FLBT 3VD4A 5D7JC 5DZNA 5EORL 4EI6A 4NQDB 2NW2A 2J2ZA 2P5ED 4PRPE 2ERJB 3UXFA 4KI5F 1CGYA 2HKHL 4JRXD 1NBQA 5BZDB 5GGTA 1FLRH 5HHMB 1D3CA 3ARGC 3QWRA 4K71C 1ZE3C 2YK1H 5B4MC 3NA9L 1OP5H 5HHQB 5FA4B 1MHPL 2QSCH 3QUXD 4OGAC 1EVUA 3L3DB 4I3SH 1T2QL 4JREB 3CSYB 4GSDH 3V6BR 1Q9LA 2JJTA 4X6EA 4JN1H 5E2WL 2KDGA 3CFEB 3MRLB 2OQJB 1WC7A 5GRJL 4NZJA 4ZO7A 4JPIB 2AK4B 5IVZB 1EFQA 1MJJB 2O5XH 3E2HC 4Z77B 3J8F7 4HJJL 4M5ZH 4WI2A 5EZLB 3W0WA 4JFQB 2N4IA 4UTBL 3GMMB 2Z8SA 3VWJC 3TBYA 3RAJL 5FCSH 5I17B 3IAGC 4KY1L 1N0XL 2EDEA 2L7UA 2W38A 5INDB 1ZGLB 1CT8A 2YC1A 4G9FB 3ZE0F 1ZAGA 3WS3B 1YEGH 4OFPA 1CGSL 3RY5A 4NKOB 5EDXA 3V0WL 1HQ4B 4MXVE 3KPLB 3T77B 3WL9A 5CILL 3EGSB 2DL9A 2PTUA 3K4ZA 1M7XA 5K9OA 1NDGA 1A7NH 1X7QA 4M6OL 1CDUA 4P3DB 4LVHB 4TUKL 1W0WA 5HDOA 4LHUB 1FE8L 5ITBH 1ZANL 2E9JA 4HXBH 4DAGL 4UU9B 4XX1G 2ZCKH 2A6DB 2DLEA 2JB6A 5EWIL 3MLXL 1HXYA 4FQ2H 1F00I 3O3BA 2A6KB 2Q1EA 1CFBA 4HUMB 5HHOB 4LLMA 3DVIA 2H6PA 4N9OB 4OI9A 4CN4A 3DRTB 3DECA 2O61B 1EGJH 2B8OT 4Z8FL 3PDDA 4UT9H 1JNNH 1WZ1L 4CMMB 1QBAA 5KSVB 2QHRL 4P46B 5K59F 1NCAL 3V0VA 2IFFH 3X14B 3GRWH 4PJDE 4XNUH 2F5AH 3SDXF 4UIKH 1FFRA 3JUYA 1A7OH 1B2WL 3IDXH 4NO3B 3EJYD 5AYUL 4JQVA 2JCCA 4S1QH 5IHLB 2B0SL 1IM9D 1SEQL 1X5JA 3JWOH 2IEPA 5HTSA 2W0LA 4I3RL 4JKPL 4F2MB 2WWKO 3FRUB 1ZS8B 2UZIL 5BO1H 1AGFB 3A6CL 1RU9H 5ID0B 2A6JA 1KPRA 2BRRL 3CFBB 5F7UA 4KJQC 1HE7A 4MA3A 1DR9A 3MV7B 3C60D 4U1LB 1F3RB 1J8HE 1QA9B 3REVB 3MRKA 5DURB 1NGWB 3SDCB 1P9MC 5D7IE 5FCUH 4JO4H 2BVOB 3WNKA 1R0AH 2NX5B 4ERSH 5E7BA 4LK4A 4Z7VA 1KEGL 1HHIB 5JQ6H 3STLB 15C8L 4YXLL 5GQBA 5IESH 4PV9A 4Y4FC 4XTRC 3NFPA 1T1WA 2FLRT 2ARJB 1UXWA 3EW3B 3H9YA 3B9KB 4G8EA 2YD5A 4EDXA 1AXSA 1BVKA 5D72L 4HS3B 4N0UB 2YBRA 4MJ6B 4YR6B 4PJBB 4WV1B 1I1AB 3Q1SH 3HZYA 1FNGB 3TFKD 4EBQH 2OCFD 4M7KL 4I3GA 2CXKA 1XAUA 1FC2D 3CLEL 1MWAB 1YEFH 4MXQC 4GKZA 3V0AC 1A3RL 2P8PA 4KZEL 2EE9A 2CQVA 2MMXA 3NZHL 2NY7H 3ARPA 1YEJH 4XP5H 1W72H 3PDGA 2NQCA 5I1GL 3VXPA 5FUZH 5CGTA 4UILH 4CDHA 3D5OF 2DD8L 3DXAD 4I2XB 5D1XC 1WT5A 1CU4H 4GBXB 4XNZC 1NAKH 4POZD 1RIUL 3MCKB 4KTYA 2H2PC 1L4IA 1FRGH 3G6JE 4O2FB 4PJFA 4I5BB 5IR1B 2PN5A 1OCWH 1UA6H 4OZIF 4HSQA 2VAAA 4LKXA 3WEXB 5TDPB 4RNRB 4PB0L 4NRYA 1MEXH 5AAWA 3O4OC 4J23A 1EO8H 4LP4A 4P9HL 4HK0B 2FX8L 3HC4L 4Y1AE 4A2LA 1EV2E 2IG2H 3ARFB 3FQWB 3I50H 5JNYB 1T66D 2R23A 1MVUB 4L3ED 3UJJL 2A77H 1XGQA 1JMXA 4NP4L 4R3SB 3ES6A 4LASL 5HHVH 1WWCA 4E5XB 3MFFB 4CVXB 3SDDB 2GJZA 3RX5A 2YPKA 3H0TA 4XCFH 5D7JA 4KK8D 3KXFE 3MBXL 4GQ9L 4FMFA 2L0DA 1PBYA 1YC7A 1KLUB 3EOBA 3QDGD 4KQ3H 3F6LA 5A3ID 2R0KH 3ELAT 4U0QB 4MNGE 3TH4T 3ARGA 5EBLB 4E42A 4JO2H 2PYEA 4GMTH 4WJ5B 1MCSA 4HK3N 4NZUL 2MWCA 3IJYA 5M7QA 4WEMB 4MNQA 1KJ3L 3ARBC 2R4SH 3WIFB 4P57A 3E8UL 3VW3L 3TC9A 5DRNB 2ZPKH 3H7BB 3OXSB 3JV6B 2QADC 2OTWB 5ESQB 1FIGL 3CFDA 5B39B 3FQNB 2D0GA 1NAMA 1ZHLB 3MGOB 3MMEA 3BO8A 2Z31C 4UI2A 3FO0H 2I27N 3VFUB 4JFYB 2J1KA 3VXRB 3EYUH 3NACL 2HTLD 3ILQD 2BNRA 2WINA 3UTPE 3VWJA 2FX7L 3MJ9H 4O4YH 3GKZA 4LPWA 1JUFA 5KAQG 3C9NA 1R3HA 4EN3B 4M6MH 4YZFF 4K3JH 4WHDA 4OQ1A 3KDMB 3C8DA 1X6NA 1EIBA 1AIFA 4M7ZB 4R7DA 4NCC2 2BVYA 3KHOA 4XNYH 3MACL 4N8PA 4ZG1A 3GJEB 1BQHB 2HFTA 1JYNA 5HGAA 1D5ZA 2B39A 3Q6FA 4X5WB 5H37G 1OQXA 2EDKA 5GSRA 4N1CA 1XGRA 4WO4B 2GAZB 5HJ3B 5DFVC 3QG6A 1T7XA 5C6WH 1O5DT 4P23A 5IKCB 3BT2H 1TLKA 3MLSH 3MLVH 5INCA 3GEWB 2AJSL 3VXOA 3ARDD 4MD0A 5LGKA 3EHBC 3RP1A 4NPYA 5EA0H 3IDGA 4YHNA 5E8EA 1FCCA 1U8OB 4LSDA 2PKDA 1DQLH 3T08A 1TPXC 3ARSA 5EG6C 4HV8B 2ZOLA 3V5KA 1S5IH 4LLYA 1EERB 4X7DC 1A6VH 3JV0A 3BHBA 2DIAA 4EUPA 5C0CE 1RUQH 5KSAB 3QEUA 3DO7A 4EUPG 1JIBA 5CIPA 1ACZA 1RSFA 5LBSL 3CMOH 3HRPA 3WE6A 4ZS6D 2YKLL 2DLGA 3DX6A 4PJXE 2HMIC 3QFJD 3CVIL 2ILLA 3RX7A 3S37H 5IBLD 2Q8BL 1H8NA 2NW3A 4XVTH 5FHAH 1TZHA 2PO6B 3B8SA 3RL1B 2VDOL 4NCDA 3VD9A 1W0VB 3TVMC 2Z4QB 5CEZE 4KJWC 3NCMA 5DUPH 1FDLL 3KPSD 3DUSA 2W0FB 3P0VH 4S1DD 1B0RB 1AXTL 3IDNA 3C09B 3D9AH 3SJVD 5C71A 2EIZA 2FB4H 3BZEB 1D5BA 5J11B 3IDJA 2JCCF 1IRAY 1U2CA 2IH3B 4FFZL 4QXWA 2BDNH 1I9EA 1BBJB 5FO7B 4FQJL 5DQJB 4QNPF 3TV3L 1ZKAA 2XZAL 2XIDA 3LVEA 4P3CH 4PGDB 5FAAA 1FFNB 2FD6H 3BP4B 4IRJA 1PDKA 4NN7B 4X5XA 3TN0D 5MERA 3QUZD 3M17B 5C0AE 3LKPB 3M1BB 1UM5L 2CMRH 1HH9A 2RCSH 5F7MC 3KR3H 1MLBA 1K4DB 1GC1C 2P45B 4YHZL 4JPVL 4Z7VF 4D0BB 4U6XB 2J5LC 5DHYB 5DFWH 3O6FB 1S7XA 3B9EA 4WWKA 4NWUH 4QRSB 2HT4C 4AG4L 2D2OA 3BE1H 1S9VB 4ODWA 3TIDA 1ZLUK 1CFTA 2YEZB 2L4OA 3MLUL 5JUEH 3CFIC 5IFJB 1WCBB 4WW2A 3BRDA 5EU7E 5IHUH 1JRHI 2K7QA 5ILTL 3GK8L 1U91B 3QR2A 4FQPA 2DQUL 3WMSA 2XN9D 4HWBA 3TBWB 1YPZE 4MDIB 4PRNA 3I02B 1FSKC 3WHE0 1NBVH 3FN9A 5D93C 1Z0MA 2AV7A 4G8GB 2EYTB 3O4LA 4LCWE 4R4ND 2HP4A 3X13A 4O02L 5EBGA 4M9OA 1I4FB 3IETB 4WNQA 4Y88A 1ZT1B 4WFED 3OAZK 3RVTD 4YEEA 3RDTC 3HG1D 3H3PH 1BF2A 4I0PC 4MMXC 1FBIH 3DNKA 1WBYB 4UTAH 2GFBA 1UFUA 5C0BB 3LQAH 4KTDL 4FQXD 2BSTA 1N4XH 3MXVL 1DUYA 2WP3O 4NBZB 5IMLB 5EOCL 1BFOA 4PJFF 4ZYKB 5F9JB 5GS0C 3RVXC 3DVGB 4HFWB 1MCWW 2HKFL 2N7AA 4NZTH 4Z7WA 3TZVD 3ZT6A 2OZ4L 4JHAL 4TVPE 4RFNC 2YHGA 4K23H 3BYYA 2RGSA 5CP3A 5F6HJ 3P9WB 1BD2A 1C5CL 1VEPA 4YXHH 4LL9A 3LRHA 5EU4B 1FO0B 4G6KH 3WO4B 1MJUL 4BA8A 1T20B 3SE3C 3GMOB 2QV2A 4A6YH 1LDPH 3CDGA 3VG9B 3VXMB 1I8LC 3U79A 3VFOA 3MNZB 3ULSA 2VL4A 4UNUA 3T0ED 4HJGA 4JFFD 1IMHC 3HC0A 1AGDB 3MA9H 2XPGA 1BM3L 3ZDYE 4LEOB 1LO3L 1IEBA 1QFOA 3QUML 2VLRB 3IDMB 4NQED 1KB5H 2AABL 5F7YC 3WIHA 3ZHDA 2BP3A 5DXWA 5C08B 4IRSD 3QEQB 3MRHB 1Z9MA 4N0FA 4FQQA 3O3EB 4S2SB 2NY5H 4BELD 2IPKA 5B3JF 1P6AB 3FB6B 3OWEA 4FZEH 1MFDL 1AKJD 2X4SA 4LFHD 5DYOA 4LAQH 1J0IA 5HD8D 4XT1C 2Z31A 1QG3A 1DLFH 2ATPA 2X2YA 4JR9L 2P8MA 3ECBB 4YLQT 2DTMH 5E00B 1ZT7A 1U9KA 3WIHL 4XPHL 1YY8B 1JRHL 3QT2A 5JDSA 4RZCA 3EAKA 1RMFH 2IAND 3S35X 4NRZB 3BPOB 2UWEE 3L7FB 2EYRA 1KCKA 3IDUA 2AXFB 4ZQKA 2OLDA 5CGYD 4FQIH 1OSZB 5L8KB 1FYHB 1MWAH 2FJHB 4G7VH 1M7DB 4G7YH 5C92A 4MMZC 3W81A 1PGRB 5IB1A 4DVRL 5C07B 4JE4B 3QUXA 5SWSA 1P7QB 2YN5A 5ICYA 1JCKA 1YEKH 5GS3A 3RX8A 5JPNB 1C1EH 1QRND 3ZKQD 4WDIB 4L9DA 5DO2D 3UTOA 1KELH 1ZTXH 5I74C 3KPMA 4O2EB 4Y4KC 4L8CB 1XH3B 3T0WA 1Q9OB 4ZXBC 3VD3A 5ALBL 3IXAB 2RBLA 1A6WL 5TDNA 1XF5A 5FGCB 5JOFA 4PP1C 2R2EB 1T2XA 3ZYZA 4EJ1C 2YSSA 1N2RA 1FGVL 3TCLA 4PREA 2ZNWA 1MRCL 4YDKH 5T5NG 3UPCA 1A1MB 3EYVB 5T3XH 2EXYC 4DW2H 3MRCB 3EFDL 4NO0B 5HVHB 5A2FA 1U42A 4RWYH 5SWQA 3PWPB 3CX5K 4F57L 3U7YH 4BSWB 3ZE1E 3O2WH 4KK5C 4GKNA 5D71H 4K3GA 3WFDH 4GAYA 3PWUB 4YHPA 3VFPB 4OZGA 3L3HA 2QQNL 2X4UB 2CKNA 4XPAH 3VDAA 4PRAA 3BZ4B 1JGLH 1UQSA 2HT3D 2IBZX 4LDLB 5TH2A 3H42L 3MA7A 1CFVL 3QULA 3HE6D 1KC5H 4DFHA 3GSNA 1CE6B 5TDOB 3GI8H 3TPUB 2A9NL 1ZHKA 1U92B 1G9MC 4AMKH 1OF2A 2AJ3A 3HI1A 3AS2A 3DTXA 4WHTA 4PJ7E 4KJYA 5JHDA 4ODXB 4NO2A 5KS9E 2R2HA 1OD7A 4HXAL 2PW2A 2YPVH 4M1DL 3KLAA 1NH6A 1VESA 3KLSA 3L5IA 2EO1A 1JZ7A 5FECB 4LMQI 4FQLH 1R3KA 4FXGA 4POYA 4EI5D 1V7NH 3B5GA 5HYFA 1QSFB 4KHXH 2EICA 1MIML 3SDXB 4EIZC 3LH2H 1G7IA 1AGEB 1HK6A 4MGXA 2LAGB 2VZUA 1ONQA 2ITDB 2ESVD 4GRLC 4ZDHB 1PAMA 1I1RA 3QXDA 4X6BB 3IFNL 1ZLSH 4Y16D 4O5LL 5C0ND 1FFOB 4H26B 5D7SL 2QR0A 1PFCA 4WUKH 2V2TA 2ORBH 1MCCA 4JHWH 4OJFH 3U9UB 4EVNA 1KN2H 3UTZA 2ICWI 1I3VA 3GBMH 5E8DH 4UB0L 4WW2F 4YIQB 5DD1L 1EH9A 4MJ5A 1DEDA 5IFAH 3KPPA 4YDIH 2P1YA 4NHUA 1KGCE 4XCNA 3ET9F 3ILPA 4PGBB 1DLHB 1I9JL 1U3HD 5AUMB 2Y5EA 3SQBA 2O5YH 3TA3D 4JVPA 4FQHA 4M43H 3T8XA 4ETQA 3LKOB 3ZE2F 2ZUUA 1A7BA 4XNXH 3F7RA 3VXTB 3GSQA 2Q7YA 4O2CB 3RDTA 3O3AB 1HYSD 4Y19E 5ADOL 4OGYL 3E1F1 3INUH 5IF0B 4XVJH 4WHYH 1AR2A 2P8LA 1MNUH 2VDNH 3BKMH 4JZJC 4RAUB 4X6DE 3MV9B 5JHLH 1P1ZB 1P84J 4KMQA 4WGWB 4R90L 2YOCA 4OIAA 2V9QA 4G8IB 4ZFZA 4J6RH 4GT7A 4K3EL 5BJTA 1XR9B 5HXMA 1R5WB 3EZJB 3WO3B 4NHCL 4DVBA 4PRBB 3BDYL 1KTDB 1QNZL 5IIEB 2I9TA 3ZDZE 3MNWA 1FNSH 3NCJL 3TBVB 5HI3D 2VXSL 3ULVE 5KVFH 2MOVA 4LOUC 4PLNC 4OF3A 1KPUA 1TNMA 4Z7WF 1UVQB 5JORB 1CLZH 1KEML 3UZVB 1AGBA 1INEH 2Z35B 3P40A 3PGDA 5J1AA 4RA0C 3WKML 1QLFB 2O93L 2CK2A 1WEJL 5ISZD 4RGMC 3SGJC 1AY1L 3C08H 5IBTH 3QPQC 4S11A 3BI9X 1AP2A 3OZ9H 1KIQA 4MAYC 3WHXB 2VABB 3VFWB 3VXSB 1CDGA 4WTZA 4OZIB 1H3VA 1HDMA 3T4AA 3O6LL 4WTZG 3W11D 3VFGL 3VXUA 2C26A 4XMLL 4NFDA 5SV4A 4OCRH 4QWWD 3RQ3A 4GG6E 1I1FA 1S3KL 4L4TD 1P4IH 1XGUB 2C5DC 4Y5YA 3LHPL 4LCIH 4R9HA 3X11B 3F7VB 3QDJD 4LARH 1NLBH 1A6UH 2BNQE 4PGCB 3G5VA 3MBEC 1NGXB 1A5FL 3R0MA 3D85A 3NMEA 1OGAE 1QHPA 5BS0B 2VUOA 3MGTA 5DK2B 3N85H 1A64A 2YWYA 4L3EA 4C83A 4OUUA 4JVWA 5HHNA 5GIRB 3IRZA 4JGJA 2DQIH 5HYJD 4Q9RH 1OAXH 1MHHA 5BQ7B 3F7PC 2VDPL 4Q6IB 1HILB 1AO7D 2UY6A 3QIUD 2C4FU 3ZKXB 3S88L 2X42A 5CINL 4EI6B 3DI3B 2NW2B 4HWNA 4DOHE 3S96A 1CGUA 2J8OA 4X99A 3TJEH 2D0FA 3MROA 5MENA 2D03H 2HJKA 1EHAA 2VN4A 4LDEB 1F2XK 3V5DA 1E4XH 3GMLA 3M45A 5I1EH 3GMQA 1RZKH 4AH2A 5CEZH 3CVHH 4JFEE 5T33L 5FUOL 1CIDA 5I1CH 2DQTH 4RFOL 4U7MA 2X89A 5DSCA 1CZ8L 4ZSOA 2YA0A 1YQVH 4Q0XL 4K94L 1Q9LB 3RTQD 4JB9H 4JG0H 3RUGE 4X6EB 5F7NC 5I19H 1MQKL 2Y36H 2ZUQB 1OTSD 4U6HA 1QO3A 2IBZY 1WC7B 4UINL 4NFBA 4LGPB 3BSZL 3WNOA 4F7PA 1BQLH 1OWWA 4OGXH 5KJRL 2WBJD 3W0WB 2GT9A 5BRZE 4PJ5A 3TBYB 1HNGA 5H8DA 4G6JH 4PUBH 1CT8B 2YC1B 3HUJE 1U8KA 1ZA6A 2GCYA 2IADB 2HVKA 5T5NF 4Z5RA 2VLKA 1QFWI 1D6VL 1D9KC 2NXZB 3CZJA 1A3LH 4I8DA 1CFSA 1FO0H 2AV1A 4JRYD 3WL9B 1KB9K 3H9SA 3Q3GA 5GJTH 1B0WA 2NYYD 5K9OB 5HVWA 1NDGB 3CK0L 2UZYB 1X7QB 1Z6JT 3CAFA 4JY5L 4OZGF 3IFLL 4XPGL 1N64L 1NFDA 1EAJA 4FZ8L 4QRPD 1MAJA 4HAFA 4XP9H 3QCVH 2LAAA 1IGIH 4FTVD 2JB6B 3V7MA 4LPXA 3WNLA 1HXYB 4H0IA 3OR6A 2XRAL 3O3BB 1IAIM 2NY4D 4LIQL 7CGTA 5B38A 4OLZL 1NDMA 3LN5A 4BQCA 5B38G 3ARXA 4P9HC 4ZS7L 4LLMB 2H6PB 1NBZA 3QFJA 2VXQL 2JTDA 3VFSA 1C12B 3PP3H 1Q0YL 1ZLVH 3RNKA 5C0RL 1UZ6F 3L3OA 4HUKB 5CMAA 4HKXA 5CEYA 4HBCH 3V0VB 4TTGA 1CDIA 1G7QA 3CDCA 5H35A 5IHZA 1P5UA 1ES0A 2AEPH 3VGBA 3R1GL 4J3VA 2JCCB 3SJVA 2I60L 4HG4J 1OT1A 5E99L 4KUZH 3T3MF 1FZMA 1KYOJ 4OBSA 1I8MA 2R9HD 3KHQA 4E41E 4U1GC 4PB9H 1A14H 2DDQL 1J8KA 2D7MA 1L7IH 2HRPH 2VLJE 3NAAH 4ENEC 5KSBE 2A6JB 1KPRB 4MA3B 4MCZA 1QR1A 1JFQL 4MZ2A 2GTWA 3MRKB 3BZFA 4OQTL 5D7LA 2PF6A 5D2LA 4YC2C 3VGHA 4JDZA 1YMMD 6FABL 3FQTA 5E94A 4KJPC 2X4PA 4K8RC 4ZFGL 5JR1H 1VKXA 4Z7VB 4RA3A 4NFCA 2B4CH 1QYGH 3ULUE 5I15L 4C56E 5TFSH 2DTSA 3TEUA 2JJSA 1UACH 4PV9B 4CN1A 1CL7I 3NFPB 1T1WB 3CIQA 2HTKD 4X7SL 1UXWB 4EIGB 4G8EB 4X9GA 3JWDL 4EDXB 1AXSB 1BVKB 5EOCJ 5J13C 2YBRB 4F58H 3D18A 1QFWL 4KXZI 1T5WA 4BZ2L 3HZYB 4UT7L 4U4BA 4QGYA 1TQBB 5E6IA 5IT2L 3OKKA 2OI9C 5TPWH 4GKZB 2P8PB 4OFYA 1A6AA 1RZ7L 5FYJH 1YUHA 2BSSA 4U7KA 4UNVA 4APQC 4G3YL 2OL3A 1YYMH 3UYOD 2DM2A 3VXPB 5M95B 4TOYH 4AIOA 2XWTA 4KPHH 1WK0A 2FEEI 3VFTA 1X3DA 4KRPC 1AI1L 3HMXH 2VDQH 4JFHE 2LQRA 1KCSL 1J0ZA 1MCRA 1J86A 3RWHA 4EOWL 3RFZC 3T2OA 2RIKA 4PJFB 1GVIA 3S3SA 5DK0A 3TT3H 4KK6D 1TCMA 2VAAB 4LKXB 1IC5H 4OB5H 3KWWA 1EPFA 4NRYB 1DBJH 5D5ME 4ODSH 1DFBH 2CLVA 5DJ0A 4LSRL 1U3ZA 3TZVA 5I1HH 1V05A 2R1WA 4NQSA 4HS8L 4YUEL 2XTJC 5IB4A 4XVUD 4NM4L 4WRLA 2I5YH 3CCHA 1SYSA 2R23B 5E9DA 5B22A 1XGQB 5C7XL 3ES6B 3MLYL 3BW9A 3U7WL 3LRSA 5T5FH 3UZQA 2XI9A 2YPLD 5K9KA 2GJZB 3L1OH 2YPKB 4NQDD 4QTIL 5CZXC 5I76A 3H0TB 5D7JB 5C09A 3A67H 1FH5L 5GZOC 2ZJSL 5FUCE 1S78D 4XHQA 1BFSA 3EOBB 4JG1H 3VA2C 4AYFA 4NQEA 4G6MH 4DUVA 4WENB 3ARGB 4JFXA 4E42B 5IUSA 5I75C 2PYEB 5I8CA 2IQAA 5HHXH 4K3DH 3IJYB 2VDRH 3LB6C 5LAXA 3S36L 1CTNA 4MNQB 1CD9B 1CTOA 2YD8A 4WUUA 4P57B 3RWGA 2A9ML 2JK5A 2MJWA 3UO1L 3WBDA 3P11H 3CFDB 1TFHA 1CL7L 4NYLB 1NAMB 1S9XA 4J3SA 3RVVD 3MMEB 4D9RE 5I1JH 3P4OA 2AK4D 3BO8B 3K74B 3F6IA 4R0LC 3E2HB 2B7DT 3WFBL 3WKNA 2X1WL 1V7ML 3O9WD 2WLYA 3DV6A 2BNRB 2IANA 2JIXA 3MV8E 2WINB 4KVCH 3VWJB 2KZ1B 4CVZA 1LGVA 3RL2A 2YWZA 1BGXH 1JUFB 4XPFL 1F4YL 2BJMH 1NC2D 4NNPL 3C9NB 1R3HB 5C6PB 3GBNH 1AIFB 2C4XA 3LPWA 4R7DB 1YNLH 4HF5L 4MLIA 1WFNA 4JM2A 5CJ8A 1X4XA 1I7TA 1YEIH 1ORQA 5HGAB 1D5ZB 2AJYL 3CPLA 3Q6FB 1IQDA 3KLHD 5GSRB 2FEEL 1GAFL 1XGRB 4HPYH 4LHQB 1F42A 3QG6B 4NGHH 1HKFA 4LHUD 4PRPD 1J11A 4HCRA 1PKQA 2DOCA 1IC4H 4LCYA 5INCB 3E6FA 3VXOB 1K3IA 4MD0B 3VD5A 4NPYB 4L5FL 3IDGB 4I48A 5E8EB 4YHNB 1DQDL 4M3KB 4EDWL 1JHLL 4XHJD 1NFDF 2ZOLB 3V5KB 4LLYB 3DIFA 3C6LC 2P46B 3BHBB 2BVPA 4X80L 5AZEH 2D7TH 5HHOD 4EUPB 1O7VA 3QEUB 2X05A 1HINH 2PUQT 4KHTL 3DO7B 2E27L 5CIPB 4R4FH 2PCPA 1U6AL 4HCRL 3Q5TA 3X12A 1CFQA 4PJCA 3WE6B 4JJ5A 3VXNA 5AG9A 4RRPA 4P46D 2NW3B 4U3HA 4RRPG 1TZHB 1GRWA 1RFDL 2NXYB 4N0RA 2J6EH 1JV5A 3D0VA 4HJ0D 5EOTA 1WVZA 3DUSB 1L6ZA 4XP1L 3GKWL 4ZOCA 3IDNB 1LE5A 3R8BB 2HT2D 4GMSH 4TSBH 2EIZB 3FAXA 3QDHA 1MCJA 1D5BB 2BVTA 3IDJB 1H9VA 2HG5A 2EH8H 2O26U 4U31A 4QOKA 1OM3L 3S34L 4OD2A 4PRHE 5TE7L 2EIEA 5GGTH 3MV7D 4M3JA 4PG2C 1FAKT 1MFAH 5DURD 1VGEL 4Z7QE 4U33A 4JAMA 3S3PA 3SDCD 4MJIE 4P2CG 1RIVH 4IRJB 4FRWA 1EFXB 2NX5D 3MRQA 4X5XB 5MERB 5B21A 2X4NA 4RGOH 1H3TA 3QAZB 1BJ1J 4YPGA 5D2LF 1HH9B 1MLBB 4C4KT 1KCLA 1A7PH 2VN7A 2VERN 3DLQR 3MFGB 1A4JA 32C2A 2R0ZL 1T7YA 4RMUA 4MZ3A 1S7XB 4WWKB 4Y16A 1JPTL 2BXYA 4R96A 3RWCA 2DN7A 4ODWB 3TIDB 2GSIA 3DUHA 4RISL 1CFTB 1I1AD 4N0CC 3QNZA 5DVMA 1G6RL 1N5YH 4WW2B 5D8JH 3P0YL 4Z0XB 2JB5H 1TJGL 2Z92A 3WSQL 3FB7A 4L8BA 5IQ7H 2XZQL 4H88H 5L9DH 3B5HA 4JO1L 2MCPL 5J3HC 1KOAA 4IMKC 4PRNB 5CFHA 3EO9L 1DBMH 3U4AA 1UXSB 4CADA 3TA3A 2F54E 3O4LB 3X13B 1XIWD 1EEYA 4WNQB 5FYJU 3RVUD 4HMDA 1J0JA 1DBBL 1T0NA 4GBXD