1D2PA

Crystal structure of two b repeat units (b1b2) of the collagen binding protein (cna) of staphylococcus aureus
Total Genus 92
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
92
sequence length
373
structure length
373
Chain Sequence
ETTSSIGEKVWDDKDNQDGKRPEKVSVNLLANGEKVKTLDVTSETNWKYEFKDLPKYDEGKKIEYTVTEDHVKDYTTDINGTTITNKYTPGETSATVTKNWDDNNNQDGKRPTEIKVELYQDGKATGKTAILNESNNWTHTWTGLDEKAKGQQVKYTVEELTKVKGYTTHVDNNDMGNLITTNKYTPETTSSIGEKVWDDKDNQDGKRPEKVSVNLLANGEKVKTLDVTSETNWKYEFKDLPKYDEGKKIEYTVTEDHVKDYTTDINGTTITNKYTPGETSATVTKNWDDNNNQDGKRPTEIKVELYQDGKATGKTAILNESNNWTHTWTGLDEKAKGQQVKYTVEELTKVKGYTTHVDNNDMGNLITTNKYT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords COLLAGEN ADHESIN
publication title Novel fold and assembly of the repetitive B region of the Staphylococcus aureus collagen-binding surface protein.
pubmed doi rcsb
source organism Staphylococcus aureus
molecule tags Structural protein
total genus 92
structure length 373
sequence length 373
ec nomenclature
pdb deposition date 1999-09-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF05738 Cna_B Cna protein B-type domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1140 Mainly Beta Sandwich Immunoglobulin-like Collagen-binding surface protein Cna, B-type domain 1d2pA01
2.60.40.1140 Mainly Beta Sandwich Immunoglobulin-like Collagen-binding surface protein Cna, B-type domain 1d2pA03
2.60.40.1140 Mainly Beta Sandwich Immunoglobulin-like Collagen-binding surface protein Cna, B-type domain 1d2pA02
2.60.40.1140 Mainly Beta Sandwich Immunoglobulin-like Collagen-binding surface protein Cna, B-type domain 1d2pA04
2X9WA 2X9YA 1D2OA 2XTLA 2XICA 3B2MA 4BUGA 2X9ZA 3GLDA 3GLEA 3RPKA 2XIDA 2X9XA 1D2PA 2Y1VA
chains in the Genus database with same CATH superfamily
3KCPA 4LQ1A 3MNMA 5KYUA 1A7OH 2G2RB 3O6LL 2Z91B 4QOKB 2I9LA 2X89A 5K9QG 1UCBL 2VLLA 4DP0X 2ZUWA 4QOKD 1DVFC 1U0QA 5HDLA 3IPEA 3VH8G 2DIJA 1U8MB 3NP4A 5DO8A 4LLVB 4BUQA 1ACCA 1UXSB 4QJ4B 4CL7A 1J0ZA 3GSWB 4IKJA 4XO3A 5TDPB 5C0IA 4XOAA 4AX3A 2CDGB 2FQEA 5KWYC 5T3XL 4PREA 1RIHH 4BK5A 1JRHH 3QORC 5CLTA 5I6LA 2NUPB 2Q20A 1C12B 5IW1B 4DPAX 1U2CA 1FZOB 2FATH 3DX7A 2CO6A 3LKQA 3LEVL 4OM1L 4FKKA 4RQQB 1IFRA 3QWOA 4D9QE 4L1SA 5LNGA 4AMWA 2C34A 1J8KA 2YPKB 3N6YA 1LDPL 5DJ2A 4N2AA 4FDWA 3RL1B 1FZKA 4KITB 2FX9H 1KIQA 1Z5YD 3ISYA 3OKOA 1E5ZA 1PNCA 1GZHA 1ZOXA 5CLWA 1D5RA 1EERB 3QORA 4NQSA 3RZCC 4FEMA 4HPYL 4X6EA 1CUOA 2FB4L 2ZKWA 4OLYL 4PJAB 2GITA 1I1AD 2FK9A 4GSXA 3TBYB 3X13A 3MV9B 4GXUN 1EANA 2J72A 1JI2A 3ARDC 3LMJL 4AKQA 2A6JB 3V0JA 5KSBE 1ZGLP 2E9IA 1T7ZA 2VDML 5E6RB 3ROOB 3M8OL 2P8PB 3HNTH 5K93A 2B4CH 3W11D 5C3LD 3NCJH 4L9LB 1BD2D 2XZQL 4G42A 3ASWA 2YKLL 1A02N 2KC0A 1G87A 3FUEA 3GMPA 5EEWA 4MCZA 3VNYA 5LXGL 3TF7C 1OE1A 2WTRA 2AMUA 3DX8A 3L7FB 3NFSL 4ZS7L 2PXYB 1UFGA 4V2CB 4FF9A 3RNQB 2J8HA 2YK1H 4DP2X 1IGTB 1P2CB 4CBZA 1T5KA 2B1HL 4KQ3L 5EUOF 3FBKA 3QK0A 2YN5A 4FJ6A 4BZ2L 4OJAA 1A3RH 2V7HB 1NGQH 1A9EA 2XWJA 3ARDA 1N8ZB 2YFNA 4XP5L 4XX1G 5AVTB 3HPLB 4OUOA 4DGIH 4F9LA 4ANWA 4QRPE 4JGMA 4U6YB 4HHAB 2Q86A 3HG0A 4PI2A 1OL0A 1BVNT 1HKLL 2QKSA 3STZA 1WVZA 4B9KC 1CGUA 1RD6A 2CG9X 1OIOA 1PGRB 1TQCC 2PYEA 3M45A 3T6WA 5HDBE 2QADB 1G6RA 4PS3A 1YPZB 1DQJA 3QCTL 1XR8B 1WUNT 2R0KL 4LHUG 1XL6A 2PCXA 4B5EA 4H4NA 5F0JB 1EZVX 1ULVA 3KGUA 3PP4H 4KOBA 3HE7C 4KVCH 3UBHA 1DBBL 1X7TA 1SM3L 3BQUA 1KENL 2D3LA 1HSBB 4ZMVA 3PUCA 2Q8AH 3JWNH 2A9DA 2VQ1B 1RZPA 3IJYA 3IVKA 1ZHBA 2JI2A 3U36A 3QUYD 3BSZA 4JREC 4NO5B 4WF7A 3D3VB 2AQ3A 4QTIH 4UZGA 4OV6F 3L3DB 3HCVA 2IDCA 1ZS2A 2XN0A 3L6FA 1NEZA 3P11L 1VDGA 3KPRD 3AAZB 3D3VD 2XUWA 5DZVA 3BP7A 4N0FA 1MI5E 4L8CA 1B3JA 1Z9SB 1FFTB 1QAWA 1Z5HA 2C9XA 3SCMB 4PGZA 5JIMA 4FYRA 5K59F 5J6GB 5EFIA 4NQDA 5I75C 2B15A 2ZSWB 3UTZA 4IOSA 1FAIL 2P44B 5IM7A 3KPSA 4MMZC 2R0ZL 1QASA 4LSDA 4PMFA 4ES9A 3EGXB 1BHGA 1OB1B 3GZKA 1N2RB 3D18A 2HTKC 3JV6B 5DQDL 3WGUB 3LOWA 1IQWH 1GHFL 3EIFA 3WEAA 5E8OB 3MRRB 4PJGA 2WD0A 1DEEB 1YYLH 1IJ9A 1UB5B 5JOFA 4FNRA 1H3TA 2YR3A 3MJ8A 3VFWA 4Z7NE 1LK2A 4ALAH 1T7YA 1ILSA 4HG4J 3PWUA 2A83B 1XCWA 4MGXA 3LNEA 4HUVB 2GT9A 3MRQA 1T7WA 2EXYC 1A4AA 4GINA 2VMEA 1OK0A 4EE2A 2HAZA 32C2B 1KMGA 4FQXD 2AI0L 2JCCE 4AZ8A 5AZUA 1B4JL 4EF3A 2Y6SC 5AOMA 4OAWA 4HX1A 3QI9B 5ID0A 4WTQA 2NUTB 4PCTA 1TENA 4AH2B 4FTVA 1PY0A 3O6FA 4XMVA 1GH7A 1GS7A 2QELA 4B6ZA 1XHHA 3MBXH 3CFBA 5MENB 2A38A 2B9AA 5EZOL 1J48A 2X6AA 4ZMTA 2OK0L 3GSUA 5IG7A 4O9HL 1IC4L 4I48B 1P4BH 3B2DC 1FG9C 3ESPA 5BRZB 5A1AA 1F86A 5HJDA 1N0LA 5IHUL 2J5WA 1WAAA 4NZRH 2H32H 5DK0A 3C8KB 4JFFB 5JZ7C 2FNBA 5EC1B 4FNQA 2DI8A 5BRZD 2ADJB 5GGVH 1BIIA 1BDYA 1DANU 1P4LA 3SDYL 4DW2L 5IB3A 4JFFD 1A9VA 1ASQA 3ZKSD 4Z5RA 4MS8D 1C16B 1Q9LB 3GJFA 2IWKA 4LARL 1ILUA 1E2ZA 4JDTL 1XZ0B 3BAYA 2DQCL 4BSWA 3NJVA 2VXTH 4PLJD 4ZUVB 1BQLH 1ET5A 1SFDA 2WLLA 1F11B 4S0TD 3FCBA 3S7GA 3VI3E 5FO8B 3BSHA 1AFVL 4RZCB 3NK3A 2Y69B 1PS3A 4Y8AA 3AT9A 4ZS6D 2ICEB 5EUOB 1B0IA 1D5MB 3T1WA 3ECBB 1RURL 1T0PB 2TRYA 2ZOTA 3DX3A 5DWUH 2HKFH 2JKRM 4KKBC 4L4VA 4IMLB 2OZNA 5JR1L 2ITCB 5F7EL 5JO5A 3R4RA 2DKSA 1E9PA 2BM3A 2QEJA 3QPQC 4Z9KB 5JHDB 3HB3B 3FCSA 4J12A 5C0BD 5IB1A 2PR4L 2P4AB 3HMWL 2YSTA 5E8EB 3TURA 1TEGA 1U8JA 2QHLA 3HB3D 2AITA 3S37L 3OAYK 2VT0A 2J4WH 2VL4A 2ZX9A 2ZWNA 1X4ZA 3SKNA 2GW5A 4TUKH 3QC5X 2MTPA 2EC9T 4P2QA 4AUUA 4O2EA 2KLSA 3FHEA 3SQOL 4U1LB 5GGRA 1KGIA 1I9RH 3KBPA 2V5TA 5FKPB 1CPUA 4HXAL 4A2GA 3CZFB 1ZHNA 5LBVA 5L2JB 3BT0A 4A39A 2DH2A 3MKGA 5B8CB 3VGDA 5CLXA 1IBFA 2BVPA 1T5XB 4P49A 3ARBD 4C54A 4L1HA 3NJMA 1FC1A 3IGAB 1SNRA 5E7FA 4NQQA 2WB1A 3SE4A 5I5RA 1YEGH 1MRCH 1AOHA 5FUZL 4D8PA 1JZ2A 4JKPL 3N0PB 3U1SH 3F62A 1FJ1B 4DVRH 3CBKB 5EBLA 1XV8A 2WSPA 3OC5A 1MHHB 5ITFA 4U6TA 3P4LA 1AHWA 1TO4A 4LB8A 3K6DA 4QJ3B 1UH3A 4BSJA 1QI3A 5IWLA 4LIQE 2L7JA 4MSWB 4Q9RL 5CIPA 4HWBA 1KCVH 1SEBB 5TTRA 1JWSA 3QXDA 2JB5L 4KTDH 2HG0A 5D1QE 1W8EA 4F9PA 2ZCKH 4GUQA 4OZFH 2EDKA 4KK6C 1L9SA 3N2JA 4MMYB 3C08H 2P5EE 2VSDA 3QQNA 2VE6A 5IJKC 3AB0C 3O4LB 1JF6A 2G0LA 4NO3B 5JPNB 5J1AA 3U83A 1JZ4A 3JWDL 3DX6A 4H8WH 5IBTL 3WY1A 3UYRH 5F89B 5BS0E 2GYSA 4PY8I 2Y1AA 2VDRB 1BVZA 1LWRA 3V52L 3MJ9A 1E6JH 2GABA 4HH9B 1CT8B 4L2LA 3WNLA 2Z31D 5TDOB 3JWNC 1DSFL 3MNDA 1PSKH 4P5TA 2VDRH 3THML 5G55A 4X8XA 1IZJA 3UPRA 5LG6A 3CDFA 3CLEH 2ICWI 4K9EH 4Z3HA 4U1NA 3WKQA 4IRJB 4QY8A 1CGXA 1SYSB 1XIWC 4DP7X 2CAKA 5ID1A 1BQUA 3GMNB 3IE4A 3Q6FA 3S5YA 4P4KB 5IJKA 1EBAA 4CGUB 1DZ0A 1WP6A 5CN3A 5F7DB 5FUCC 2BSCA 3FUKA 4BE6A 4P4KD 3WNPA 6FABL 4MVBC 5JHLA 1RFDH 1NSNL 5B39G 3H3PH 2AXJA 5CCJA 1A6TA 5DT1L 2QPSA 5EOQH 5CEYB 3ZHDA 4Y4KB 4ZMNA 1JZ7A 2E0PA 1UKTA 1Z3GL 1BLIA 2W9EL 5D5ME 1CCZA 5T1LA 1ZLVH 1YNLL 5K9KB 1D7BA 4L18A 3BVDB 1RKRA 4GSDH 1XIWA 4J1UB 3VTAA 1D5BA 3NJIA 1CLVA 4PJCA 2C7FA 3SDAC 1RZ8B 2B1AL 4G9FB 3IFOA 3U48A 2VXUH 3DVNA 2WYHA 5I74B 1OGSA 1QFUL 2J73A 4ALAC 4IYKA 2QV2A 1A7BA 5JXAL 2HX9A 1IBGH 4WIQA 1JV5A 5E94B 1M7IB 5D7KD 5FFGA 2YA1A 2DWYA 2VL5A 2YA2A 2P5WD 2BY0A 3CDGA 3CXDH 4TSAL 3WNMA 2O5XH 3IDIA 4IBUA 3TBTB 1UUNA 5IIEB 3RJDA 5FHAH 3PJLA 1F02I 1XF5B 2J8UF 1R5WB 3E8UL 3W9EA 1HKFA 2NNRA 2OCJA 4DGVH 3WDJA 4A6YH 3KWWB 4ILDA 2FQGA 3P30L 3QRBA 1E9OB 2C9QA 3QARA 3CAFA 2FT6A 3T4AA 4GXVH 3IFNH 4MQXD 1S9KC 3MPCA 4NKMB 2ZYHA 4NSKA 1W0WB 2GJ6E 1BJ1H 4PJ9C 2X6UA 5D6CB 4PTTB 3HW7A 2F58L 3ARVA 2H2SD 3BHBB 1HXMB 2A9CA 2QGBA 4R2GD 4NERA 2BMKB 2VLRD 4BH8A 4YXHL 5I0DA 4OZIF 4IRSD 2O6EA 3B2PA 4HUKB 2A2QT 3OZLA 1Q9WA 4H1LB 4NXSA 4I5BA 5I1EL 4JHAL 2EILB 1T4KA 3BP5B 2YEQA 4XGZB 3KXFB 1MW1A 1JGEB 3EYQD 3H3BC 1DLFH 2J44A 2E8YA 1AD9B 5KN5B 4PLJC 2BWDA 4J3OC 4N68A 5FOBB 3IGFA 3OLGA 4GI8A 4QCIB 3EO0A 3G5YA 1L0YA 2DJSA 2G5BA 4MCYB 3HVNA 3ME0A 5GRJH 2R69A 2DN7A 5GS0C 4MJIA 1K6QH 1CQYA 3O6KH 3TV8A 4X99B 4MNQB 1TVBA 2IGFL 3CHRA 5I1IL 5D1ZI 3BH9B 4NOFA 4FZ8H 1BXAA 5LAXB 3DV4A 4DCQA 1C9SA 1YYML 2ENYA 3D5OF 3V7MA 5FGCB 4F3FA 2XN1A 5I5IA 2XXGA 4LOFA 4M61B 5FM5O 2WVTA 3W81A 1O7DE 1RIVL 1UJ3A 5CZVH 1CC3A 2F2HA 3CD4A 3SD5A 1ZCRA 3BIKB 3ZHLA 4WFHE 1Y6KR 3TBSA 4U1JB 1WUZA 2F19H 3MTRA 1G6RL 2H4EA 4N2CA 3UTPE 4OBSA 1ZLUK 4R4BA 4HKZA 4W6WB 4FFWC 1R3KA 4KGLA 2X9ZA 4JUSA 3FO0H 5FYLE 3SPCA 4Z95H 2FO4A 3M1CA 4JY4B 2UX7A 1KXQE 3EJZD 1KB9K 4LHJB 3RNKA 1CIUA 5KZCD 4ELMF 1UM6L 2VKWA 4YHIA 3TEYA 4LCCC 1OP3H 5JW5A 1E2VA 3GSRA 4Y4FA 1OTSD 2P8LA 1MJ8L 1DBKL 3B7SA 4TF4A 1H3VA 4N1HB 1FL5A 1NGXA 1R0AH 4P48A 2JLPA 3KW8A 3RVXC 3II3A 3S3DB 4NXKA 3HAEB 5D7LA 3DVFA 4IDJL 3KNBB 3U1PA 5A2AA 5I0VA 1OT4A 1ETZB 4UDTB 4LCUB 4I2XB 1FIEA 3HAEH 1KB3A 4G5ZH 2CJSA 2R1WA 5GZOD 1G7JA 4UM8A 3QB7C 4E9TA 3AS1A 4N8VA 1F3RB 4KMTL 4ANUA 4NHCH 3QDJE 4N6QA 4PV8A 3ARRA 1PKQA 2EEDA 4B9PA 4O2CB 4F92B 2ED7A 1MJJA 2OMYA 2VLJA 3VRJB 3B3IA 1NQBA 1NIFA 4PJXA 1B0RA 4OM1H 1PTZA 3MRKA 3S9DB 4H8QA 3VQLA 1AMXA 5I16A 4XAWH 3FFDA 4ACPA 3SDXA 5EU7E 4WUKL 5EBGA 4NZTL 3BUPA 3D39E 4MZ2A 1KLGA 1Q1JH 3OJ2C 4OGQC 5IUCA 2EVJA 4PGJA 4FQCL 1JRHI 2Z1KA 4OU3A 2HJFB 3C6LC 4AYEC 3ETBJ 2AK1L 3JV5A 4L9DA 4PLOB 5C0AA 3T2NL 1SLVA 3QIUD 1KWGA 2R8SL 2CJTA 3FB8B 2J8UB 1A6PA 4F8TA 1JI1A 1JPST 1BMWA 4OLYH 3DNKA 5L0QB 4YNYA 4LLQA 4PJHA 2MCAA 2ILLA 4LBEA 1J8HA 1BVKA 3DGCR 2OMNA 1QQDB 1UM5H 4WTZG 3CSBA 5JNYA 4TNEA 1HJBC 4EVNA 2VDMH 3LTVA 1P5UC 2A73A 1OARH 4PG9B 5DEFA 2XZQH 3ZTNH 1RJCA 2YKLH 4PP2B 3VI4A 3VD0A 1NH6A 2D2CC 3C6LA 1JZHA 1CG9A 3NFSH 4QRRB 4CVXA 4M5TA 4IMKA 2ZXAA 3T65B 4CVZB 4OZIB 4BKSC 4F8NA 5FIEA 3U2IA 2G60H 1J05B 1CYWA 4GUPA 4M7ZB 3EGSA 5TJWK 3QJSB 4IIZA 3VG0L 2IALA 5CU5A 3F58L 2XWDA 5CJBA 4IGBC 5EPMA 3WTYA 2VDNH 2XTSA 4XP5H 3LN4B 2DD8L 2VMJA 4WI4A 1FUNA 2H6PA 1P5UA 4JPWL 5F1OB 3AGWA 1R34A 5IOKA 5F9WC 4M1CD 3Q05A 1IGIL 1HZKA 1S5HB 3NH7L 4IIQC 4U1SA 1WH0A 5KVFE 5GSVB 3DLQR 5E0QA 2A6DB 1RUKL 2VDOL 1JXGA 5DHVB 1ZANL 2I25N 3QHFL 2XN2A 1Y18B 4QRQB 1KTLA 4AOFA 5KS9A 1T21B 3MV7E 4Z7QE 4L0PB 1E90A 4N0CD 4PJDF 1G7HA 4OH2A 4P2RB 3HG1A 1DCEA 3DC0A 1KLUA 5HGGS 5L8KB 2BINA 5FK9A 3O8XC 3CE1A 3PHOB 5I1KL 1DBBH 5E8DL 3BPNB 1E27B 1KENH 4NI3A 4KI5D 1QEWA 1ETB1 2O4EA 3BESR 3EH5B 2JFCA 3MCLL 2YWZA 1MAML 3GPSA 3QW9A 4P2OC 4P46C 4H88H 4R83A 3RDTC 3KGTA 2IH3B 4HU2A 4APXB 4X6BA 1EH9A 5J1TC 3QAQA 4XI5D 1CFVH 3K5RA 2J6EH 3LXUX 1JDDA 4C47A 5I6XC 4NEHB 4DP8X 2OBGA 1N7ML 1NL0L 4FXKA 4KFMA 4WY7H 4HUMB 2Z8VC 3GHBH 3U7AA 3DSFH 4K23L 1PNDA 3D69A 4ELMB 5IJVA 4NT6A 2V9UA 3O8XA 5DZ9A 2R23B 1E8XA 3T0WA 4JVUA 4FX5A 1DQDL 2VR8A 3EOBA 1BEYL 1JDCA 4G1EA 4N2MA 4UUJB 2R0ZH 1N5YL 2UYLB 2HXAA 3CVDA 3RPIB 1CD1B 3ARGD 4XMPL 5HDOA 1TITA 4PWIA 3U0TA 3MLTB 3TH4T 1GHFH 3MROA 2GUOB 4HWBL 5JOPE 4C56E 2DM3A 3I75B 3MRDB 2WNKA 3POCA 3EDKA 4XR8C 5FLVA 4DKFL 4N6RB 3GSXB 5L4IA 4OFKA 3UBGA 1TNNA 2X4OA 2KBGA 3N44F 5D2LE 5TDNA 4AK1A 3WTUA 3RPBA 2ZKHL 1TG8A 3FO2A 4JGJA 3IXAA 2FH8A 3QCVL 4ENED 1MELA 1TZ8A 2DMBA 1A9BA 4ZAKB 2AI0H 4LF3A 4GQQA 2E76C 1CIDA 2QVTA 2XKUA 3NP3A 1WBXA 5D96B 3UTTE 3MJ9L 1NMBH 4YHOH 4ZAKD 4GB9A 2O26U 4HPOL 2NXZB 2J21A 2VLME 3NZHH 2A0LD 3WFEL 1KGXA 3W3BA 4ONHA 5JLZB 3REVA 4ZSOA 3RX9A 4FQ1H 2HYMA 12E8L 4F93B 4PN6A 4CUCA 5B38G 3DHMA 1HEJC 1A2YB 3AABA 4JN2B 4O9HH 3RX8A 1YECH 2M83A 2VZUA 4YHKL 3U79A 1PIFA 4WJ5A 5GRVL 3HZMB 4HZLA 1S5IL 2YBRA 4WNJA 1RZ7L 4N22A 5EZIL 3BE1L 4RFEB 2XFXB 4DW2H 2XX0A 5JHLL 1T04A 4K71C 4N9GB 5CCHE 1PZUB 2Z7UA 1MZZA 3SIKA 2WVSA 4G71B 2X6VA 4HKXA 1BZ8A 1OAUL 3E0GA 3K4DA 3KVPA 2DW5A 1O9WA 4HH8A 1OK8A 4Q7DA 4GP8B 2Z8WC 4JY5H 4JZNB 2HRPH 1L0PA 3VXPB 3L4YA 5AUMB 1E42A 3K1KC 4X5XB 2IOMA 3QJHB 1FNAA 3BJ91 4G11A 2VUOA 4XPHL 2PO6D 4M6AA 2FO8A 1H9VA 1MWOA 5ALBH 1XH1A 1ZWIA 3MRMA 4AYFA 2CPUA 1EFXB 5ICYB 3CFTA 2LVEA 1UD2A 4HIXH 2X10A 3MRJB 2VR5A 4UQ3B 3US0A 4Y5VB 3N85L 4X7CC 5DWPA 4AVIA 2IIJA 4MXWL 5D4QA 3VXSD 5F7EH 1F13A 4JJOA 1PU0A 1GAFL 2HUHA 4F33B 4NRZA 3WJLA 4XPBL 2HP4A 1FO0H 1CICB 1YEIL 2D7TL 4GQPH 3VXUE 1MFDL 2OMTA 1LJMA 3VYNA 1A7PL 4AYGA 3HC0B 1CICD 2AVFA 4PJ7E 4YE4H 5KTEL 2W60B 2Z8RA 3S37H 2BXZA 3S8WA 5CGYC 3D7PA 3BZ4A 4NDMB 1GOGA 3LVEA 1N59A 4PJDB 2WCPA 3FJTA 4PJEA 1H5BC 1MG3C 4KQ4L 4HAGA 1EMTH 4PTUB 1SVBA 5ACMA 4HXAH 1XBDA 4MX7B 1N67A 1UZ8A 1AZNA 3BH4A 4MJ6A 4TLTA 4UM9A 5KVEL 4N28A 4O51B 1FIGL 2BNQD 3NAAL 5DYOA 3LEYL 1EZLA 1NGYB 2B7DT 2NY0B 3UTQA 4TUUA 3FU7A 1OEZW 4K7PY 4XNMB 4S1SL 4X6CE 3TNNB 3FQUA 3WFBH 4OCXL 4R26L 2NY6D 4LT7A 5DJAB 4HGWA 1OSPH 1F4YH 4MJ2A 1B0GA 4PQXA 3V7AG 3ZVVA 3KD4A 1PEZA 4O2FB 3GK8H 5CCKH 2UXFA 3V0FA 4L4TE 3F12A 3A6BL 4OGYL 3HZVA 4GEIA 2JJSC 2PCYA 4K73A 2RALA 5F88B 5AZEL 4PVLA 4AGLA 2R69L 3EFOB 4LE8A 1TYEB 2Q10A 1QNZL 4RIRB 3HEIB 1S7WA 5F1NB 3MRFB 1R3JB 3LKOA 4DN4L 1T3FA 3RL2A 3PL6C 3VFVB 1OSYA 1NC2A 4PHZA 1U8KB 1IEAA 4LKCA 1WD8A 4XCFL 2D31B 1KV7A 1NIBA 4KKQA 3JWDH 3TO4C 4BA8A 1M6OB 1MVUB 1T1YA 3QJXA 2D0FA 1MFMA 1QLRB 2I69A 2OXHA 2ZOLB 3KW7A 1MCOH 4L8SA 4QXVA 3WKYA 1U8QB 3G5XB 1TQVA 2HLFD 2OTUA 3HC4H 2Y1ZA 2C3GA 1ROCA 3MV9E 1E4JA 1IKFL 1HWGB 5CMAB 5ESAB 4JNXA 4YBQC 2X4QA 5LXVA 2HPOA 1SFHA 1J87A 3MBED 2AAVA 2EDXA 3T0ED 3PGCA 3N44B 3THMH 3B56A 3WL9A 1KYAA 5GS0L 4N0RA 2HN7A 2F54D 2VDLL 1BGXL 2JNZA 5H4YA 4B97A 3VXOB 1AKJA 2BVYA 3X11B 3LPOA 2G3MA 4U6VL 4RGMB 2X0VA 4MAZA 3PL6A 4Y19B 4P3CL 3PWPD 2H3KA 4P07A 2E7LC 4OZGA 1AO7D 3KCPB 2RR3A 2HZHA 2ZWYA 3FZUD 2ZXCA 5JIKA 2GK0A 2NY2C 3D33A 4O4YL 4Y2LA 5HYJD 2I9LB 4OT1L 5DJ0B 4OGZA 4DKTA 3ZZQA 2JJVA 2VLLB 4ODTL 3UMTA 3TVMC 2C3WA 4KH2A 4KX8A 4PJGF 2X89D 1CLCA 5DT1H 1RUML 1DUZA 1BP3B 5B38B 2W9EH 2ZCLL 4TS6A 1YNLH 3I74A 5ADPL 3CLFH 5C0IB 4AJWA 1TETL 4KKLD 3P1VA 4Z78A 3ZQWA 5AW6B 3KJ4B 1G7PB 2R9HD 1G1KA 2B1AH 2IPKA 4PREB 2YN3A 4D7PA 1V55B 1Y6MR 5TQ0L 2RHEA 3BVNA 5EZJA 1F6LL 1X5AA 2QTEA 4N0UA 2W59A 4KROD 4JHWL 2UVFA 2NX5A 2I24N 3DX7B 1CE1L 2CO6B 3EJCA 3LKQB 3QDMD 4ZW3A 4IHBA 5KYNA 3H1ZA 1P69B 4ZNEE 1LXMA 1I7ZA 4TSAH 1DVFB 1ZDQA 4ISVA 3K3QA 1VACA 2K8QA 2HRGA 4FFZH 3PP3H 4HXBL 1WHOA 5TH2A 2JJUA 1FZKB 2O5YL 2QQLL 3APNA 3E8UH 1A3ZA 4WUUA 1KIQB 3LIZA 5C7XH 1SDDB 2P49B 5F0PB 2W81C 4NJAL 1G9NL 1WAAF 1AANA 4TTGA 5C71A 3PQYB 3QORB 2DQTH 4TL5A 1MKFA 4DNLA 4UQ9A 3SBPA 2NW2A 2H41A 4X6EB 1WT5C 3FH8A 4ANVA 5ANHA 3FQ2A 2XWZA 5DSCA 3AGVA 3BP4B 4LXFA 4QHUA 5AB0A 1IL1B 1INEL 1OO2A 1XXFC 3GWJA 3K0YA 5IROC 1QRNA 2XQ0A 3NABH 2GB2A 1ND0A 4KRPC 1UH2A 4Q2ZA 2X28A 1G43A 1KC5L 4V1DA 5FCUH 5CLYA 3SQRA 4G42B 4H8UA 2KDGA 3GDBA 4JQXA 3GMPB 1F58L 5F0MB 4MCZB 4J3XA 3WLWD 1UA7A 1KELL 4BXVA 4ZX5A 2WTRB 4JHAH 3DX8B 5CHNA 3AREC 1A0QH 4KTGA 1TZAA 1DFXA 3W2DH 1IC1A 4CC1A 1RK7A 3QA3A 3VXMD 2CO7A 1KCKA 5EA0L 4NN5B 3RZCB 4OI8A 1HDMA 3LD8B 1WT5A 2D7PA 2K4AA 5D1XE 3UEZA 4MA7L 1U42A 1A9EB 3C5XA 2LGNA 3ARDB 5JDJA 1H6TA 4Q89A 4IU2A 1PF3A 4EI5C 5F3HB 4HUWB 1BM3H 3R0MA 2BSSA 4AEHH 2AQNA 2IGFH 3M1BB 2Q86B 2H0EA 1MF2L 4BCYA 4JFQA 4H40A 1YUHA 2YPLB 4JDVA 5DLML 4MLIA 1SJHA 4NWUL 4B96A 2JJTA 2EEBA 3N1GC 4GY4A 1U3HA 1G6RB 3RUGE 5LCVH 2APBA 1O7SA 4HIEB 1DQJB 1RIVH 2EIZA 2VXVL 3L13A 4PJBA 4GO9A 1RHFA 1E3FA 2PYED 4ICWA 3LNGA 5D2NA 4S1QL 2IAMC 4WHYG 5AVVB 1G6RH 4MD0A 4M7LL 4E9YA 4RRPG 4Y1TA 5CSZB 4EI5A 2BSBA 2NY3C 3MCG1 1HQRA 3MUY1 5JA8B 1QFOA 4J5VA 2B08A 3DPDA 4WCYL 5C08A 4HULB 5IB4A 3BQUD 1GGYA 1Q0EA 3IJYB 3IVKB 3EOAB 3U36B 2BH0A 3N41B 5BOPA 1G7MA 1YC7A 4KJPD 1UM6H 3DJSA 1TQCB 2VMFA 3C87A 1N6QH 3UC0H 5C09A 4L8BB 5LNDA 4MHHG 4MB1A 4WW2C 4AM0A 1U2YA 1BAGA 3HCVB 3ILQC 3OTTA 4P2AA 4CA4A 1NEZB 3MRNA 5T33L 2VIRA 1DBKH 3BSZH 2XWCA 3C2AL 1CXIA 2DQJL 3NJFA 2KI6A 2IAMA 4N0FB 4L8CB 4R97C 1X5MA 3O9WD 3ZE0E 1ZSHA 1HHGA 4FP8H 5EFIB 4PJ8C 5J7CC 4NQDB 3V10A 3KYMA 4FQIL 4CSZA 4Z7WA 4F7PB 2DV6A 3KPSB 4NPYA 5BZDA 5EOCL 1NMCC 3WDIA 2VC2L 4WI5A 1MDTA 1IC7L 3KVDD 4IOSD 3O2VL 5INCA 4LQFH 5D71L 4JREB 5LGKA 5DJZA 2APWA 4OM0L 1ACYL 3SKJL 4KY1H 4WW2A 3M46A 4M7JL 4PJGB 4KO7A 3S88L 4XPAL 3D0VA 2F1EA 3MN8A 2FHFA 1K5NA 5DHMC 3S6CA 3T2LA 4OI9A 5DHXB 4NPKA 1EK3A 4NKDA 4X7DC 4XX1E 3MJ8B 3VFWB 1QSFA 1EZUA 1LK2B 5AVRB 5JHDE 4EOWH 1RZFH 3D9AL 2JKWA 4O5LL 4AXWA 4OFIA 4PJ8A 4GRLA 2YO3A 3UIZA 3W9DA 5CD5C 5DI8A 1BXVA 2GT9B 2VSCA 3IDXL 4F37F 5HTSA 1TEFA 2FJFA 1EBPA 1K9TA 3V4VA 1E3ZA 3MKKA 4KKNA 4HAFA 4MMZB 4U2YA 1LLAA 5AOZA 4AZ8B 5I30L 4OAWB 5IY5B 1EEZA 4HX1B 2DQHH 5ID0B 2QQNH 1XGZA 3EFDL 4WI0A 4C59B 5I17A 3SYAA 4KZEL 2EACA 4FTVB 2LQRA 3O6FB 3QWRA 3JWNG 4OCSL 3CFBB 3EH1A 2DL2A 3LN5A 4FTVD 2JMRA 3O6FD 3GMRA 3GSUB 2KKQA 4GUCA 3UG4A 5IG7B 3SN6N 1PX3A 2V17L 2YAMA 4BDVB 1EJFA 2VJ0A 1DVQA 1XCTB 5KVDL 5I24A 4U6XA 4QEGA 5IB5A 4Z7OE 1TTAA 2XWXA 1NKOA 1IU1A 2BC4A 2CK0L 2E7HA 1HAWA 3MLUH 4ZPTA 3PNWB 1BIIB 1I1FA 5IB3B 1N64H 2A9NL 1JWUB 4JW3A 5BUAA 4Z5RB 4APQC 1BZEA 1EGJH 3B1TA 3DBSA 1M4KA 3A67H 1IGJA 2WLKA 3PV6A 4ABWA 4EXKA 1X6LA 3O0LA 1DQIA 2Z3FA 3DUSB 3GUTA 2VWEC 1DL7H 1ET7A 1J9CT 3FAWA 3WJMA 1KG0A 4BSWB 4M6ML 4MKTA 2BDNH 2EYTA 2WLLB 3GJFH 4XXWA 4FQ2L 4YDJA 5GZNA 5EN3A 2DICA 1JDAA 2J12B 4DOHB 2VDOB 1EDYA 4ZFGL 1WGOA 2DOCA 4LPXA 1W80A 5JQIB 4X4XA 2UZIL 2WYIA 3D34A 5IQ9A 5KVGE 5B1KA 1BFVH 1ERNA 3ZKND 4L4VB 5AW2B 4OCNC 3FO1A 3R7RA 3QHFH 3ZTJH 1YJDL 5JO5B 1KXVA 3KPTA 4F37K 4BQ8A 1JVOA 4XP4L 5GRVK 1X5FA 4L4VD 5D7EA 4CRPA 3FCSB 4OUUA 4P5KA 3MMEA 5BXFA 5IB1B 5HY9B 1GSKA 5EMYA 1MCLA 2CK2A 1XB3A 3CX2A 2DIAA 1YSOA 1U8JB 3CXHK 3LH2H 5D4HA 3S36H 4PPTA 3IMBA 3TA4D 4Z3TA 5DR5H 3SKNB 2CLVB 1I1YA 2IG2H 4LPWA 4JQVA 4P2QB 2EXWD 5E8DH 4L8DA 4WNQB 4FQPA 5GGRB 4CU7A 5I1HL 3MGAA 4DGYL 3MCLH 1MAMH 3MLWH 3P4MA 2DLGA 4F8OA 2H8PA 5DLLA 2R51A 2BVPB 1C5BH 2AQRA 2R4SL 4XHJD 4J28A 2H47C 1BFOB 4OJFL 5I6OA 5IJCC 3ES6B 1RSYA 3IMRA 1SXSA 4D8PB 4KNUA 4WEMB 2E47A 2WNXA 5D70L 1U8PB 2YWYA 3ZE1B 3ULSA 3FTGA 2Y7MA 4NUPA 1KGCD 2VLKE 1OTTC 3MBWA 4JFUA 1XL4A 3VFRA 1KB5A 2LLGA 5ITFB 2VJ8A 4LU5L 1MLCB 1NFDF 3ZO9A 3I2CL 4OR1A 2YXWA 1BEYH 2DWEA 4PJ6A 3T77A 4LGRB 4J3OG 4U0RC 5CIPB 4XCNA 5IMOA 1N5YH 1XF4A 2B14A 5IQLA 4G7VH 2R1XA 1JWSB 3QXDB 5FO9A 4LRNL 3NSXA 3PDGA 4KO5A 1HL8A 3ZTDC 4B9CA 4DKAA 2KZBA 4FXGC 1S3KL 3AUVA 1MFEL 5J12B 4HWBH 2YAEA 2QVKA 3HNSH 4H26A 2VE6B 3UBXA 2JKTM 1NUFA 5HD8D 1GCYA 4MZ3A 5J1AB 3E2HC 4NZFA 3DX6B 2MKLC 3CVHL 3G6DL 3EDEA 1N9PA 2A4ZA 2ZKHH 2P24A 3FQTA 1CVSC 1W72A 1F3JA 3LN9A 1MIML 1RIUL 4N24A 2IF7A 4MAYD 3FF8A 1HCZA 4LESA 1T2QL 3OG6B 1M53A 4KRNA 2FBRA 4PW3A 4QYAA 2EVHA 4U1NB 4YBLC 4P5TD 4R9HA 4GKNA 4NQEA 5AWNL 4G6AD 3Q6FB 1KEGL 2EDMA 2HWZL 5FKAA 1FNSL 2BWIA 4RDBA 4Y16A 4NC0B 4N4YB 4Q9CA 3KXFE 3QIWC 3FDWA 2QQKH 4A7GF 3PGFL 4N2HA 3T0BA 2ZX7A 3C5SA 3TT3L 2NY1B 1S5IH 4KXZI 3WE6B 5C0NC 1JHTB 1VZHA 4KK8C 4XNUL 5CBAA 1BBJA 1KBGH 1A6TB 2NY1D 5KSBA 1D5IL 4UILH 4C4KO 4Y5XC 5JHLH 2B5IB 1EDQA 2OYPA 1AS6A 2J7LA 3P0YH 1XIWB 3IDMB 5EU5A 2EDQA 3SQBA 5T1LD 1CD8A 3IFOB 2K7QA 3RVTC 1N68A 4OZFG 1WFJA 4RBPH 3JTSA 4LP5A 3NA9L 5FGCE 1JGIA 2I7SA 3NJGA 1NLBH 3QJQB 2CCVA 2D0GA 4L23A 3DVGA 3JWOL 4NRXA 1JV5B 4EEEA 5KJRH 4OLWH 2CXGA 3EH2A 1H9DA 2VL5B 2BSEA 3CDGB 3S96A 1UUSA 2AK4E 3W0WE 3IDIB 3WLBA 4ZXBA 3DA0A 3FCTA 4OV5A 2H7WA 1GYVA 2WZPA 4ODWB 3CK0L 5HXMA 1NAKL 4QRPA 3F5WA 4R90L 1RU9L 1EUUA 1SOXA 4KK9C 2X9WA 3N85H 4GW5B 3TF4A 1ZE3H 1JGUH 4LSVL 1GAFH 3CN2A 1F42A 4QWWD 2D7TH 3U2JA 1DJZA 2IOOA 4H5SA 1MFDH 4KPHL 1BVNP 4NSKB 4O02H 1LTXA 5I1GH 4EUPA 4PWJA 4EN3C 1GY1A 3VI4F 2EABA 5HI4C 3AC0A 4BINA 4AKOA 1HAUA 2Y7QB 2AQ2A 3N40P 4BH8B 1C08B 4H20H 1YA5A 3VB8A 4KQ4H 1E3XA 3IYLW 3KYOA 2YA0A 3PJSA 3F6JA 4TOYH 1Q9WB 4AQ1C 2L4OA 4MD4A 1KWKA 4I5BB 1ZTXE 1FIGH 1HHIA 4TVUA 3ZUNC 3WGVB 5MERA 2AEQL 2YS4A 3OMIB 3GMQA 5I5MA 1QMUA 2ALAA 4HK3J 2F5AL 5DRXA 3HVDA 4I3SH 5FM4A 5M7QA 1LDSA 3IWVA 3UDWC 5CS7A 3T1FA 5AAMC 4FFVD 1OP5K 1TIUA 2ZJSL 2VQUA 1Q90A 1HC1A 2FSEB 3LRMA 4JPVH 3BOVA 2CLZB 3G5YB 1MI5A 4Y4HA 2G5BB 2C7UA 3IJ8A 4TV3A 5KS9F 1J0JA 1BBDL 3LVTA 1CN4A 4JFYA 4KTYA 4OD2A 4N2BA 1NGZA 2R2EA 3A6BH 3F8UB 4OGYH 5DUBB 4MJID 1VFUA 1ZDSA 3GHEH 3V0GA 4WW1A 2OS7A 2R69H 3DV4B 1HSAA 3L4UA 3MLVH 5FHBL 4N3UA 2ZG1A 4F8PA 1UJ3B 2JJWA 3DV6B 5AW9B 1N10A 1B4TA 4Z0BH 1M7UA 1Q8MA 4GIAA 5CWSA 4XCFH 1SMOA 3TBSB 3D87B 5CGBA 1X5GA 5SV4A 3UPCA 5F8RC 4W9EC 2KERA 5IESL 2J8UE 1OPOA 1RP9A 3QNYA 3TA3C 1B6DA 3TP4A 2FR4A 2B2XL 5I8EA 2MQGA 2M8XA 1R3KB 2VDLB 3DI2B 3GBML 1Z5LA 2VAJA 1GJIA 2GJRA 1OSZA 1YNKL 5F72S 2FO4B 4HWEH 3RNKB 5DJ6A 3VFNB 2CGRH 2JCCA 2VZ1A 1TU2A 1NCJA 4NQCB 1MVFA 1Q38A 4EMZA 4YHIB 3RIFK 4BKLA 2OKMA 5JW5B 4U6VH 3GSRB 2IDFA 3OAUL 1TZGL 1DVXA 2P8LB 4WWKA 2H1XA 5DMIL 4PR5A 1MCCA 4Y4FD 5F0LB 3MLSL 5FA4A 4RVBA 4GBXA 4O4YH 3I6GB 3DO3A 4OQTL 4Q6IC 4ZW6A 4RZKA 1CTOA 5C07E 5D7LB 3BAWA 5EU3A 3TA3A 2X09A 5FAAA 1ZS8B 1N19A 2ZUSA 1V54B 2F53E 4CKQA 5D7LD 1QO3A 1RUMH 4G8FB 2AXHA 4XN5A 3PLYA 1R46A 1DANT 2R1WB 4IRZL 4UM8B 5IFHH 1GKOA 1YY9D 3GTVA 4E41B 4UNVA 5DFAA 4CDGC 1XMEB 2JXMB 4LSTH 4PIBA 5F7HA 5ADPH 5I8OH 2LR4A 5CZKA 1TETH 4GG8B 4PV8B 1SN5A 1RP8A 4UQIM 1J5OH 1OE3A 4RSYA 2R59A 1NCDH 4PD4K 3NRPA 2OMYB 2VLJB 1MCDA 1HHHA 3B3IB 2FO1A 4JHWH 3T8XA 3Q06A 3MRKB 4LCVA 3CZGA 4P2RE 5I16B 1OPGH 1TDQA 3VI3A 3FO9A 3IEAA 3FFDB 1A7QL 3SDXB 5AZ2L 1BLNA 1ICTA 4MAYC 4HXBH 2CUMA 2VITA 4UBDC 1KLGB 2CDEA 1HH9A 3OXSA 3GTNA 2QQLH 2GKIA 2QBWA 2HT2D 3V4VL 3TH2T 1JOIA 3OPZL 2ERJB 2Q3XA 4JM4H 2WVVA 1JFQH 4F57H 2A6KA 3DJ9A 1G9NH 4NJAH 4QXGH 3MRGB 1JXKA 4JFZL 5CN1A 3TBBA 1OAXL 2Z7ZA 4NM4L 5C0AD 2PTUA 1Z9MA 3WDHA 4PJHB 3T6QC 3AG3B 1W8OA 2ZOUA 5FGBC 4LBEB 2WY3B 1J8HB 1BVKB 5ERWB 3AQDA 2ZCHL 1PZ5A 2EH7H 4EVNB 1OANA 5JXEA 4XMUA 3SPJA 1RZJC 1VAHA 4M8RA 4JGNA 1UZ6E 5DEFB 1FVCB 2PCPA 5C86A 2EO7A 4EQ3A 3VI4B 4JG9A 3C6LB 3N91A 2VZVA 1CG9B 2F5BL 2G4EA 3H54A 5ADOH 5D1QC 3O3AA 1URLA 2BY1A 1X4XA 4IKIA 3DJRA 5EA0H 1NKGA 1PBYA 3APMA 3B9KC 4GUPB 3EGSB 5C0FB 1KV3A 4KK5C 3MA9H 5T1KB 5C0EA 2IALB 4AC4A 4HFUH 3WIIL 2E9GA 4MA7H 4TNGA 4JDEA 4D9LL 2CU9A 5EPMB 2YAOA 4W4NA 1NC4B 1N5AB 1AS8A 3S4SA 3BKYH 1OGPA 2H6PB 1P5UB 4CGTA 4HCRH 2NSMA 2CKNA 3MFGB 5FUOL 2HFEA 3LEXA 4ETQA 1YQ2A 1FLTX 4U1SB 2BIPA 4OIBA 4OJEH 2W65A 1UD8A 1MF2H 2WYZA 5CJXC 2Y25A 1FV1A 4FQJL 4TYUA 1KTLB 1Q0YL 2YGNA 3L95A 3RB5A 5KS9B 5D1QA 2BFGA 1BMZA 4NZDA 4E9WA 1A5FL 1R3IH 2RGSA 2WXJA 5AG8A 3UC2A 3CH8A 3B9KA 1FCCA 1G7HB 4I1RA 4PJEF 2P5EA 4DPCX 3HG1B 3PFUA 3TBWA 3QJOA 1G5GA 1Q0XH 4S1QH 1KLUB 1UENA 5FK9B 4JRYB 1XH3B 4PB0H 3VW3L 5BS0A 4N2DA 1MREL 4HLZH 5DK2B 5F9WB 2QTVA 1QEWB 3ARXA 3V95A 2FL5A 4IIQB 2NOYA 5AKTA 1QYGL 1VFAB 3RILA 1PG7H 5GJSH 5KVMC 1ES0A 2IEPA 2UWEE 3IJEA 4X6BB 1TJIL 3FQXA 5HJBA 3UO1L 3WCYA 3MLRH 4MB3A 3TN0A 2NY5H 3RA7L 2VN4A 3RLSA 1U4FA 3GM8A 3F7QA 4KXDA 2WW8A 4DVBA 2EZ0C 1CXKA 1F1GA 4W9JC 2VMCA 4I88A 2DYPD 4R4ND 2X0UA 1S9WA 3D69B 4NT6B 4E9LA 1SF3A 3QUXD 3O8XB 5HHXL 1XX9C 4KXBA 2VC2B 3QDGE 5I6KA 3IMVA 2IAAC 5ETUA 3TO2A 3IGLA 3TM6A 3EOBB 4G1EB 3SYCA 1P7KA 3T4YB 1M42A 2GTQA 3RDTB 5TPWH 3SJVD 2X1QA 1IC7H 5FYJE 1KB5L 1X7QB 4GPVA 1DJYA 2WIIA 1B2YA 1JYNA 1IIKA 1NZRA 2IQ9H 5D5MA 3QQDA 3MROB 5CP3A 3SKJH 5I6XB 3RWJA 4XPAH 4MAUL 2CWRA 3WS6C 5DFVD 3NCXA 2DS4A 5I19H 1KYDA 5FW7A 2AJSH 1EX0A 1E43A 3D9AH 5TDNB 1FNGA 2XG4A 4ACTA 3QUML 3FO2B 3G5VA 5LKNA 3IXAB 4OJDH 4L3EB 1A9BB 1HOCA 3ETTA 4HJJH 4LF3B 5BVPL 4J2QA 2YRZA 4S0SD 1WBXB 2JKXA 1IILE 1UQSA 4GH7B 4OZGF 3TJPA 4LLWA 2EQDA 4JFSA 1JGLL 1LEIA 1W72L 4XMLL 4KO9A 2WXQA 5MHSD 1EAPA 3PWNA 1JPEA 4N90D 4KJQD 5J13C 4MBOA 3VTTA 3OB0K 4QNPF 4N2KA 5C0CE 1FI8C 3ESNA 1ZPLA 2C4FT 4Q9BA 3REVB 4R6UA 4X6FA 2AGJL 4XN1A 2OR8A 4PY8J 2V17H 2GJ6A 2VN5A 1YG9A 2MRYA 1DQTA 3NCCB 2YBRB 4PGCA 4RISL 2B59B 3GI8L 4I4WA 5DD5L 5SV3A 1O75A 5KSAC 3QUHA 2OZ4A 1T04B 4WO4D 3MREA 5EC2A 3WTSA 3HI5L 5F9JB 2FLBT 3OXRA 5JIDA 3ZHNA 2ICWJ 1MCKA 1SGKA 3T6ZA 4HKXB 2I60L 4HLJA 1MFCH 3VWJC 4G1MB 5SWSD 2G0KA 2A1WH 2MHAA 1JYXA 5G4NA 3BAEH 3ZX1A 4OLXH 4A2HA 1PW3A 3QUKA 4JM2A 4OCYL 2V2TA 3ALWA 1BZDA 1I31A 2D4DA 4FQ2H 1JNJA 1ZWIB 4JY6A 3MRMB 4ZFGH 4AYFB 4NQTA 1SXCA 1B6UA 3L4XA 2C3VA 2BFVH 2UZIH 4JPIB 5B1CA 4PRNA 5AB9A 2R2CA 3HBZA 1USZA 1Z9LA 1YJDH 4M43H 3VWJA 3OGCA 5I66B 2ZYRA 4TVPE 4NRZB 1VPOL 3H2WA 1QKZH 1C8QA 1HIMH 1TJGL 5D8JH 3APCA 5KG9B 1KCSL 2DQEL 3WKMH 1VFMA 2OMTB 4R7DA 3ZMRA 3QEHA 4KFZC 5DS2A 2YAQA 2FX8L 4R7VA 5ANMB 3EOYG 3RBGA 4EZKA 3WAKA 1HFUA 5C2UB 7TAAA 2EDWA 1GC1C 2YD4A 2Q7AA 3BZ4B 3C75A 1N59B 4DFIA 2DAVA 3LIUA 3DETC 4PJEB 1SBSL 3EYSH 3NRFA 5DUPH 3ATEA 1UZ8B 4M5ZH 4OGAD 2G3ZA 3JSSA 3OJDA 4RX4A 4XPGL 3ZHFA 4CC4C 1WCBA 4HBCH 1ZLSL 3UTQB 4UM9D 2DMHA 1KXQA 3FU7B 1Z9PA 4DF9A 3FULA 2ZF9A 4UAOC 1HH6B 3FQUB 1FAKT 1U8IA 4PAZA 4PCKA 3IU4L 4GOSA 1TOXA 4G5AA 5IVZA 4XVSL 1CB4A 5EUKA 2WO4A 1U8LA 4WFFD 1V3JA 5IBUG 1JVKA 5GHWH 4HGWB 4WU7A 3X1NA 1HHKA 2Y36H 1B0GB 5CJOH 1WFIA 1KN4H 3HS0A 3X14A 3MJ7A 3QO1A 2ZOKA 3MV8E 3I2CH 4N8CH 1G6VK 3DDFA 1LD9A 5CJ5A 2WQSA 4JL1A 1DBML 4CC4A 4E5XA 1YY8A 3VRLE 1SPDA 4XP6L 5ACZA 3NEXA 1I3UA 1PZ2A 2CHNA 3CVHB 2DQUL 1MFEH 3LKOB 4UQDA 1MEXH 1T3FB 25C8L 4PGBB 3QDJA 1NC2B 4XMKH 1FVEA 1VFBA 4GO8A 3MUZ1 4AV4A 2LU3A 3PQYE 4IJTA 1MWAA 2GIMA 2OXHB 1CDIA 4L8SB 1MW0A 1ZXQA 1WEJL 2OTUB 3BC9A 2XZCH 1I8LC 4WFEE 3NTCH 4MHHI 2X4QB 1RV6X 4DZBB 3M88A 2FJUB 3IFLL 3RWFA 1J8SA 3L4WA 3N42F 1KJVA 2XTLA 3D39A 5D93B 2HN7B 4WFGE 4IKNA 2ZXEB 3GLEA 4AQ8A 1AKJB 2UXTA 5AWNH 5HGDA 3K1DA 1F56A 3PL6B 2Q76A 1FHGA 5EO0B 3V6FA 5ISZE 1KEGH 1H8OA 1FNSH 3IN2A 4OZGB 4I9WD 3OR7A 5JQHC 4H8VA 3MC0A 4N20A 3TWCL 4ATTA 3FQ1A 1H15A 3U25A 2EADA 4MLSA 5I8CB 3PGFH 1N3NA 5DO2C 1E4XH 4X42A 3VD5A 1WFMA 3HS9A 4MFHA 1I8LA 2ZX5A 3O3EA 4ZX3A 4WW2F 1C1EH 3UJJL 4HD9A 2Y06H 1UGKA 1DUZB 3KLLA 5LN4A 1SLUA 5L88H 3DK2A 2XKNA 9PCYA 4LNRA 3F7VB 1VIWA 1DR9A 5I8KL 5DC2A 1CDBA 1OD9A 3IRZA 1T03L 4Z78B 3D25A 2WVUA 3GM0A 2FLMA 2DTML 2YPLE 5CO1A 3N9GL 2DIBA 4QHKI 5KUMA 4GJTB 4J27A 5EZJB 4N0UB 2Y2WA 1JTOA 3EYUL 3V7AE 4JZJC 5AVUB 1XGPA 1DQQB 1I7ZB 3TVMB 4ISVB 2NX5D 4CILA 1VACB 1TR7A 9CGTA 2KPNA 3WIAA 2WXKA 4RMRA 2L8AA 3GKZA 2X05A 1VENA 4LSRH 1GKEA 5TH2B 4F1ZA 1U3ZA 2V5RA 3H3KA 2PWEA 1NMAH 4WUUB 3T5WA 4JAMB 4LSVH 3GLZA 4KJQC 3QIBC 4JR9L 4ZTEA 5JW3L 1VRSA 3P4NA 4WUUD 1GXEA 2DQGH 2XV3A 1L4IA 3FN0L 3MV7A 4QTFA 4FG6C 2F74A 1RJZA 1N4XH 2OJ1A 3LIZH 4MZRA 3VRIA 1CZ8L 1LNUA 2CH8A 3QG6B 5DSCB 4GKSB 4JX0A 4JZJA 1AJ7L 4CMMA 4J6RL 5LGJA 5EN2A 1M1XA 1X5YA 1QRNB 3CMGA 3BN3B 1LMKA 1NDMA 2HSIA 4Q2ZB 4UTAA 5IR1A 4X0NA 5GRYA 2OULB 4FNPA 5EULV 2XV2A 5GGQL 1NOFA 4V1DD 2LFGA 5CHNB 1BZOA 2AEQH 3BN9C 3N1FC 5C8JA 3FBQA 3QIBA 3DROA 1DZBA 5K9JL 1QHPA 3QA3B 2K78A 2WLZA 3HLAA 4LPCA 1BQSA 1YEJH 2X88A 1OSEA 1HDMB 3LPWA 2YSSA 1TZHA 5C9JA 2WBXA 4ORZC 5L2KB 5IEHA 3CFKA 4D3CH 2EDFA 5GGTA 4FRWA 1VEPA 4ODSH 1YN6A 2YXFA 4IU2B 4M3HA 4AKPA 2EC8A 4ZFFA 5LJYH 2VDKL 4WK0B 2CHXA 2BSSB 4MQSB 2QLYA 2F7OA 5HDWA 3QFDA 4LEOA 2OMUA 4JFQB 2ENPA 3OAZH 1YUHB 1XGUA 1RZJL 4KZDL 2HG5A 3UMNA 1SJHB 4FN0A 3OZ9H 3GEFA 4DT2A 1E8YA 1U3HB 4MNHA 4LIQL 5AYTA 1SJMA 5CGTA 5HHNA 3EJYD 4PJBB 4WVRA 3V0EA 5HYQA 4C56A 1RZKL 3O11A 3H7BA 1U3HD 2VR3A 1QBLL 1IT9L 5BW7A 5CKAA 4MD0B 3NACH 4MMXA 3BVTA 3WBDA 4JFHD 4BK4A 1B2WL 1UM4L 2Z1PA 4EI5B 2BERA 3V0HA 1HQRB 5D2LA 3S34L 2XWTB 4QT5A 1NA8A 4RGNC 4DEPC 3GBMH 5C08B 5IB4B 1YNKH 4KBPA 5EF2A 3QUZA 1NICA 5DRZA 4ERSL 5C08D 1G7MB 2DLIA 3L4TA 4KDTA 3UTTA 1ESOA 5E00A 3CIQA 1JWMA 5C09B 2GBUA 3LYRA 2XTJC 3EFFA 4TSCL 3TBVA 1I75A 3MRNB 2FWOA 3L3GB 3S5LG 5DMIH 2ZNXA 3CIAA 3N42B 3K8MA 2IAMB 4BGDA 2E6PA 3VX1A 2YOAA 1JFHA 1D6VL 1HHGB 2X70A 1HE7A 4HS8H 2OAAA 4Z7UF 4FNUA 2X4UA 4X83A 1JCVA 4HF5H 3KYMB 4PRHE 1UWEH 2VMDA 3RY6A 4CNIA 3IS0X 4DO4A 3UZEA 3SPGA 4X9HA 2UY6A 4NPYB 4AZUA 5BZDB 5FS5A 1Y1UA 2N59A 5INCB 4XBGA 4HHGA 3F7LA 1G5AA 3GTTA 5DJZB 3FSOA 2IBGA 4WW2B 1L9OA 3UP6A 1NGWB 3D0VB 3M7OA 3UG5A 4L0YA 4PLKC 5A6MA 3LRSB 2J56A 3PG2A 4NKDB 4NENA 4U49A 4X9BA 5BJTA 3DTXA 4I3RH 4K8RL 2EIKB 1A4KA 4P9HC 5IFAL 1ROWA 2CE6A 4PJ8B 4GRLB 3W9DB 5DI8B 2R15A 4EIZC 1M3IA 1QSFD 5IT2H 1E5UI 1LVEA 1AOZA 2FJFB 1G7IA 4GRLD 1MHEB 2UZXA 1HZLA 1NMCB 2HFFA 1UOLA 4XCEA 3ZE2E 1XGTA 3FW6A 3P73A 4HMEA 1EJ8A 4OD1L 3V5DA 1N12A 3V4VH 2X4NA 4WI0B 2O61A 5I17B 3CQFA 3QULB 5HHOB 4P5SA 2DQ6A 4YVNA 3BYTA 2EO9A 5KSUB 4KVNL 1OAXH 1JPTL 3LN5B 2OW7A 4B3VA 3QWRD 3GMRB 1TSHA 5KSBF 2DRUA 1LL1A 1P7QD 3CFCL 4U1GC 2YQ3A 4FNTA 3FTVA 1KZYA 4GAGH 3FU0A 5EZLA 2DBLH 4OIAA 4PJ7A 1IGMH 2QPDB 4U6XB 5IB5B 3SOTA 4ZPTB 2BC4B 3FL7A 4A66A 5IGXH 1I1FB 4DPRA 2JQZA 3KWXA 1A6ZA 4KKCC 1G9MC 3B5GA 2EDOA 2ZSVB 1JN6A 2BSRA 2FEEL 1AGCA 3DMMC 2UY7B 4XZUB 4UZUA 4AGQA 1IGJB 2VDQH 4R8WH 2OZ4L 3PV6B 1E7VA 3WFZA 1ORSA 5CR8A 3WELA 1DHKA 1U8MA 4LLVA 1X5HA 3HMXH 4F7KA 3RKDC 1CI5A 1GSMA 4Q6KA 5I1CL 4HOXA 2WV3A 3WJMB 2AP2A 4PWKA 4X6CA 3GC3A 4ODUA 1UWXH 3TOPA 3FQNA 3GSWA 2EYTB 2FH6A 4UDUB 5TDPA 2CIIA 4YDJB 3EO9L 3P4OA 1JZDC 1OAQL 1MJ7H 4JFDB 4XP1H 1J0HA 1HL5A 1TCRB 3IDUA 5GZND 1XF3B 5CFHA 3UOAB 2X1PA 5IW1A 2E9BA 4KH9A 5IQ9B 3FT4B 3K2IA 5L6YL 5C0GB 3EYOB 4L4TA 4LSUL 1SVZA 3SGEH 4APQB 4TKWA 4H2CA 5EF0A 2DQIL 2RAMA 4FQJH 3MGTA 1FN4A 4UOQA 2YPKA 3ABMB 3QRGH 3PWJA 4LVOC 4EAEA 3D0AA 1MAKA 4OUUB 1A5FH 4P5KB 3MMEB 4PHXA 5BXFB 1HL4A 4B9ZA 1RZGA 5GIRA 5I6NA 3PUUA 5B3SB 1V27A 2R0WH 1JD9A 2ZTBA 4WEBL 3ZIMA 2AXFA 1OT2A 3AG4B 1FSKB 2BK8A 3ISWA 1MW2A 2CR3A 5IUSA 3OC8A 3VW3H 2ED8A 3B2XA 3ARUA 2JTDA 4GMTH 4L8DB 3ASOB 4JKWA 4MXQD 4BH7A 2P9RA 1QYGH 3MV9A 4ANKA 3N5AA 1XEUA 3JWNE 3P4MB 1BQHG 3ZL4H 4Z8FL 4YXLL 2XV0A 1D6EA 2H8PB 3UO1H 2XZZA 2P8PA 4Y0GA 1PVHA 2J20A 4HJGB 2BZCA 3PABB 4E2OA 2ZXWB 3NESA 2AEIT 3C6SA 5FYLL 3SYOA 3DX2A 4DSYA 2HUEA 2YAHA 3LKNB 3Q2WA 1QZNA 3VD3A 3ULSB 3FTGB 1REIA 3NJJA 4NZJA 1TQSA 4UV4H 4XAKD 1A14L 4Y9GA 1JUFB 2ZPKH 3MBWB 1P2CA 2AJZB 3SKMA 5FUCE 3VFRB 1KB5B 4M7LT 4NUJA 4HCIA 4AL8H 4GUOA 1D9KD 1GC1L 5DMKA 3T77B 1X5IA 2W94A 4XCNB 4NZUH 2V7HA 3S5LB 2R1XB 5K1VA 5FO9B 1N8ZA 1FFNB 3HPLA 2CRZA 4WTXA 1VHPA 4M93C 2BO0A 2HFGH 4S1DC 3PPSA 4U6YA 1L9RA 2CNZA 3UTSD 1DBJL 4HHAA 5I1LA 3CZNA 4H26B 3QUMB 4MAUH 3U6RA 3ZTJG 4FYQA 2AKRB 1QW8A 2AEOA 2XXCB 4YDZA 1JGVL 1IAIL 1ACXA 3I3BA 5I0XA 2JCCF 3N55A 3RJQB 3P0VL 3LNDA 4JO4H 2P24B 1XR8A 2FD6H 2BP5M 1F3JB 1UOVA 1TT6A 5E9AA 1T7XA 5IEKA 5H37A 1MWAL 4U0RB 4WI2A 1U91B 3GKWL 4NRYB 3L3IB 4L2YA 4PS8A 2Q0ZX 3Q8BA 2ZG3A 3QEGL 4P2CG 1W72H 4FXGB 1H8LA 1KBWA 1JPFA 2V7NA 4GKNB 4NUGH 3LS5L 4DTGH 5FCSH 5E1AA 2VQ1A 5FKAB 2VNCA 4Y16B 1IC5L 2VH5L 4NQED 2GAZB 1JHLL 3LXBA 3E9TA 5EG6C 3C5SB 4Y16D 1AZBA 1T66C 4XNDA 3BAXA 3L3DA 4RISH 2YQBA 1AXIB 1AAJA 4XNZC 3BDYL 4GFXA 4OSUL 5DD5H 3AAZA 15C8L 3HC3H 5KSBB 1BAFH 2I7OA 5E6IA 2YRLA 3HI5H 1YAZA 2ZSWA 4EXPX 1TYRA 2XETA 3L9YA 1G9HA 5EU5B 3SQBB 4UF7C 2Q8BL 3VI3F 2NXYB 2GBAA 3F05A 5IHWA 4FNLL 5C3TA 3T08A 1N2RA 5L9DH 3UGXA 4F7TA 5CINL 5SWQA 3QIWB 3AS3A 4HBQA 1NFDE 1ZLWH 5IVOA 2J1WA 4B3EA 1HINL 1Q1PA 1ZEAL 2NXYD 3DVGB 4NRXB 4BZ1A 4Z77A 4IS6A 5E8OA 4WI3A 3MRRA 3OX8B 4G7RB 5D1XA 3S96B 4A7QA 3WLBB 4ZXBB 3FCTB 2AEPL 4P9MH 3VH8A 4OV5B 4IBLT 4UT7L 2WP3T 4K5MA 1GA2A 4QRPB 3F5WB 1G1OA 3EBAA 4ZXBD 3QYCA 2A83A 3U4KA 2NCMA 2WZPD 1MFNA 1W16A 4EQ2A 3L17A 3C8DA 1ZV2A 1HCYA 1WCQA 4W9CC 4BWTA 5B21A 3ZRCC 1AP2A 1P4UA 2VXQL 1SOSA 1TJGH 3J07A 3PXHA 4M1GL 5I26A 4H5SB 4NQCE 5KVFL 4LLDA 1T20A 3PFQA 2CHZA 3RUGA 2G3XA 1I85C 3KPQA 5C0BE 2NUTA 1YO4A 4AH2A 4ZPVA 5MEQB 1DVYA 1T80A 2BRRL 2J5LB 3BW9A 3H7LA 5J3HC 4EUPH 4U3CA 3VXTB 2WCSA 1SBSH 4ZMZA 3IKKA 1MHPL 5KANI 3PJSB 4AUJA 4KKAD 4RCAA 3L7EA 4JKKA 4XPGH 4UTAL 1HHIB 5MERB 3GMQB 2UXVA 1K3IA 1ZLSH 1FFPB 5DRXB 2ADJA 2H2PD 1D5XB 4E41E 2NW3A 4LFHD 4DO6A 3H85A 3DXAB 5TGBA 3T1FB 3IU4H 1UASA 3BD4A 4TVSa 4TLKA 1L6XA 4HDIB 1TQUA 3LPPA 1C16A 4JRLA 4KNSA 2IC2A 2F6AA 4ZO8A 1CFQB 2VM9A 2L7EA 4HSAC 4WGKA 3TV3L 4HOWA 1MI5D 4Y4HD 4P99A 5C0JB 1I9JL 1NGZB 1F11A 3KWVA 3EDDA 4Y5YA 1P4IL 3MRBA 2NTFA 1KPUA 1L3WA 4WW1B 5CP7A 2DKUA 1JF1A 5T5NG 4HFWA 1JTPA 1PZ3A 4MA1C 1GJWA 1AZUA 5F7WC 5F9OL 5T5NF 4E42B 2DQUH 3ECBA 1VESA 1IM3B 3LQMA 3O6ML 1EJ6A 2FLRT 3MNVA 4OTXL 1SF5A 4G8IA 4IMLA 4P23C 5CWSB 3T3ME 5I15H 5DJXA 1UH4A 4Y2DC 2WP3O 4XO4A 4GSUA 4G6KH 4U33A 3QNYB 5JHDA 1YYCA 4QXTA 4K7FA 3DYMA 3KR3L 2Y3NA 2FR4B 4NKOA 3IRCA 4FXLA 4WLCA 1Z5LB 4M9OA 3SGKA 4CVWA 5DD3H 4W93A 4HJEA 3O2DA 2VRKA 4MQ7A 5DJ6B 4YPJA 1X9LA 2JCCB 2XIBA 3VXQA 1TU2B 4HG4K 4ZK8A 2AQSA 3HG2A 2PWFA 4B5ZA 3O3DA 2EE6A 4B9YA 3ZR5A 5HHXH 2ZE0A 3RTQA 2ZWSA 3V0VA 4LHUA 3CZFA 4F24A 1JNLH 1FYHB 3TWCH 5FA4B 1RSFA 1V7NH 4GBXB 3VGAC 1T5XA 3H8NA 1WWBX 3KAAA 3N04A 1G0DA 3CMOL 3OB8A 4WWKD 4Y2DA 3DX9B 1MLBB 3TEUA 3TA3B 2VUYA 3UX9B 3SBRA 3IDJB 3QSKB 4GBXD 5D5MF 3T0XA 2YJQA 2FWLB 3CCHB 2YPVA 1GYWA 5BVJA 2BHUA 2LAGB 2Y7OA 1QO3B 3MQIA 3VD2A 3DHUA 4HPHA 3ESVF 1BA9A 5HDQL 3EJUA 4LKXA 3SPHA 3BH8B 4NB7A 3H56A 1K3ZA 5DRWA 5CEXA 1T03H 1DJHA 2WZAA 3C9NA 3RGVC 2FECL 2OPCA 4MSWA 2NQCA 3RY5A 1SEBA 3N9GH 4M62L 4EI0A 4TSBH 1U6AL 4UOW1 1A66A 3EOTL 2OR9L 4Q6IB 1JHKL 2BIHA 4ZRGA 3ZL2A 5TE4L 4Y1SA 1EEUA 5G5DB 3SSGA 3VI3B 3FO9B 4DUWA 4NIYE 2V9RA 3DKHA 5BV7H 1F3DJ 3O4LA 3MUHL 3BPOC 1BLNB 4JRYE 4DK6A 4FI6A 1CF1A 5IVXE 4X80L 2VITB 2EVIA 1HH9B 2QMKA 3UL4A 3CVIL 2LLNA 4Q8BA 2WVVB 4AQZA 2NQDA 4NWTH 3RGVA 1MCPH 1OXYA 2WGNB 4LL4A 5KSVB 1YZZA 4QUOA 3B2UD 4FS0A 1IRAY 1YEHL 2FIRT 3PCYA 4P05A 2UUDK 1CZ8H 3JXAA 4ZOEA 4IRJA 2KHAA 3GMNA 3MACH 3TZVD 1LYQA 1PZ5B 3H4FA 3Q5OA 3AXLA 3UEQA 1G0YR 5F7DA 5AAWC 1FFQA 3BGFC 2VLRE 5GGQH 1KXTB 5JXED 2QR0B 4N5ED 2Z6FA 1KTBA 1J1OH 2H1PL 3HE6C 4TQ8A 5EORL 3RWEB 1BYNA 1UWGL 5JHAA 2IDQA 1A4BA 3QZOA 1RUPH 2IWEA 3WE1A 2AF2A 2VDKB 2QFPA 2ZZUT 1XBRA 3MYJB 4J1UA 5C2BL 7FABH 3BKMH 2OJZL 1KCWA 1MQ8A 1HNGA 4HOZA 1RZ8A 4WHDA 3CZEA 4BWWA 2JB6A 4OF3A 2VLKA 4ZJ9A 1MRFH 2X4SA 5ECJE 2VDKH 2HFEB 3LEXB 3O0RH 4CW1A 2W65B 4EI6A 1M7IA 4KZDH 1FV1B 4NFBA 2YZ8A 3TBTA 5D1QB 1G9ML 3MRIA 2QDVA 4S0HA 5EWIL 3CX5K 4XNYH 2Z92A 1GIGH 4UIKL 3B9KB 2PLTA 4OIIH 3F7YB 4PRPD 2HVJB 3FCGA 2P5EB 3TBWB 1RZKH 2X9YA 3TJEL 5GS1C 2RFXA 2Y9RT 1S4IA 1SHWA 3KWWA 1EHXA 1S7TA 1GGBH 1KYOK 5BS0B 3AT0A 1UM4H 5G4MA 1GMIA 5ALCL 4JO3L 3S34H 4U3HA 4HVBA 4ZO6A 2FL5B 4XO8A 2WUCH 5BS0D 1BOGA 2X44D 5D6CA 3OGOE 2CSPA 3UACA 1KB9J 2WO3B 3BHBA 4KDVA 5HVHB 1H6FA 3FQXB 4ERSH 1JP5A 4HOMA 2IADB 2BMKA 1CBJA 3TN0B 3UFIA 3TFBA 4YR6A 3GHPA 3R8BB 1MPAL 4NCC2 3IETB 3BAKA 2E7MA 3TN0D 4DO5A 5K1JA 1XWVA 2AQPA 2HB0A 5BZWA 5GS1A 4ICXA 1IBBA 4DP6X 4HJ1A 1S9WB 5LGYA 2D9QB 3TC9A 3KXFA 1G4RA 4KUCF 5ETUB 1AD9A 2GVYA 5KN5A 4LOVA 5IQNA 1P7KB 4BZYA 5D7JD 5ICZB 2K6WA 3KL3A 1VEMA 4YAQB 4ADIA 2D03L 1XGRB 2E3VA 1OCRB 2WIIB 4HK3N 3NJKA 4UU9A 5D5MB 1XXDC 3GNML 3OKYA 3QQDB 3KYKH 4UV7L 4XO5A 4X99A 1HS6A 3RWJB 2Z65C 2W92A 4AIEA 1S78C 4RNRB 2ARJQ 4N1EA 4K8RD 2CZNA 4KGJA 4PP1D 4DIXA 3IPBA 5LAXA 4J3UA 1NCNA 4DK3A 5L4MA 4PSPA 4Q52A 2XG4B 3NGBC 1QI5A 4PRID 1OCWH 4YVUA 1T0NA 3G5VB 4HUUA 4ONFH 5F2FA 4GG6E 5ANME 4RMBA 5KW9L 2OX5B 3NEOA 2QVFB 3FQYA 4P59L 3VWKC 3BIKA 2AK4A 3W0WA 1HOCB 4GSRA 3NCBB 1OWRM 1BCIA 1UQSB 2Y72A 1OOWA 1HCFX 4LLWB 3IF1A 1LEIB 4BD4A 1S9VA 1PLGL 2M1KA 1IIIA 2RIKA 2OL3A 1KGJA 2NLJA 2WWKT 1WF5A 2FHBA 4X4ZA 3AFLA 2GK2A 3KPLA 5T1DH 5MI0C 4KX7A 2GJ6B 3Q6GL 2VGLM 4X4ME 1MY5A 5DC0A 1IAIM 1IFHL 1QWNA 3IU3B 2GJ6D 1KCLA 3LQAC 4JFED 1CGYA 1BW8A 2DTSA 3FB5A 3L5XL 1OV8A 4UT6H 3MREB 5EC2B 1T1ZA 5I18L 3OXRB 4YOKA 4UQ2A 1HQ4B 4CN6A 2KT6A 3KNBA 1T5WA 3D85A 4N25A 5J13B 4N0YL 3HR5A 4UDTA 2SEBA 4L3AA 4YPGA 1N0XL 1HYSD 4I89A 4ZD3L 3K2UL 1L9NA 3C8HA 1WE5A 5AW5B 3BFWA 3QUKB 4KTEL 3KG5A 2V2TB 1BYOA 1U93B 3JTTA 2WUBL 2LT9A 4JM2D 2NR6A 1OAQH 1X5KA 3D2UA 4DAGL 5B39A 3Q2NA 3K6SB 5DA4A 1NIEA 3PNRB 4O2CA 4F15C 5KSAB 1B4RA 4BZ1L 1W15A 4Z7QF 3DHPA 3BKCH 4XN2A 2AHIA 1IQDB 2JK5A 5L6YH 4POZD 5JQ6H 5HHVL 1J0IA 3VWJB 3OGCB 3NVQA 2Q7YB 4X8GA 5EEXA 4DQOL 2OJEA 2XQBL 3GMOB 5LQBH 1JZ6A 2F61A 3QEHB 1UWYA 2GY5A 3ELQA 4QXWA 4HEME 3G6AB 1OLLA 1UZGA 2NY4B 4WEBH 1SQ2N 3ZKXC 2Q1EA 3ZGHA 4DH2A 4JFTA 4FABL 4MRCA 1IGCL 2NY4D 3FB8A 4JO1H 4LSSL 1L9MA 2J8UA 4WFHD 2P28B 3BYYA 2I9TB 3AY4C 4QNPE 4YHZL 3LRGA 3QFGA 1USQA 1I9IH 4I87A 1WCBB 2YOCA 3VQ2C 1F2XK 1U41A 3O2WL 4AE0A 5BO0D 5M95B 4RX4D 2SODB 5FYLD 3ETBF 4I0PC 1U8IB 1CLYH 4RMWA 5FYLH 1QOKA 4PP2A 5IVZB 1J11A 3D50A 2JV6A 3B4NA 3CFIC 3E38A 5EUKB 1U8LB 4D0CB 3SGDH 4WWID 4NP4L 3T65A 4CVZA 4WU7B 1HHKB 2EDNA 5FWRA 1JF5A 4WJG3 5C07A 2HX7A 3X14B 3MJ7B 3QO1B 5B1JC 1VA9A 4L3FA 1NGPH 3CG8A 4PEEA 2F53A 2F1AA 1DUYB 3L3KB 4AIOA 4QLRA 1KTJA 3AS2A 4E5XB 1YY8B 4KJWC 4ZMXA 3DJTA 4M7KH 4YSEA 3RFRA 5ACZB 4UAOB 1F90H 3TT1L 8CGTA 1S5HA 3Q5TA 2GEEA 3WFCH 2EDRA 1CU4L 5EBMA 5GSVA 3LXCA 2G2PA 4K94C 5DHVA 1OGAB 2AQ1A 5T5FH 2CM5A 1FVEB 3DX0A 3WN5A 5EF3A 1Y18A 4UMGA 4QRQA 4YSQA 4LASH 3HR6A 1T21A 1MWAB 1H3PL 2WLJA 3QDJD 3KPNA 3ZW3A 4GQ9L 3BZEA 4OB5L 5HP5A 3P0VH 2ADIA 4JKNA 3BO8A 1CVRA 2WZ0A 2KZ1B 3VDCA 4P2RA 3AXIA 3QAZB 3ZT7A 3NSDA 5G2NA 1IVTA 4W9FC 1EXGA 2EIMB 3GKWH 4PUBL 3RWFB 1S7SA 2X2JA 3RFZA 1XT5A 3PHOA 1X9QA 4JFXA 2X1WL 3GS0A 3ZL1A 4HWUA 5JPMC 1I3GH 3O2DL 3D39D 3NFNA 4WO0A 5JW4M 4AYMC 1AXTH 3V6FB 4HK0A 2ZAGA 2E75C 5DURB 3OR7B 3UBXI 2VH5H 4ZW5A 5A7EA 1H15B 3X3FH 2ZUQC 2DQDL 4LOEA 3IS1X 1N3NB 4W9HC 4MB5A 1AR1B 2AZUA 3A0OA 2J88L 4KJYA 5L2KE 4FQQA 3O3EB 3CGTA 2OI9B 4JB9L 3UIYA 5L7XH 4P06A 1AR1D 4LAQL 5CUSH 1DN2A 1DDHA 4JN1L 2OMZA 3QT2A 3PXLA 5EU6D 3KWTA 2XACC 1WRFA 4MJJA 4LNRB 2YPVL 5LO7A 4R0LC 1LK3L 1MCWW 3ALPA 1WIPA 3ILPA 4OLEA 4MDJB 2MPAL 1XVSA 1DSYA 1NCCL 4FNLH 2OYKA 4BCXA 4F2FA 3GO1L 4EBQH 4LDEB 4R5VA 1XGPB 3GF8A 3I75A 4UWQB 4Z3FA 3MI6A 2TSBA 1RQ5A 4N6RA 2AEPH 1YEEL 4D9RD 4AMKH 1XSOA 2Y1YA 1XF1A 4ECNA 3MOBL 4FFYL 1MQKH 1FPTH 2BJML 4GFTB 3O3UN 2K3HA 3AG1B 4IOFD 5FDYA 4YDIL 1A3LL 4M1GH 3EF4A 2HLEB 3UERA 2Y1VA 3OBAA 3MV7B 2BP8A 4AQEB 2AXGA 3LS4H 1ZVSA 3CQQA 3C6EA 1QFWL 2F74B 4Z7QB 5KVGL 1RJZB 5E70A 1FDLH 3VRIB 4AYBA 4GNKB 3MV7D 4QPEA 4JZJB 4CMMB 1F4XH 3PE9A 5EN2B 5HPMB 5LGJB 4NCDA 3MYZA 3BVXA 5TD4A 3GSQA 2PTVA 1NDMB 5IR1B 2J3SA 2IFGA 1A1MA 3QZMA 3E1F1 4AG4L 5FV1L 4L1DA 2XI9A 3KL0A 3HZMA 4X6CF 1NKRA 4UTAH 4TPRH 3SDDC 2ED9A 4M6NH 3CDZA 4FCAA 5C8JB 1W0VB 2IGLA 2Z35A 3G9VA 2UWEA 3QIBB 2XFXA 4L5FH 2BNQE 3HLAB 3IDYB 1UURA 4IBYA 3LZFL 2YSSB 1HWHB 1TZHB 2A5UA 4LLUA 5IEHB 3US9A 1JERA 4NPJA 3K71A 2ZWLT 4WTZA 2B9BA 2Z4QB 4L37A 3T6XA 2WBJC 3MRPA 4NJ9L 3VXPA 3QDGA 4ZFFB 5AUMA 2R4RL 2E27H 4X5XA 2Z9TA 3MTXA 5GGTH 3EHBC 3ECWA 2M2DA 2XWBA 2FSDA 3QFDB 1ZIBA 3B43A 5GRUH 4DPBX 3SDDA 3I3DA 3FSWA 1XGUB 2P26A 2WLHA 6PAZA 2JF1A 4PB9L 2BP3A 5AEAA 3K6OA 1OAKH 1I7UA 2ZP0T 4PJFE 4QJ5B 1RJYA 1U58A 5ICYA 3U6XA 3O3BA 5HHOE 3VMNA 4HLEA 3BUBA 4Y5VA 1INQB 1J0YA 4C56B 3MR9A 3O11B 5JYLA 3MAWA 1PDKA 1YEWA 3CFEA 3BMWA 4WV1C 3RU8L 3GB7A 5HI3C 4X5WA 1XMWA 1MJUH 5A6LA 2RQEA 3LZLA 1UXWA 3MRLB 4JRXB 5D2LB 4AUYA 3FYEB 3CNKA 3HC0A 2DDQL 5GJTH 5E9DD 2ZUTA 2MQCA 2X1XR 3QUZB 4XE5B 5A2KH 1DE4B 5DRZB 4NDMA 4MS6A 5A16B 3UTTB 2J55A 5J8OA 3UAJD 5E00B 3T0EE 4BQBA 1JWMB 3QUZD 5I6PA 3UTTD 1L3NA 4MX7A 1PCSA 3TBVB 2NCEA 5B22A 4LOUD 4G80A 1W8NA 1T83C 5C0CA 4O51A 1VCAA 3ZSSA 4ZMLA 1DQMH 3TYGL 1CGSH 4D8OA 5FB8B 3PWPE 4V33A 3CMOH 3BVUA 5D1ZD 2FWUA 3H9SE 2UZPA 2X4UB 3PWLB 3TNNA 1EJOH 4CNIB 2DLHA 4DEPB 4Q9QL 2YFOA 3L2NA 2UY6B 5C0RL 3QRLA 2G9KA 2FEJA 4CADB 2P5PA 2XQYG 4JFDE 1D2OA 5DEZA 4KAQL 2FBJH 4EKXA 4XBGB 2IFFL 1AG0A 5CN2A 3HA0A 5HDQH 4UQCA 3GRWA 1P6FA 4E0RB 3DURA 1YEDA 1ZA3A 3P2TA 4OCLC 1WPCA 4M1DL 1E5YA 4N26A 2JKSA 4O2FA 3BZ5A 1AQ8A 2XTJB 4IBTA 4JHZA 4S1RL 2Y2YA 3BCFA 3DIFB 5F88A 4NENB 2OMVB 2PW2A 3ULUC 4KOCA 4ZX4A 1U6AH 4YHYC 1QPXA 1A4KB 1JHKH 5ILTH 5TE4H 3MRFA 4HJSA 3WO3B 3ULVC 1T7VA 4DEUA 3VFVA 5JORA 1OAYH 3QDME 3WNIA 4ADJA 5E99L 1X44A 2UZXB 4QF1A 3GS7A 4X9GA 2CO1A 2HFFB 1U8CA 3ILDA 3QQ4B 1M6OA 1S7XA 1XGTB 1MVUA 5E2UL 5JYMA 3P73B 1QLRA 3C5ZC 2HKHL 3V5DB 4J4PD 4PGEA 1U8QA 3G5XA 3TH3T 2X4NB 2O61B 5F1SA 4YDVA 2GIXA 5CMAA 5AVZB 3PDDA 2CIKA 5ESAA 1GCFA 3OWRA 2VABA 4WRLA 3G9AB 3VXUB 2Q9OA 5HJ3B 4DZ8A 5AQ0A 3VXOA 2OL3L 1PKOA 2R83A 1QATA 2EYSA 2NY7L 4PJ7B 2C9SA 1F6AA 4AJ0A 3FPXA 3G5ZA 4NAMA 1LQSR 2OP4H 3SKUD 2IBZY 1A6ZB 2F68X 4PMEA 2MFNA 5DJ0A 3C5ZA 4K7PL 1JN6B 2BSRB 2JKJA 1AGCB 2P80A 5HHME 4BYHA 3IT8D 2ZG2A 4OLZL 3G04B 5I71C 1NINA 4EIUA 1CE6A 4P0DA 1FORH 1B9KA 1KCUL 1ORSB 1ZMYA 2BXYA 2H1PH 2WXOA 3RRQA 2DYSB 4Z7UE 4A55A 4KHXH 5B38A 2XQYK 5F1KC 2FYYA 4X6CB 4ODUB 4U1GB 3FQNB 3MLYH 3VXME 1ZTXL 4XVUC 4PVMA 3I9IA 3LB6C 4YL4A 2CIIB 3D4GA 1VCBC 2OJZH 3P4OB 4KHTH 4R4FL 1G7PA 1I7TB 1RJLB 3NT0A 1X7SA 2W9DL 3OMAB 1JPSH 4W9LC 4HKJA 3DECA 1M56B 2Y07H 2BOCA 4U1IB 3WXWL 3MLXL 4FLQA 2EAEA 5A3IC 3KLAA 3DMMB 2R27A 3MV8A 4L4TB 3RUGF 4AIXA 1DJGA 4ZTOL 1EO8H 4HIJA 1DVFA 3L5IA 3MGTB 4LBAA 1FN4B 5B7FA 3UADA 3A5VA 4JANA 3PWJB 1GGIH 3SDCC 1HESA 4UIKH 4MDRA 4ELDA 1RZGB 3QQ9C 4G6JH 5GIRB 2DWTA 1JPGB 2YD0A 4HGMA 4NUMA 1NBYA 2AXFB 1SDDA 1E4WL 3B34A 1KBPA 3PQYA 2WLMA 35C8H 4FHBD 4MA8L 4YXKL 2GI7A 2CLRB 5AW3B 1AI1L 2WC7A 2XJKA 1TMCB 4ZFZA 5LBGA 4AMXA 1ZV5A 4BH7B 2WINA 3AXHA 3BP4A 5EZPA 3NMEA 3RTLA 1IL1A 1D6EB 3IFPB 3TJHC 4F7MA 3MV9D 2G4GA 4LVOB 4H0LC 4XMXA 3T2QA 3SDCA 3ZE0F 4ABQA 1MPAH 3C6SB 3Q9PA 4HIIB 4PWGA 3NPSC 3FUJA 3NZ8A 3SPVA 1VSCA 2IO5A 2CDFA 4AGOA 5ISZA 5TFSH 5BQ7A 2X4RA 2WHVA 4JQIL 1AGBA 3SKMB 2F8XC 3S2AA 1J9TA 4H7VA 5FYKE 3RZCA 2WBWB 2PXYD 4NUJB 1U3JA 2EDBA 2VOTA 4JKLA 1LILA 5DMKB 4I77L 4P04A 43CAA 4HEPG 3BEWA 4UNTA 3APDA 5E6YA 3ARFC 1SDYA 2D03H 4PGDB 4XTRD 1VF5C 3CHPA 4RMTA 4XX5A 2WQAA 2HT4C 3FT3B 5F3HA 4HUWA 1JD7A 2FX7L 2EDTA 4UV7H 2I5YH 1LE5A 3M1BA 1UACL 5I1LB 5J9PA 3U6RB 3HFMH 1FBIL 1A22B 2D7MA 2P8MA 1SEQH 2YPLA 1XEDA 3V4UL 3MXWL 4YO0A 3C60C 5AYUL 5BUPA 2IDSA 2CO4A 4HIEA 4OF7A 3WJJC 5MP6L 2EDLA 4P59H 4QMEA 4XXDA 3CFQA 4ABVA 2QADD 4KV5E 5IEKB 2V8MA 4HJ0D 2WKOA 1MCHA 3U2SB 4LSPL 4BHUA 2JQMA 1IBZA 4M93B 5CSZA 3GSNA 3RVVD 5KUKA 3SY6A 3K46A 1YCSA 2AQTA 2V7NB 1JPFB 1SMDA 2ZUYA 4OJYA 5H37H 1OTUD 2XC8A 2J1XA 4QKXB 5E1AB 1V3KA 3EOAA 3BRFA 5FYJU 3V0DA 4Z7OF 1MNNA 3OKLB 3M07A 1FE8H 2ZXGA 1AHMA 3FT9A 1TFHA 3Q6GH 1JSYA 3DXAE 4L8BA 3IMUA 4FC3E 2Q6WA 1EIBA 1I8MA 1IARB 2FUTA 2VN7A 3LXAA 4XVJH 1CK0L 4OY9A 4FHKA 3MLZL 4G43A 4KNTA 5E6IB 2L04A 3HE7A 3HJ0A 5EIIG 2VZTA 2AABL 1V7MH 5KOMC 2X40A 5E6ID 3SCMD 1RLWA 1PCXA 4N9OB 4N0YH 8PAZA 4F7PA 4GAJL 3N06B 4HC1A 1NDGA 3KJ6H 1N0XH 1CLZH 3K2UH 3BMVA 1XSIA 3ENEA 5LWYH 4F7TB 5SWQB 3SKOA 3A4FA 2XVKA 4OZHE 2GC7C 2ZICA 4Z77B 3HPJB 1CFNB 4IS6B 4G7QB 1KY7A 5D1XB 4DAGH 3FMGH 4XNZB 3H0TA 3VH8B 3WMPA 3U7YH 1GZQA 2Q2LA 3PIQA 1OM3L 4NO2A 5D1XD 2NMSA 4NBZB 5DD6B 4ENZA 3UABA 3JBG7 3BUQA 1KJ3L 3GDCA 2ZXDA 5DJDA 1IGFL 4NC1E 4CC0A 5E5MA 4XP9L 3GRGA 1MZYA 1U8OA 2PP7A 2Y7LA 3A6OA 1YMMB 4YHLL 1AP2B 2FQDA 4MMZA 5AW4B 1RXLA 5AKSA 4QHKJ 4LLDB 1T20B 4HQQH 4RMUA 3RUGB 3PREA 4QI3A 3RY4A 2H6OA 3C5JA 3KPQB 4PWHA 1M57B 4ZPVB 2Z7WA 3QI9D 2CRMA 2YHGA 1BXUA 1NEPA 4PBDA 4S11A 2OMBA 2IWFA 4QXUL 3BW9B 4LSSH 4YSPA 3BGMB 5B3JE 2FIKA 3II1A