1D2PA

Crystal structure of two b repeat units (b1b2) of the collagen binding protein (cna) of staphylococcus aureus
Total Genus 92
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
92
sequence length
373
structure length
373
Chain Sequence
ETTSSIGEKVWDDKDNQDGKRPEKVSVNLLANGEKVKTLDVTSETNWKYEFKDLPKYDEGKKIEYTVTEDHVKDYTTDINGTTITNKYTPGETSATVTKNWDDNNNQDGKRPTEIKVELYQDGKATGKTAILNESNNWTHTWTGLDEKAKGQQVKYTVEELTKVKGYTTHVDNNDMGNLITTNKYTPETTSSIGEKVWDDKDNQDGKRPEKVSVNLLANGEKVKTLDVTSETNWKYEFKDLPKYDEGKKIEYTVTEDHVKDYTTDINGTTITNKYTPGETSATVTKNWDDNNNQDGKRPTEIKVELYQDGKATGKTAILNESNNWTHTWTGLDEKAKGQQVKYTVEELTKVKGYTTHVDNNDMGNLITTNKYT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Novel fold and assembly of the repetitive B region of the Staphylococcus aureus collagen-binding surface protein.
pubmed doi rcsb
source organism Staphylococcus aureus
molecule tags Structural protein
molecule keywords COLLAGEN ADHESIN
total genus 92
structure length 373
sequence length 373
ec nomenclature
pdb deposition date 1999-09-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF05738 Cna_B Cna protein B-type domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1140 Mainly Beta Sandwich Immunoglobulin-like Collagen-binding surface protein Cna, B-type domain 1d2pA01
2.60.40.1140 Mainly Beta Sandwich Immunoglobulin-like Collagen-binding surface protein Cna, B-type domain 1d2pA03
2.60.40.1140 Mainly Beta Sandwich Immunoglobulin-like Collagen-binding surface protein Cna, B-type domain 1d2pA02
2.60.40.1140 Mainly Beta Sandwich Immunoglobulin-like Collagen-binding surface protein Cna, B-type domain 1d2pA04
3GLEA 2X9XA 2X9WA 3B2MA 3GLDA 4BUGA 2XTLA 1D2OA 2Y1VA 2XIDA 1D2PA 2X9YA 3RPKA 2X9ZA 2XICA
chains in the Genus database with same CATH superfamily
4F57H 2FEDD 4LU5L 4FL4C 1HL5A 3HZ3A 1UA6L 4YO0A 1E9PA 3ATDA 1BXVA 3S3BB 1RIUH 4OGAC 4QRBA 1T83A 4KI5D 5I19L 3RQ3A 3BH9B 1YAZA 4NHCL 1IKFH 3H53A 1G6RB 4LCIL 3ME0B 3TT1H 1KCKA 3S34H 4NM4H 2A77L 5H2BB 1RHFA 4ZUSA 3BKCH 1AFVL 2CPUA 4FQLH 1BP3B 4ODSH 1KSRA 5AUMB 5CMAB 2FDBP 5CJOL 4RMBA 2VDPL 2KC0A 2EDMA 3B2VL 1CVSC 1FGNL 3F62A 1OO2A 4Z7VA 3AT8A 5EEZA 1PZ3A 2GK2A 1UZ6E 4UT7L 5IVXE 1BZ9B 1CFSB 1OALA 3H0TA 5L2KA 4PJHE 1KCVL 2AQ3A 1CDBA 3V4PH 4DP0X 4RGMC 2Z31C 3BW9A 4BSVB 2YAFA 4NX0A 2IAMA 2ROYA 3F5WB 2VM9A 3QUKA 4Z3GA 4O02L 4TLUA 5J13B 1P7HL 1M7XA 1YEIL 3D1MC 4NQED 2BX5A 4BRVA 5E1AB 1KGXA 4GW1B 2IQAB 3K2MC 1N12A 1K2DA 4LL4A 4QKXB 1KIRB 2NY4D 4CC0A 3FFCA 3H9SE 1BLIA 1YPZE 2MCPL 2VMJA 2LU5A 2K6ZA 6CGTA 5HYQB 3WKPA 3Q2CA 2VDNL 2R1XB 5F93C 1WIPA 2MFNA 4HJSA 3S98A 1JZJA 3QFDA 4Z7OB 1CFBA 4PJEA 3ECBB 4NRZB 3O3BA 3D0VB 4QHMB 5C0BD 3BAEH 4OQTL 3DOSB 2QLYA 4ODXB 5D5MF 3AUVA 1U41A 4X7TB 1X9QA 5CGBA 2FBJL 5DSCB 5LAXB 1HHJA 1DQJB 1ITBB 3QDHA 4XH2B 4GKSB 1S9KC 3RFRA 2R8SH 1I7RA 5FOBA 3C8HA 2PTUA 3L9RA 4UOW0 4YLQT 3VXQA 1U8PA 3G6JB 4N2AA 3OAUH 3S97C 3G5YB 5FM5M 3OGCB 4AM0Q 1KTCA 1UUSA 3IU4H 4P57A 5KJRL 3DRTB 5HHQA 4HIXH 2DQCL 2H3NB 2J25A 1D9KA 2RMNA 2ZP0T 1YNKH 3L3IB 1M57B 2F74A 2DQ6A 4Z95L 3IF1A 3ARXA 3BIKA 3WJLA 2VLJE 3A6BL 4J3BA 3EUDA 4QCIB 3UEQA 1V3KA 3PUUA 3DYOA 5IW3A 4ANWA 5I9QC 3WKNA 2OMNA 2CH8A 4KUCF 2WXHA 1KZYA 2DWDB 4CMMA 3EOTL 1QX1A 2P5WD 3TLRA 3L3GB 2DBJA 1KBBA 4PY8I 3WUZA 4NHUB 3ZXAC 3DRQB 1XVSA 1PD0A 4IJTA 3WS3A 2LOEA 4RFEB 3JTBA 3UZVA 1JPTH 1FVCA 2J1WA 3BN3B 4J6RH 1PDKB 4LEBA 5JPNC 1KB9K 3B43A 2WTOA 2X44D 3FQTB 3OF6A 4IKJA 4PJ9D 5HDQH 2A9AA 2EXYC 1VEMA 4CMHC 3MUGB 5JPNA 4PJEE 1FZJA 3C12A 1JWSB 3EDDA 3BH9A 1DYZA 4ZUWB 4PGBB 2BVUA 3UTSD 2PTTA 4XP6H 3TWCL 4AIXA 5AOIA 2HKHL 3IDGB 4ZW3A 2I32A 3B9VA 4I77L 1ESOA 3HNVL 1A9BA 2HH0L 4FQXD 3TXAA 5DYFA 2YXVA 4OF7A 4PTTB 4S2SB 3BZEA 1B9ZA 2HT2D 4B9YA 3P3UA 2L0DA 5I66A 2R1YA 3CX5J 2BSRA 2JKXA 5DR5L 5C0AD 1BQ5A 1PPIA 1UURA 1O7DE 1AXIB 5FO7B 3WIHA 3IDGA 4PJ5A 2A9ML 4ABVA 2ATKB 4X98A 3F7YA 1IGFL 1ZIBA 2RACA 3AITA 4QGTA 2GY5A 5L88H 3V0GA 1ZTXL 1BCIA 4TQ8A 4FZEH 1IQDA 25C8L 2OTWA 2WZ0A 3MLVL 4U3SB 3KPSD 5DC0A 3OB8A 1RZGA 2HB0A 2QPDB 5BV7H 4XPAL 3GMQA 5AW5B 1TITA 4NUPA 5IV2B 3JV6B 1RURH 2BSED 3FOMB 4F2EA 1NCIA 2AEWA 3OR6A 4A2LA 4ETQA 1BZ7A 4TQPA 4YDMA 3KJ4C 4Q52A 1E4XL 5F6IC 2QSTA 2C7UB 1PG7H 3FT1A 3P0YH 3TCXA 1OTTC 4PEEA 1T5KA 1SJHB 2ZX9A 4TF4A 1A47A 2E7LA 1AQDB 5CXPA 4A6YH 2AF2A 3FB6A 4Y5XB 1LK2A 3LZNA 2ZYRA 5A16A 4PJXA 4XHQA 1OGSA 1RUML 5J57B 2IEPA 5DTFA 2UWEA 2ZKWA 2AW2A 2O6DA 2WPGA 1FN4A 2YGNA 2ODIA 1CLYH 2NY1D 2ARJA 3VG9B 4RSVA 1N6UA 1ZS8B 1AD9B 1G84A 3WIFB 3IFLL 2YFOA 5IM7A 2NCMA 3P73A 4GUPB 3NCWA 2R69A 4CC4A 4WWPA 2H47C 5KSAC 4BRJA 4BE5A 4XH2A 3UJJL 2VDOL 2KL6A 2ROXA 3ISYA 3RZCC 2FX8L 3NJGA 3QAZC 4NZFA 3CZKA 4U1LB 4C4BA 1K8DB 1T5WB 5E1GA 5L8LB 4N0UE 4LVNB 2XWJA 3IMRA 3N55A 3TO2A 3R7RA 2YAOA 2ADGB 3QZNA 2YPLE 5D70L 5EOTB 1E4WH 1KBGL 2YBRA 4HZAA 3TA4D 4P2RB 1OHZA 2J7LA 2ZOTA 3L5XL 5I1CL 2CRMA 2JJVA 3QEHA 4LLQA 5DO2C 5IJVA 3KS0H 4ZO8A 3IJEA 1VGEH 2QVFB 4NZRL 5LXGL 4GG6E 4DFHA 1JGVL 3VWKD 3A6OA 4Z9KB 2KYIA 2WYIA 1VFAA 3FCTB 4PBWD 4WRLA 1JZDC 2Z93B 4LL1A 5INDA 5B8CC 1SHWA 5B38A 3GXTA 3LZQA 3GS4A 4KHTH 1V05A 5HI3D 1MJJB 1U93A 1PY0A 2VDQL 4K7FA 3V7MA 2JKRM 2JB6A 3ZRSA 2A38A 3IMBA 5IM7B 5D71H 3P30L 5MHSE 3GMNB 4HGKC 2Q76B 2OMVB 1UM4L 5LO7A 2K78A 1I53A 1JFQH 1HILB 1CE6A 5K39A 5DVPA 2Q8AH 3U9PH 2F8VA 2P52A 3VXSB 3H3BC 1SRDA 5GGUA 5CLWA 3SKJL 2B39A 1WZAA 1SYSB 3K81A 1CTOA 1Q8MA 4C56D 2FEJA 4APQB 2J72A 3NIDB 1QFUL 2CQVA 5D7JA 1KTLA 4HUWA 3MLWH 4O2CB 4F15B 4BH8A 1OSYA 4LDEB 2NW2B 1TTUA 4XX1G 1IIKA 3RLSA 2R1WA 3Q2VA 2YJQA 1XGPA 3QORB 4X5XA 5DJ6B 3QIBD 3VD1A 5D7SL 2WVTA 3BCFA 1FNGA 1OE2A 3GEFA 3C87A 3JWOC 1CK0H 4H25A 3MCLH 4FD0A 3BXNB 1LXMA 1ADQH 1ZV2A 2IVFC 4XXWC 2DWDA 1HH9B 2JB5H 1IBFA 4JZOB 3SHSA 1JZIA 5DEGB 3ZR5A 1W72L 4RVBA 4MTMA 3PRZA 4G6FD 3TA3C 4DGVH 1UVQB 3QNYB 3CLFL 3GTTA 1MW3A 5E5MA 4HBCH 5HDBB 2YKKA 2X89A 3KPNA 4PH8A 4YHKH 4ELMF 2DI9A 4F7MB 1IUZA 4Y2DA 5HYSA 3MA9H 4P4KA 4HVBA 2YD5A 3WDIA 3OC8A 3IDNB 3L1OH 1A4KB 3EDJA 4PJHB 2WO4A 3UBHA 1OSEA 4DO5A 1K5NB 3FN3A 3BVNA 1JJUA 2F61A 5EU5A 1T1YB 2XTJE 1AO7D 1M71A 1UWEH 3HB3B 5CIPB 4W9DC 3UCRA 5LLIC 1UD2A 1FVDB 4QXGH 1G7MA 1P7KB 5T8IA 4ICXA 1OOWA 3QXWA 1EO5A 1I9JH 2BNQE 2H6OA 2QGEA 5FUOL 2OXHA 5I28A 1AC6A 4MS8D 1GC1H 1Q9OA 1YCSA 1LYQA 2X2HA 3IXTA 3WN5C 4QJ3B 4L9LA 3FFDB 1PMYA 2CCVA 4G82A 4G43A 1DUZA 3O41B 4UNVA 1IV8A 3FU5A 5I23A 3B2XA 4G42A 5F72S 3WE6B 3ZZSA 2DIJA 2R7EB 3SQOL 5IVNA 2WZ6A 1D5IL 1KY6A 5C86A 1KELH 1QLEL 2UZPA 3SKMA 1T22B 3UG3A 3HPJA 1W8OA 3MLPA 2AP2A 1DVFC 1V7MH 5AVQB 3KYNA 1WD9A 4L37B 2VISB 3QXDB 3PV6B 4ZFZA 1D2OA 5FA3B 3W11C 5F1SA 1XCQB 4ZNEA 3VQ2C 4K8RH 5CEXB 1YNTA 3CVHA 5E8NB 2JFCA 3MLSL 5CJ5A 1MLBA 1F6LL 1NCWH 3CQQA 4HD5A 4NFBA 4R8WL 4QHKJ 3ARQA 3HR5A 3CFIC 1J9RA 4NUGH 3S35H 5EBLA 1MW1A 2EABA 2WZ5A 4K8RD 1LO2H 1MFBH 3QE5A 4NQCE 4RAUA 4AGNA 4V11A 1ZT1A 1GZPB 1MFUA 2H0PA 1NCUA 1FNSL 1UB6A 2XFXA 3KEHA 1XR8A 2PXYA 3MRGB 4E36A 2PP9A 5CCGE 5B1AB 3WNJA 4G8EB 4IOIB 4DGWC 4E42B 2FT7A 4FNPA 2VSCA 5EZIL 1HL4A 2X87A 1TKWA 3I9GH 3L9RB 5HHQB 5KBNC 4GIAA 4X9HA 2WUCL 3V4VB 2AHIA 1HH6B 4P5RA 1PLGH 3BUIA 4FTVB 4LLYA 2V2XA 3HHSA 4JFDE 4KY2A 4YHZH 3EJRA 4UYQA 3U46B 1DJWA 3MA7A 2VXUH 1U6AL 3P4OB 4Y88A 4BWUA 3MOBH 1ACCA 1NPNA 1VLXA 2OR9L 1HAUA 2CAKA 3BDYL 3AXIA 3SE4A 2RBLA 3FUMA 3T0EB 1HI6A 3RWGB 1I1YA 5AZEL 3SE4C 3PDOB 3TGXA 1OCWL 2BVOA 3LB6C 5FUCE 3IJHA 4WI6A 4YDKH 2DZEA 4PGDA 3SJVA 4ZYKA 1XMWA 2DRUA 3GO1H 4KK5C 3D0LB 4OCRH 3QIWB 4CKVX 3LXCA 3HE7B 4Q4EA 5HYFA 3THMH 3EO1A 3M1CA 4GW1A 2DLTA 3EZJB 1KV7A 1E5ZA 3FOLA 5SWZE 3JBG7 1RY7B 1ROWA 4S0TD 3GZKA 1N68A 4UMSA 3ESNA 3DOHA 2F1BA 1JS4A 1KXVA 4OTXH 1SLWA 3VXSD 1NAKL 2PWFA 4F27A 2F5AL 3DBXB 3HG5A 4HALA 3ZTNL 2HT3C 1H8NA 5FYKD 4LCVA 1FDLH 1XF2A 1HHIA 4GFXA 4PRAA 4XOEA 2EKSA 2HT4C 3NFSL 1KY7A 2RCSH 3PGFH 3LMJL 5GXBB 1PTZA 1MIEL 5IHZB 1EHLL 4HHAA 2OL3A 3MYZA 4A68A 3EYVB 4K94L 2J1YA 4L4TD 3B2VH 4U3SA 1RZ8B 2W1NA 1G0XA 4PRPA 4IMKC 3OBAA 3TZVA 4TNEA 1PVHA 3VJ6B 3PPEA 3G5WA 4MKTA 4QO1B 5GS0C 4W9EC 4A55A 4J5VA 2Y69B 4JFSA 4WTZA 1UKTA 4OLUH 5CP3A 1TJMA 3TBYB 1HT6A 3PWLA 4IGBB 4OJAA 4A63A 1LTXA 1B0GB 4H0LC 3HC2A 4QT5A 1G6RH 1I3GL 1PU0A 2N7BA 5IW6A 5IBLC 4BINA 1V5JA 3LPWA 1CGSH 1E50A 3LH9A 1WZLA 2J12B 3MRRB 4PJ9A 2X4PB 5ITBL 3FHQA 4M4PA 1ZA6B 2QVMA 4PJ7B 4BM7A 3BZ5A 4QXVA 4Y1AE 2O6PA 4BKSC 1F11A 1O75A 5DUBB 4Z7NE 3PPSA 3ZGIA 5GHWH 1BEYL 5I1GH 3WY2A 4L05A 35C8L 3C6LC 2VDOB 3MUGA 4X6FB 5IVOA 1RVFL 2FBJH 3D48R 3NEEA 3X3FL 4EE2A 5FR3A 1TETL 2EDTA 4ATWA 4UM9A 4NJ9H 5ICZB 4U7KA 3I6KA 4KRPD 2HLFD 1FH5L 2G2RB 5B1JC 2Z91B 3IFOB 3VG9C 5HHXH 3ARBB 3EGDB 4N90E 1AHKA 2ZXEB 3BT0A 3QISA 2V17H 4NP4L 2GEEA 3JT2A 4AV5A 2L3BA 3APNA 2PR4L 3NZSA 2ADFL 4M1GL 4S1QL 4YSSA 2O6EA 3DJRA 3EJYC 4PY8J 4UTAL 5D2NE 1O7DC 1LE9B 1RD6A 5BO0D 2OX5B 2ZSVA 1VEPA 2YRBA 2WZAA 3HPJB 3MREA 4JL1A 4A7QA 3RKDD 3A4EA 1KC5L 4MA7H 2IAMC 3MV9E 3Q8EA 4HDIA 3P4LA 4TUOA 3NTCH 3TO4D 5I24A 1D7DA 4KHXH 3SDAB 2F15A 3MA7B 3U2JA 4BH7B 4ACPA 2FL5A 5LBSH 5FW7A 2X28A 4I2XE 1VFBA 2BO0A 5DMKA 3PHAA 1A3RL 2BY3A 1ZIAA 2NLJB 2P1YA 2PWDA 2BZCA 5EC1A 3EH5B 5AW4B 5SV3A 1MCRA 3N42B 1I7UA 3N1QC 1X4XA 4P5KB 5ISZA 4J6RL 3CCHA 1TQBC 2EIDA 2G5BB 5HD8C 4O9HH 2YD4A 4KKRA 2QFRA 2O4EA 3OHXB 4U1NA 2MOVA 2Z8RA 4XXDB 5ICYA 2AK4D 4LP8A 4Z7QB 2W91A 2VLLB 1NCBL 1KYOJ 2IAMD 4D9RE 4U1GB 1ZHLA 2JTDA 1RULH 3V6OC 4FG4A 3GLEA 4XMWA 1S9WB 2W65B 3K8LA 5TQ2L 1AC0A 4GPVA 3OXRA 3AACA 4NQCB 4XAWH 4C83A 4NKDA 3U1QA 2IADB 5GS2D 4L3EA 4F7PB 1S5HB 1X5IA 2JK5A 2XIDA 3PJNA 1WAPA 4Y89A 3RWJB 1EO7A 1Q0EA 1DP0A 2HJKA 2J8UB 4PGEB 1IJ9A 2HFFB 5C0GB 3LRMA 1LLAA 1L7TH 4L4VA 3B4NA 4RGNB 2OULB 3GM0A 4L5FH 1X7SA 4J4PA 1Z1WA 1DQVA 3QIUB 4P4KD 4WZ9A 4P2QA 1F4XL 4ZTEA 3HUJE 4FNRA 2BMKA 3QULA 3GHPA 2UV3A 4DZ8B 4ELME 1YNLL 4KTYA 2RD0A 5T3ZH 4KZDL 1TTCA 4CVZA 1UXLA 3D4ZA 3IS1X 5E24E 1HKLL 1ZVNA 3V8CA 1DVXA 5IHLB 3UTTD 4APQD 5D8JH 3WO4C 4UIKL 3BPOC 3TBVB 2YPVL 3DYMA 3L81A 3IAPA 5T3ZD 5JIMA 1PQZA 3BSZA 3QHFL 3O6LH 4UTCA 2P7TB 4NKMB 1AVAA 2EVHA 1OAYH 4C47A 5IGXL 1MJJA 5FYLL 4OVVA 3W38A 3AM8A 1O9WA 3MRCB 1FH2A 4K3EL 3FU9A 1OWWA 4O51A 1WA1X 4OD2B 4WW2F 4WI0A 1KGYE 1XXFC 3QRGL 5HGHA 1OD9A 4OZHE 2C4FU 2AJ3B 1NEPA 1UTDA 4F8QA 3Q8CA 4M7KL 1U42A 4CU7A 2AK4A 4A7VA 5HPMA 3EYSH 4LSQL 2MIZA 5AAMA 4OIIH 2G9HB 4M9PA 5HJ3A 4LGRB 2JSFA 4HWBH 4MDIB 4MJ4A 1T1XB 2ZX6A 3C2SA 3X1EA 5HXMA 3PWVB 3OZKA 3SB3A 1H0DB 4QAMB 5FB8B 2QEJA 5C08A 1WK0A 3K6DA 2VZSA 3VFRA 2BOBB 3IAGC 1MCFA 4P2RD 2YKLL 4PJ8D 2GUOA 4QUOA 4BA8A 2VN3A 2R1WB 5BS0D 3QRFM 3CZSA 4MQTB 1BD2B 4KH9A 3DKHA 3HG1B 2VO8A 1S3KL 3VFVA 2PO6B 1FIGL 1CL7I 3MRKB 3U7WL 3ARED 1HWHB 2XN1A 4ZXBB 2FLBT 5HJDA 4AMKL 3IDYB 4U31A 4D8PB 2FZ3B 4BKLA 2XN2A 1LQSR 4HOZA 2IANE 3WOVA 1KJ3L 1ZVYA 2DS4A 1CE6B 1UM5H 2FEDC 1CGUA 4JFDB 2VC2B 3RIFF 4AGOA 3N41F 2ZOOA 2ARJB 2P24A 2I60L 4PPTA 5IMOB 3ROLA 2BIMA 1KJMA 3C6EA 2WNXA 4LF3A 1H5BA 4PJ5D 1A14H 4XC1H 1P9MA 3DJZA 4GINA 4XNAA 4ZXBA 2OTPA 4H1LA 5F8QC 2DPKA 5BUAA 3FQYA 1YEKL 4PJXB 2KZKA 1IAKA 4PRAB 3U1SH 1AXSA 2A99A 3OPUA 3ALXA 2ZT9C 1BZEA 1CZ8L 1X6NA 3F58L 1R5VA 2XZQH 3QUML 1DJGA 3HI6L 1KCSL 2K7PA 4NOBA 3EBGA 2D73A 3REVB 3IFNH 4P46B 4PW3A 5MEQA 3ZHLA 5K59E 4UM8A 1B4JL 5IBTH 4M3KB 4HHWA 1DJYA 1N67A 4LIQL 3K4AA 32C2B 2MNJB 1J5OH 1PAZA 1A6PA 4UT6A 1KC5H 3MODL 4J3VA 2NY0C 3QUZC 3MRBA 3VXTA 2AJUL 2WQUA 4JRYD 1MCJA 4NPJA 4PJBF 3SDDC 3RZCA 3L9BA 3NIFF 3OXRB 1TVBA 3WFHB 1KIUA 4RAVA 1EK3A 3QI9D 1FGVH 3FTSA 3DPBA 2WUBH 5TPWH 3X12B 3BN9D 4PM1A 3VFNB 1RZQA 4ODWA 3EW3B 5E2JA 3CN2A 4F9LC 3M8OH 1UYWH 5MENE 3OGCA 1UFGA 1Z9PA 3VYPA 2G30A 2L7EA 1IL1B 3I75A 1WCBA 4OF3A 1QRND 1R0AL 4UDTB 2VC2H 1IKFL 4APXB 5FYJH 2QKIC 2D2OA 3I3EA 2YRLA 3AY2A 1J5DA 1TQUA 1OAKL 2CM6A 3AREA 5I18H 4KXDA 4A38A 2VITB 3UYPB 4ZI8A 5CHNB 3U2SB 2LAAA 1IC4L 1EERB 4TSAL 5LCVL 3WI9A 1FYTB 4HV8A 2OW7A 3QULB 3IN0A 5AZUA 5HHMD 2YD3A 5ABAA 3TYFA 3ULSA 3ZL4L 3BUBA 4Z7UA 1S7TB 2BSBA 5B7EA 3V5HA 3G7TA 7TAAA 43C9A 4WSKA 3QCVL 4AYDC 4CNIA 4GAJH 2WYZA 1KMGA 1JPFA 5EV7A 1A8JH 1K8IA 4S1RL 2CHXA 3U36B 2DQIH 3D69A 3M17A 3MRJB 5KEZA 4HKBA 2HWZH 4P2OC 3CN4A 4GUCA 4PJAF 3VGEA 5T33L 2XTJB 4CMMB 5E6ID 4AV4A 5J1SC 1P0SE 2ZF9A 2APFA 3F7VB 3LHPL 5IFJB 3F5WA 4BUQA 4Z3EA 1E90A 4HMDA 3CX5K 1CDHA 2OL3H 2FR4A 1N6QL 3MBXL 1AS8A 3KR3H 3X14B 3QUGA 1S9WA 3IFPB 3RKPA 4LKXA 2FWUA 1T1ZA 1JERA 2BNQD 2X10A 4B27A 2VWEC 5T1LB 4C4KO 2IOIA 4NM8L 5SV4A 2ED9A 3Q3GB 1R1CA 2FX7H 2IFFH 3U7YL 2R7EA 4TNGA 4RWHA 2YXFA 1N18A 3BSHA 5IW6B 2IPUG 1OM9A 1KOAA 5EUOA 4PJHF 2H0EA 3CLEH 4U1MA 1DQTA 1F11B 2HT4D 1FAIH 1FSKC 3ZKXC 4JM4L 4FMKA 4MNQB 1G7HA 3Q0HA 3HG1A 3IYLW 3CIQA 3CK0L 1DVYA 4AY0A 4OFQA 2EH8H 4NFCA 1INDL 4WUUA 4GBXB 3S36X 4JGMA 3SGKA 1UD8A 4WO4B 4X5PA 5KVMC 5ANHA 2J73A 3VRLF 1F6AA 2K45A 5ERWA 1D6VH 4DP4X 1SZNA 1X6LA 1CICB 1YLBB 2VW4A 3NQIA 3EO0B 3QIBC 4HF5H 4KH2A 5AW2B 4EIZC 3QDAA 3IU4L 3TOPA 3RWIB 4N26A 5CWSA 4YFEA 5FK9A 3EGSB 4P59L 1YO4A 4WTXA 3GSQA 5KZCB 3H54A 3RB7A 5J56B 3ARBC 5IMLB 1HKLH 1ZLVK 1Z0MA 1MJUL 5EOQH 4KXAA 1JYXA 2OAAA 3A47A 4KX8A 2R29A 5I71B 3C5ZD 3G6JE 1RUKL 3P9MB 2BZDA 3VYNA 2EXWD 1KPVB 2A77H 2K0RA 2ZJSL 2X1XR 4JRYA 5TF0A 1NCCH 1FVEA 1AIFA 1JF5A 2WK2A 1UWGL 2DB8A 2D3NA 1U8HA 1XD0A 3CBJB 4OIAA 2DKMA 4FFZA 4HS8H 1AO7A 4PJBE 3HMXA 4KMTL 4MMXC 5E2TL 1NPJA 2NNXA 3EXLA 4NP9A 5JXEC 3LH2H 2Q6WB 5EU6E 3SDAC 4WVRA 1FC2D 4KTGA 4FZ8H 5IJDC 1TG8A 1CGYA 1WVZA 2EEDA 3MJ9L 4BKLB 1A66A 4U6XB 4AVKA 3PHOA 1GAFH 3FSOA 5D7IF 1K3ZA 3L6FB 3HG0A 3IJHB 5H94B 4QIRA 1DJSA 2GKIA 2J6EL 2FGWL 3CSTA 1L6PA 5HGDA 4IDJH 4N24A 2AITA 1G94A 4RMWA 1LJMA 5LQBH 4QEGA 2BWIA 3PDDA 4KKLD 1QP1A 3NEXA 1GYUA 2NY3B 4KO7A 4GRWB 1BMWA 4PP2A 4KO6A 5GRYA 1A6ZA 7PCYA 1XHHA 1I1YB 2IH1B 3SGJC 5C6TL 3PWLB 4N1HB 5L6YL 3BI9X 5F0JB 1ZT7A 1N7MH 5GISL 2DOCA 3D2UA 2MQ0A 5HDRA 5C3TA 5HJ3B 3WMQA 3ES6A 3CHXA 1BHGA 2BOCA 3N43B 4HJJH 2OZ4A 4UAHA 1CFNA 2IH8A 4EO5A 2CCLA 2WWKO 2YBRB 3OF6D 4XTRC 1REIA 3DDFA 1AR1D 3V0WH 3H9SB 4JDVB 4TL4A 1UB5B 2B14A 1G4MA 12E8L 3GBNL 1TNMA 5TDPB 3UTTA 1ZJAA 3BP7B 3MV9B 3WAKA 5E8PA 1XIWA 3HC4H 5DRXA 3Q5OA 4BZ2H 2WXIA 4D0DA 4OD1H 3F7PC 4FS0A 1EVUA 3IDXL 1J8HB 2OV0A 2H45A 2JKSA 3FO0L 1DJZA 4Y4FC 2DQCH 3LRHA 4JY6B 2X9ZA 2IWGA 4ZMVA 1A3LH 1U0QA 4N1EA 4Y2OA 1QWUA 3TEYA 5K9QI 3GDCA 1VIWA 2CO7A 1KDIA 5AOMA 3PDGA 4DGYH 3RY4A 4K9EH 4GRMA 1X5GA 3VE0B 5KBMA 2E6PA 4KRMB 2DMKA 4OZHA 4JFVA 2OYPA 1RVFH 4JPKL 2WB1A 1A6TA 4QXTB 3PJSA 5AYQA 4JR9L 1N0LA 2HMIC 1QHPA 2DAVA 1NGYB 3OXSA 3EBIA 4YSAA 5KYUB 4OF6A 3TIEB 3BVVA 2PF6A 5AL0A 1DQDL 4V1DD 3H9YA 4FC3E 3BFOA 3K2IA 4GI6A 4NYLA 1ZVHA 1ET5A 3ZE0B 4FQ2L 4PS3A 4NRYB 1OQXA 4WUKL 1KENL 4NT6A 1WTGT 5CIPA 5ICZA 5AB9A 1MWAA 4IEFB 3LRGA 2I25N 4QHUB 2R2BB 1HIMH 2G9KA 4BUGA 5BZZA 1CL7L 3BH8A 5E6UB 1B2WL 4A2GA 5AYUL 1HYRC 3PGDA 3ZTCC 4Y2DB 5HYSB 4AKOA 4KAQL 3F05A 2GUOB 5JHLH 2QHRL 3MLZH 5BV7L 4XPAH 5C2UB 3H1ZA 2LFEA 3MLTA 4BZYA 3NCBB 3X3GH 2XQ0A 3B7RL 4CL7A 3NVQA 2DMBA 2A6DA 3VXUE 4PJ9C 3QUMH 1C16A 3O9WD 1BYNA 4TPRL 2RJMA 1F4HA 3CUPA 2XZCH 4G7VL 5DUPL 2OYKA 2QSCL 3FTGB 1SEBB 5F88A 2CWRA 2YUXA 4R96B 5I6NA 1MCHA 1I7TA 3M1BA 3S3JA 1IC7H 5DJXA 2HYMA 5F7HA 2OYMA 1AZZC 4MZ3A 3TIEA 5J9PA 1A7PL 2VDQB 5FA3A 5DHDA 3D4GA 1NCAL 4ZFZB 3JZ7A 1QYGL 1LE9A 3K7UA 3K8KA 3O3AA 5ETUB 1BQHG 5KS9A 1HXYA 3TM6A 5KOVC 2EKJA 2HKAA 3DPDA 5CU9A 4MJ5A 2VTFA 1FFRA 1MFEL 1NSNL 5A40E 3NPZB 2K9UA 2R15A 5I8CB 4HUUB 3VA6A 4ONHA 2BC4B 5KJ7E 3LNFA 3SO5A 1IIIA 4K4KA 3O4OC 2R59A 1AZNA 4YDLB 2HRGA 3QO1B 2V3EA 1OPOA 1D7CA 3TFKD 4J3WA 4W9ZA 1KTKE 5HHME 2JH2A 2V9TA 3HN3A 4PY7B 3IMTA 4QCIA 1SLVA 1NFDA 1YRKA 2CO6A 4CVXB 2AANA 1MAML 4TSAH 5LCVH 2XQYG 1F58H 3HKFA 3MV9A 4FJZA 3TCLB 3PY9A 5I1DA 4YHKL 3TF7C 4FADA 3TBTA 5I0VA 2NSQA 2ZQKA 3RDJA 1R5WB 4AT6A 1OTTD 4WTQA 2J6EH 2NY5L 2I5YH 4OZFG 3ATBA 2YC1A 5D1XE 1CPUA 2V2WB 1G9EA 4AITA 4S1RH 1ZE3H 2IADA 2AEPL 3MV01 1A3ZA 5C0NC 4G80A 1IC5H 5E5MB 2BIQA 2P5WA 5C0DB 4GRLD 2UWEE 1XF5A 3F7KA 3DV6A 3PDOA 3RNKA 4C56E 5JIQA 2QELA 4GKSA 3L9EA 4MA3B 1DTUA 2QR0A 2AK1L 5E2TH 4PP2B 2B08A 4PLJD 1N6QH 3KR3L 2BXZA 2IALB 4P5SA 5DJDA 2P8LB 5HYSG 2VLKA 4GMSL 1VGEL 1HK6A 4L4TB 4NZRH 4Z7UE 4PJCB 2P80A 3TBVA 4HWZB 3HNVH 3US0A 3U4AA 2J56A 1PLAA 4LBEB 4QRTB 3NFNB 1ANUA 2H26A 3HC3L 5D7LB 2Z35A 4EIGB 4JPVH 4LGPB 1J1OH 3RUGE 3GZPA 1IBYA 1T0OA 4UAOB 2YA2A 4I48A 3E6FB 5MEPB 4OJYA 2EDEA 3G08A 4CW1A 4LLVB 4KOBA 4N1CA 3POCA 1D5RA 3GTVA 3Q3GA 1OGTB 1P4LB 4NN5B 4GEIA 4ZUVB 4AC2A 1QRNA 2AJVL 3DBXA 4H1LG 4J2XA 3AVEA 3SQBB 3DURA 4X6DA 5GJTH 3P2TA 1YECH 2DD8H 2M1KA 4X2UA 1HYSD 5IVXF 3MLWL 1AHWA 3ARFA 1OGAD 1L9RA 5L7XL 5L0QB 1NFIA 5KSVB 4FABL 2O61B 1U3HA 1W16A 1FFOB 3A67H 3CVIL 4H8HA 2SEBB 4XC3H 3K6FA 4CDGC 4C83B 1BA9A 1XB6A 4X7CC 1IARB 1T2QH 2C34A 2PYFB 1N0XL 1X5YA 2EDNA 3QUYD 2RALA 3ARDD 3DNKA 1BGXL 1HNYA 4Y1AB 2Z0UA 4QRQB 1TENA 4XMVA 3TV3H 5FCSH 4E41B 1F56A 3QPQC 2MPAL 1XH1A 3KPSE 2FLRT 1LO4H 5EU6D 1SBSH 1RPUA 1NLBH 3BZEB 2G5BA 1YY9C 4YHOH 1COBA 3QDMB 2VLRA 5DUBA 2V2XB 3SBQA 1R75A 1Q9OB 3IXTB 5ABZA 4BK4A 1VGKA 1B4JH 5IBTL 1MAKA 2GIYA 4FXTA 4MQ7B 4OAWA 4ZFGH 1U58A 1E43A 1XH3A 4LSUL 4E5XA 1HWWA 3N85H 4PI2A 2DM3A 1Y18A 3HZVA 5SX5H 5J11C 2L7UA 3X13A 1SOXA 2GW5A 4GNKB 4QY8A 4YFLF 2D03L 1OCCB 2PPCA 5CN1A 3NMEA 5ALCL 3GRBA 2C7FA 1DO6A 3WGVB 2CGRL 3E2HB 4IBQA 3TBSA 3BVTA 4M7JH 4YSQA 2ADJA 3RX8A 5D7IE 3ZZLA 3FQWA 1UGKA 1TVDA 3T0DA 1GPOL 1C08A 1MDAA 1EEZA 1T66C 3MRBB 5JMOC 3GGWA 4M9OA 5A7EA 3ZR6A 1ETA1 2BS8A 1YY8A 4L4JA 4N3UA 4F3FA 1LVEA 5C0AE 4EZKA 3D69B 3U83A 35C8H 5H4ZA 4O02B 5IVZA 4IOSA 3CFNA 4GRLB 3D8MA 4JGUA 4YDJB 3NCEB 3MV11 1CCZA 3BE1L 1MCOL 2QADC 4O2EB 4MAZA 2IWKA 4I3RL 4P46D 3CPLA 1K4DB 1AXSB 4U1JB 1V10A 4R7XA 1F4AA 3FCUB 3QCUH 3PQYD 3C60C 4M1DH 2F5BH 4A39A 4X9FA 4GI9A 3HLAA 4MXVF 5HJGA 1FORL 4NM4L 2V7HB 2NRDA 4C4KT 2WXLA 2CR0A 3C8KA 1KCLA 1BM3H 1TQCB 4HD9A 1DLHB 1YEEH 4X80H 1TNNA 2NDGA 3FU3A 5EUOB 2FZ3A 1QSEA 4LASH 3CVHL 1DBAH 4X8JA 1TU2B 4OH2A 1A7PH 1B4LA 3WD5L 4QT5B 1FFTB 2BVOB 4LPYA 5T5NF 1IZJA 3UC0H 2W0PA 3BQUB 1A21A 1E4KA 4HPOH 4P23B 3UAAA 2CE6A 5GSVA 4MXWL 1ML0A 4XN7A 4PWFA 1GCYA 2GSGA 3FF7A 4R6UA 1F6FB 2B0SL 1RK1A 2BDNH 5TE4L 1XWVA 3EDKA 1E42A 4LT7A 3OG4B 1OP5H 3OKOA 2VR6A 3MXVL 4Y2LA 1OB1A 2EILB 3KVDD 4YE0A 3S37X 4ORGA 4UI2A 2GSIB 4FA8A 3T4AB 4O02H 1YEGH 1OGPA 1MCPH 4BKTC 1HQ4A 2D0FA 1PD1A 2XN9B 3U0WL 3MNDA 4WU7B 1TYJA 2R2EA 1O7SA 4BD4A 5HD8D 1ZPLA 5JXAH 3FTVA 3U9UB 4JFTA 3ETSA 3TN0D 3D3VD 2Y3AA 3U4BL 1MWAL 4KJPD 3QUZD 4FAAB 3O6KL 4L0PB 2ZX8A 3LXBA 1BSIA 1AHWB 3ARFB 2NW2A 1YEJL 3MRDA 1U4EA 2B4CH 2DQFA 3VGFA 1EAQA 3AB0B 4EZMA 2F1EA 1I8KA 3R1GH 5I1AA 1H5BB 2WLIA 3HN8A 4XB7A 4I13B 3DHMA 2E9BA 4NKIL 2B8OT 4Y4KA 4A7SA 2GK0B 1YVLA 2HLAB 3VXMA 4Y4KC 3REWB 1JK8A 1AGEB 1IL1A 5DURB 1BBDH 4M6OH 1J5HA 2ICES 5C0RL 2E7HA 1HHGA 1CLVA 3AG1B 4Y5XA 2R4RH 4JY4B 1KULA 3ALPA 5E5RB 4HWZA 3ABGA 5AVSB 1FWXA 4TRPH 4MVBD 3MX0B 1T7YA 3LX9A 2YRPA 3VXTB 4I0PD 5JNYA 4O9HL 5DD6B 3GMRA 3RI5F 3FT3B 4PJXF 5C0BB 3LTVA 1B6DA 4Y19A 4J1UA 5EBMA 4WV1A 2G2NA 4I18C 2O26U 3QI9A 4Q8BA 1D5MB 1AY1H 1P5UA 3DUUB 4IBYA 4M7LH 4Q2ZA 4WI4A 3K2KA 1G9NH 3LIUA 4JO4H 2CKBA 2PCYA 2X7LA 3TA3D 4XWOD 1U8KB 5E1AA 4PUBL 3I85A 1Z5YD 4IKKA 3JUYA 1HJBC 3RWFA 3VUAA 1HNGA 2XBTA 3OR7A 3EBAA 2J6WA 1JXJA 2VR5A 2DQHL 5BZDB 1DBKH 4CKQA 3IE4A 4J3OD 1JK9B 1UH2A 3MV9D 4IBWA 5LDUA 2ADFH 4S1QH 4A37A 4MD0B 2D03H 1Z3RA 2XXCB 5C07E 4A66A 3O4OB 2X9YA 1JRHL 3C75A 3GZQA 4I48B 2DYPA 1KWKA 2UY7A 3BUYB 4CBZA 4LCWE 5D1ZD 1K85A 4MJIE 1A7RH 3I50H 2OMYB 4F8TA 3PHSA 4WFFE 1N70A 2WYHA 1JG9A 1J12A 3U7WH 1U8CB 3DVFA 3WUWG 4HYTB 1K6QL 4PJIF 2YS4A 5ESQA 2ICCA 2NW3A 4MNQE 2C9VA 5IROC 4N4YB 2WN3A 2IALA 3K6SA 1B0RA 9PCYA 1LEGB 4B5ZA 1F3JA 3AY4C 5C0EB 2XPGA 4R0LA 4BQ9A 2J8OA 4LAQL 2FWOB 4PRNA 1XF5B 4I3RH 1GXEA 3L5HA 1I7TB 2F8OA 2X4SA 1Z9MA 2A0LC 2XIIA 3QWRA 4PJ7F 3DROA 3B37A 4QHPA 5DEFB 5LBSL 3T09A 2HH0H 5DGRA 4HJTA 4LSQH 3FPYA 4PR5B 3KNBB 4JPKH 4M3HA 5TF1L 4MRCA 4IHBA 3H6AA 1NJ9A 2RGSA 5ID0A 1ZT4B 3LS5L 4XPBL 5DDHA 3NP3A 4X4KA 4F7MA 2AAAA 3QAQA 3TTSA 4JRWA 4NO0D 4QNPF 2FHCA 2F7OA 2WIIA 2WY3B 2JF1A 1OLLA 3MV7B 3UP1A 4X4XB 4RGOH 3O2VL 5FM5O 2ATPA 5IY5B 3OXSB 3SDCD 3L8QA 1DQKA 1MHHA 4R2GC 4XC3L 2B2XH 2AZAA 5EBGA 4CN4A 3TYGL 5EF1A 4S0SD 4ONFL 3UTZA 4R4FH 4CC1A 3QRBA 3B5TA 3IKCA 3FS9A 2QHRH 1HEHC 1B0GA 1R46A 2IDCA 3LKOB 3MLZL 3KLSA 3FQTA 3JV5A 1ORQA 4GSDH 2CO4A 4WNQA 1DJIA 3VE0A 3BSZH 4YHPB 3KXFB 1DE4B 1BVNP 1N0LB 3DUHA 3HHRB 4IBZA 3E8VA 3O3AB 2B5IC 4Y4FA 4HT1H 1Z5LA 3NJXA 1KACB 4E0RB 1CIDA 2NYZA 3BUQA 4KY1H 2J57A 2WLLB 1EHKB 1NFIB 5KSVA 4JO3H 4LPXA 1YMMA 1HILA 5K39B 2JV6A 3FW6A 4IRZL 4C56B 3FCGA 1G9HA 4PYHA 1IGYB 4KU1A 2DQDL 5KVFE 4LHJB 2A73A 4MNGE 4OLXH 3QEGL 2HJFB 4ALAC 3CHOA 5GS1C 1UWYA 4OVUA 5I1JL 4IRSD 5DS2A 3W81A 2OKMA 4L3CB 4L5FE 2D4DA 4R4ND 5E99L 4NAMA 2G2PA 2XVBA 1SDYA 2QHLA 4OIIL 1U2YA 5JR1L 1R3LB 3UL4A 2EDDA 6PAZA 4W6YB 4LU5H 4P3CL 1XIWB 2CIIB 4HC1H 5DRXB 4AYID 2WVSA 1YN6A 1CYGA 1VADA 5JZ7D 4XVOA 3RNQB 2FBRA 1I82A 2R2EB 3CHPA 4X4MA 4V1DB 5JOFB 4YAQB 2YOCA 3G04A 4F80A 4R5XA 4NQDB 4YDVB 1UM4H 3ZHFA 5LDSA 4ACTA 2QKSA 1LDPL 5IJCC 3HTLX 4M1CD 3H4FA 3BKYL 3ECWA 4N0FB 1D5XA 3WAJA 1DJXA 3KL0A 2GBVA 3ES6B 5BMFL 4FQLL 4CN6A 5HGAB 3VXRD 1TCRB 3MOQA 1YC7A 3L2LA 4HDIB 4PP1D 4IGBA 4R4NC 1ETJA 1WV7T 4MX7A 1JMXA 4JKWA 4OZ4A 5E8EB 5HHOB 5C97A 3BZDA 5C0JB 2HTKD 2ZF8A 2BOLA 3HEIB 3QP3A 5HY9A 4J3XA 3VFTA 4QXTA 4U0RC 1L5GA 1Y6NR 5LN8A 5LAPA 4MQXD 5KVFL 5HHMB 1HINL 4H5SB 2WNKA 5JOEA 3C08L 3HFMH 43CAB 2FWLB 4WWOA 1FZKB 3O2DH 1MELA 1USZA 2H0FA 3EOAB 4PBDA 1OT2A 3ZE2B 4A6YL 1UD4A 4FFYH 4FTDA 1W2KT 2ODHA 4DFIA 2Q10A 1G7IA 4YXHH 3BYTA 3TNMB 2F2HA 4KKAD 3B2DC 4XN9A 1LO3H 2NT1A 3LD8B 4DZBB 4JE4B 2COVD 4XE5B 3DVIA 4B9FA 3DMMA 1NBVH 1SEQL 2VLJB 3DMMC 4C59B 2C7UA 3IJ8A 5BJTB 5B8CB 3RGVD 1AE6L 4B60A 2NY2D 4PRIB 2O6FA 4HUUA 4IK7A 3EJCA 3P4NA 1MPAL 2IH3A 4YSCA 1EAPA 2EXWC 4OI7A 4UT9L 2C9QA 4FLSA 3ARVA 3B34A 2Q2LA 4A7GA 4KRNA 4XCEB 2KPNA 3SPJA 3OG6B 3GD1C 2A1WH 2N59A 3L4CA 3WFBL 2F74B 3D2UB 1KLFB 4UBDD 2WD0A 3PYCA 3IKKA 5IW1B 3S37L 5AEAA 3FUJA 1KYUA 1UA3A 4HQQL 1P1VA 3ARGB 2ICWA 4ZZFA 4GAYA 4Q97A 4MNQA 4DPRA 4GH7B 1NC4B 4Y16B 3MA9L 1KYDA 2B59A 1WCBB 3HE6C 2V5TA 5C3IA 1KLUA 3CU1A 2EXYD 2I9TA 4WUUB 4RMQA 3VXSE 2AGJL 4MDJA 1AP2B 2JVUA 1W8NA 3NH7L 1WA0X 5JHDA 1TPXC 5JQ6H 3RIAF 3VWJD 5HDBF 2DBLH 3P4NB 2HRHA 4AWJC 3N40P 1H3UA 3GSOB 2VDQH 5LAXA 4ZUTB 2OMWA 2XXGA 4XO9A 5EDXA 4Z7OE 4HS3B 3VD0A 4I7ZC 4MAYA 1UM6L 4U1JA 3IXAB 4X6CE 4W93A 2C3XA 2VLKE 1A2YB 4QOKD 3H3PH 2CXGA 1TO5A 3VH8B 1J05B 1EH9A 1QSED 2V9QA 5I76A 1M4KA 3MRMA 1EO8L 3NN8B 3IWUA 1KYFA 5F0PB 4AQAB 5JW4Q 2HJFA 3SQOH 3VO0A 4HKBB 2DEXX 2FQDA 3L17A 1J0ZA 2D9QB 3ASOB 1YN7A 4FERA 1HC1A 3J2PA 4PSRA 4KOCA 1T5XA 3I6SA 3T1FA 1KIQA 1A7OH 5IMMB 1NANH 3ARDB 3P2DA 2NZ9C 1OY3B 5HDBE 1Z9LA 1NPUA 4YK4C 2XICA 4U7SA 4NN7B 3CMOL 5D71L 5IQLA 1E2WA 4L3ED 2VISA 3KBHE 1G1CA 2E5EA 3H42H 3TJEL 2ZWSA 4R9HA 1R17A 3JYCA 3U7YH 3WNLA 4AKQA 5K5YA 4LEOA 2Z8VC 2ZUXA 4EBQH 4CILA 4JFPB 1MRFL 5AKRA 3SKMB 4K8RC 5A2AA 3C5SA 4IRJB 1BBJB 4MJ6A 3VMNA 3LQMA 2DWXA 4TUJA 4UT9A 1MCDA 1AIZA 1OXYA 1CWVA 3VXUB 1XF1A 1J8HD 1B3IA 5BRPA 4G7YH 1CXIA 1NCHA 4E2OA 5EIIG 4OIBA 5SWSD 3TYGH 3HI5L 2C9UA 3B9DA 3SKOA 5EHFA 1CK0L 1J8SA 3RVVD 4F7EB 1NEUA 1JNNH 2V4LA 3K5RA 1N64H 5EOCH 4Z23A 5SWZB 1WIOA 4MJ6B 2ENPA 1E4XI 1P2CB 2ITCB 1R3LA 3FN0L 1A64A 1HZLA 2VZVA 2WGXA 3I6GB 1V8HA 1S7VA 2ZE0A 5DYOA 1K6QH 4L9LC 4KDTA 4P4KB 2Z31D 1XSIA 1SF5A 4AIZA 1DBMH 5ENWA 3P40A 4NJAH 5AW3B 1INDH 1QSVA 2BHYA 4Z78B 4A2HA 5EEXA 3EZ8A 1BM3L 2BOCB 5AAPA 5ACZB 2Y7MA 5BXFB 3X1FA 4JM2B 2VR8A 1CLOL 2OSLB 4WEMB 1BZOA 5C70A 1QWNA 5D6CB 4EDXA 1F3JB 4DP2X 2CHDA 1FRGH 2Q5BA 3TO2B 4H25B 3P3SA 5F96H 2XN9D 3U0TA 1JZEA 1VEOA 4XP9H 5BUGA 4AQZA 4MMYA 5ESQB 4LOFA 4XPGH 1LGVA 2UY6B 2QADB 3O11A 5IB3B 4GSQA 2HT3D 3LPFA 1RH8A 1SYVB 3WJJC 1ILSA 1Z9OA 2ITDA 4NXSA 5DWUL 5F0LB 2J71A 4TSBH 1B9KA 4MRBA 5H94A 3MR9A 3WKML 3QO1A 2A9BA 4P9HH 4PN6A 5B1KA 3W9DA 3ZOAA 5TE7H 3QXAA 3LKQA 4MJJA 4NUQA 5DJ8A 2VITA 3ZQWA 1UA7A 4AL8H 1JPEA 5DEJA 3X17A 3WJMA 5D96B 1LL1A 4YZFE 5BMFH 1VENA 3NK4A 3WCYA 4OT1H 4YE4H 3FTUA 5I1LB 3EO9H 1AI1L 4J27A 1ZMYA 5EEYA 3KCWA 1MNUH 1GAFL 4MQSB 4XNXL 2XT1B 4CRPA 3U4EA 4KKZA 1LK3L 5EZIH 4G7QB 2ENQA 4HKJB 4IKIA 4K3JL 3S8GB 3VSUA 1T4KA 3WTXA 2NNFA 5D6CA 3RWDB 1ROCA 3NAAL 3RNKB 4FXGC 1MCEA 1XGQB 3OGOE 5IR1B 4G3YL 3MUZ1 5EORL 4FQQB 2MPVA 1PLCA 3ETTA 1YQVH 1A4AA 2YUVA 4R84A 5EU7C 1ZLSL 5CD5D 4M6OL 5KUMA 1BEXA 1ED3A 4WV1B 3NZ8A 1MAMH 1S9XA 1R3JA 3T4AC 1F45A 5JLZB 2QDVA 1LD9B 4M56A 4GW4B 1IQDB 2OTWB 2WQWA 4PJFB 3WLWC 1YYMH 1PQZB 5JIPA 2WSPA 3IRZA 4U2ZA 4GAFB 4IBVA 5CSZA 3UO8B 1FL6A 4K9JA 2Z92A 4AVIA 3F7LA 3O8XC 3V55A 4UB0H 1A9VA 1A0QL 2AJZB 1YG9A 3CDGA 2R2BA 5DZLA 1U2HA 5IB4A 4RFNC 3AB0C 3VM5A 3IRPX 5GGTH 4BE6A 4TUJB 2HLFC 1JWUB 1WT5A 1BQHB 4R4BA 3QJUB 2X5PA 1CGWA 4AUYA 4M61B 5F7KC 1WBXB 3HB3C 4Y4KB 3QJFA 4KDVA 1R3IL 3UJIL 3ULUD 8PAZA 3M07A 3VGDA 3GMNA 2PYEA 5GRUL 2YGQA 1MI5A 4MLSA 1EO8H 1MJ8H 3D3VE 4L4VB 2A74C 4CDHA 4Q6IC 3RJOA 4D0CB 4NB7A 2YUZA 2ZSWA 3VFVB 5ESAB 1DLFL 3DTXA 4N28A 4Q6IA 3WN5B 3VGAC 3FL7A 3TZVC 5IIEA 1LWRA 1QLFB 2A6KA 5DT1H 2VAJA 2WKOA 4DERA 3N9GL 3HG2A 1J0KA 4BFBD 1NC2D 1OP9A 2O72A 3FOMA 2DLFL 4AYBA 4XNUH 2WMPB 1FL5A 3Q9PA 2W65A 5I2IA 1ZCRA 1OTSD 3ZTEA 2VZ1A 1FJ1B 5M94B 3NIDE 4J1UB 4UUJB 4ZMAT 1NCCL 4ZAKD 5GJTL 4Z1PA 4LLDA 4Q9QL 5HVGB 3C9NA 3MLTB 4ZFFA 2IWFA 3VMPA 4HIQA 1YEFL 4OGZA 4WUKH 1Z3GH 2Z64C 4Y4HC 4C4UA 2J5WA 1E27B 1RZFH 1ZPUA 2PCFB 3PWPB 4JJOA 1Q9WA 2KLSA 3MRCA 3P77B 4OLEA 3MV8B 3N44F 1KYOK 2NY6D 5DD3H 5C07A 3BJLA 4YDKL 5DMKB 4KNQA 5ACMA 4BH7A 4LKCA 4KZ0A 1RERA 3GKWL 4QHNA 1E30A 3STBA 1EFXD 1SOKA 4EI5C 5TK2A 5TQ2H 2X09A 1GS7A 2IH1A 1UCBL 3QC6X 4N8VB 4YXKH 1OE1A 5MEOA 3GB7B 2CG9X 1TVBB 3WFHA 1DQMH 4JO1L 5ALBH 2EDYA 3WFCL 5LGJB 1E3FA 1OAXH 4QXUL 3QHFH 4XP1H 2FH8A 4MVBC 2UVFA 3V6FA 3A21A 1PDKA 5IGXH 3FB5B 4IBUA 4UNUA 3EJJX 4HJJL 2YMXL 5KYYB 4PRIA 4RX4A 1BAFL 4ZFOB 2P5PA 4OF8A 4B3VA 3HI5H 5KBPA 3SKUD 3JYBA 4QLWA 2OS7A 2QQKL 2PWGA 2VJ0A 4PCTA 3TBBA 4MKMA 4ANXA 4GXFA 3V0JA 3POHA 4JRFA 3VFOB 5D1XA 2X4UA 1QLEB 1MCKA 2Y5TB 3OPZL 1OSPL 5EC2B 1NJ9B 3NJHA 2X88A 3QC5X 5FWQA 3D85D 4M1GH 1JZ6A 4Y16C 3DO7A 4PTUA 3DDGA 4ENZA 5KYXB 3O6LL 3G5YA 4YIQB 1PKQB 1YYLH 5FW6A 5C3LD 2WXMA 3NZHL 1FG2A 3NFPB 4KI5E 4HIHA 4D3CH 3PLYA 5JW3L 1GSMA 3MRKA 1A7OL 4I5BA 3SKOB 2IOOA 2NY5C 2H8PB 3HBZA 5CINH 4XNDA 1L9MA 1JPSL 2Y07L 1XGZA 1F5WA 4M48H 3EYSL 1NH6A 2QTEA 3L3JA 4Y19D 2DJUA 4J8QA 2VMFA 1TZHA 4OZIA 3GMMA 5KBLA 2UZXA 4HUVB 3S5LG 1IO4C 4PJ8C 4DEWA 2G3NA 4JB9L 1HSBB 2VOTA 3DX6B 3ROOA 4PJ8A 1I75A 1BZQK 3LV3B 3WKMH 3Q43A 5INCB 1VKXA 2VN4A 4UTBL 4NUJA 3UPCA 4XPHH 4KXCA 2KLRA 2ZKYA 1L7TL 2XA8H 2RFXA 3RGVB 1KENH 4K7PH 3QQ9D 1SY6A 1FZMA 4BIKA 3BKCL 4LESA 4WI0B 3FMGH 3B6SA 2DMGA 4EIBA 3ULUE 2WKLA 1ONQB 5I30H 4CADA 1MFCL 2BSSB 2JKWA 4I9WD 1Y6KR 3TBSB 3MV8D 3QPXH 4Y5VB 3S0PA 2GBTA 3NBNA 4OV6F 5C92A 3PHQB 3RX5A 4YHLL 3CC1A 5D7IB 3GSXA 4MCZA 4WJ5A 4R26L 4A2MA 5B39B 2NY7H 2P49B 3O45B 1ZVSA 4UV7L 3GINA 3PL6B 4U6TA 4MAYD 3RA7L 3U1SL 1AKPA 3C6LB 2CBMA 3WKYA 1AGBA 5CBEB 1Q1JH 3JWNH 4ENED 4YWGL 3ASNB 4OUUA 4BFIB 1GJIA 1NGZB 4ZMYA 5J06A 4EI6B 5INCA 4HFUH 3SE3C 4JPIA 2IDFA 1MSPA 2DIAA 1Q4NX 3QQ3B 4WWKB 3D0LA 3TFBA 3JWOH 1H3XA 1YDPA 2XRAH 4NRZA 4Z95H 4L9LB 5F7UA 4YO0B 1VZHA 3G6DL 2VLME 2GJ6D 4MX7B 4TSBL 2NXYC 1TQSA 1G1YA 4UV4L 4YAQA 3KYKL 3FONA 5BRZA 3KL5A 5E8OA 5I74C 2RQ8A 4TN9A 2E7MA 5LBGA 3WLBB 1NWOA 1JPTL 3FAXA 3PABB 3U9WA 1RZKC 4TXVB 3ZJAA 5D7IA 5JORB 1IVTA 2AJSH 4R97B 3ZE1E 3QG7H 1N9PA 1A25A 5EBLB 5K59F 3O2WH 4U1SA 1T0MA 2MQCA 3KM2A 1YAIA 3OB0K 5KJ4A 1R33A 1N4XL 1QI5A 4R5VA 5B21A 4NO2B 4FLQA 3V0DA 4ECNA 5A2KH 4EQ3A 4BSWA 2EE6A 3PWJB 3DMMB 4XRCB 5EC1B 3KD4A 3OHXC 4G1EA 5D6DA 2CGRH 4JPSA 1EHXA 3FT2A 1G7IB 5IJKA 1EUUA 3IVKA 2XV3A 5D96C 4AH2A 4IJ3C 4Z7NB 1PGRB 4XP1L 2G0KA 5G4OA 3ARYA 4DP1X 1W0WA 3KPSA 3MJ7A 4B0MM 1YMHA 4NAQA 2BXYA 1HYSC 2UZXB 2ZCHL 2WQ8A 4PGDB 4ZYKB 3SJVB 4MSWA 3V52H 2AXFA 5C0RH 3QDJE 3KBPA 4LF3B 4QRSB 4G7RB 5B38G 3N1FC 5CHNA 5D7LE 2W80C 3ZO0A 3ZZQA 4P06A 3GNML 1BXAA 5HYJB 3FQXA 4NQXA 2CPCA 5DHVA 2H2PD 4H7VA 2VQ1A 4G6KL 1FVDA 4HEPA 3FFDA 2R0KH 4X99A 5E7BA 2BFVL 1RPKA 3KPOB 2Q7YB 3RBSA 5B4MC 4E9YA 2OPCA 4M00A 2E3VA 1WFNA 2G5RA 3H42L 1JV2B 3OMAB 2JIXA 2B0SH 3FULA 2PO6A 3TJEH 1E4XH 3RURA 4WK4B 4HIIB 1QAWA 1F3DH 4RWYH 1IX2A 1QRNE 3WFCH 3KWVA 4YX2L 1MJ8L 1GOFA 1UT1A 3N1MC 4LL9A 1DEEB 5HHPA 1OK8A 3W57A 4K5OA 4ZW7A 5I15L 1F41A 4AEEA 3S7GA 4ERSH 4HEPG 4JFHD 4KMTH 3U79A 2QADD 1CTMA 4ZS6D 2YA0A 2HLEB 1L9PA 1JPSH 1HH9A 1ZTXH 4NT6B 5KVGL 3CVDA 1G5AA 1NGQH 1IKOP 3KYOA 3MJ9H 3PS6A 2IDTA 3MDJA 5JHAA 3OAYH 4XZUA 4WWNA 1U91B 4MB4A 5DJAB 1R5IB 2WZPD 1JDDA 3PGCB 5GRVL 4JZJB 4BH8B 4Q6IB 4UTBH 5DQDH 4PJGF 4PJIB 3IPFA 1J9TA 3G5VA 4P2OA 3RDTD 2OYLA 3WU1A 1FNEA 2HT2C 5FX3A 1ZY9A 1RJYA 1W6LA 4GAGL 5DJ6A 4PRPB 3TZVB 4Z5RB 3SSGA 1O7VA 5FCUL 2W59A 4LNVA 5D7KE 4X6BB 2ZAHA 2VDRB 3QNFA 1R5IA 2E76C 2DL2A 3P11L 4WGVB 4PV9A 4NIYE 3U6XA 2FATL 5D70H 5HBBA 2VLKD 4PREB 1AR1C 5G5DB 3MLVH 2YWZA 2XHNA 3B9KA 4ZT1A 1F4WL 1KCSH 4NO5A 1PYWB 4A6YB 1VACA 1WICA 2OXGA 2UY7B 3BUYA 5C07B 2XVLA 2R0ZH 1L0XA 1KN4L 2M83A 5JA9A 2A6IA 1H6TA 2R2CA 4HS6A 4JMNA 4MA8L 4FA6A 3ZIYA 4RGNE 4BFNA 5I71C 1U3ZA 4FULA 1EQWA 5CZXD 3IDYC 1PG7L 3MJWA 2Z92B 3DUSA 2W38A 4ETQB 4Z7WF 1A1NB 1MY5A 3V6ZA 5IQ7H 1T1YA 1KTJA 3IJ7A 3OAYK 1HESA 1GYWA 4LLWB 2BSCA 4P4KC 5AB1A 4XOCA 5INDB 3FOLB 1YEDB 4XPFH 3HAEG 2XPZA 1IBBA 1IBGH 3BQVA 1CLYL 1WITA 1ZLDA 1UASA 3H7BB 4FQQA 5JDJA 5D7HA 2W95A 4BK5A 4IU2B 5ENWB 1NMBH 4X6DF 2R23A 1HI6B 3RWGA 4P59H 1J8KA 1J8RA 4WEBL 5TK4A 2ZG3A 4TVUA 4KDTC 5GZOC 4LRIA 4GUPA 2FJSA 2Y7OA 1UD6A 2FYYA 4IBLT 3SYPA 2CJ3A 1C7TA 1SN5A 2NY0B 5JPMB 4QDGA 1KJVA 3PXHA 2AFNA 4GSDL 3VI3F 3BQUD 4P23D 4KJPC 3RE0A 4PGCA 1JWUA 4F1ZA 3N6YA 3VXUA 4D0BB 4OZGB 1MF2L 1FLRH 3JV0A 5FFOA 1C9SA 3V4LA 4XZ4A 1WRFA 3W0WE 2UZYB 3SDAA 1FZJB 3MR9B 5CINL 3A6CH 1E5BA 3HZYB 5JPMA 4O2EA 1FYHB 4FZ8L 2WTRA 4NO0A 1FVCB 5FHAH 1ZEAL 2VCOA 4KKPA 2EIZB 3MJ6A 4Y5VA 2ZTBA 5E8PB 4GQRA 3SPCA 3OR6B 4JB9H 4O02A 5IVZB 4TLKA 2J8UE 4WU7A 4NBZB 1KCUL 2V7NA 5E5UB 4IOSD 4HULB 4DP5X 4U1IB 3OC5A 4PRPE 4TQEL 5KAQG 5JXAL 1JFQL 5JYLA 5BXFA 1MFNA 2CGYA 1IM3D 1UYWL 1AKJB 4R5TA 4EXKA 1MCQA 3PQYA 5CWSB 2ZWLT 3UXFA 3D3VA 2MCAA 1NA8A 5FYKH 3ZKMD 3IPBA 2EDHA 2ZNWA 4LOUC 3V0VA 1LMIA 4PJ6A 1OKEA 4PIRF 4Y9GA 5FHBH 3RG1C 4Y5YB 3ULUH 5T1KD 4JFWA 4ZO7A 5I1IL 3MVSA 4HUVA 3KW8A 2LU3A 2NDFA 2APWA 1M2VB 4BDVA 5E0QA 3STLA 4LMQE 3LHAA 4RMSA 1GC1C 5FO7A 4LHUB 2BNUA 3BLBA 3ZHDA 2WXRA 4NQUA 3T6QC 3ZT7A 3VD4A 4J23A 1AQHA 4G1MB 2VLRB 3M86A 3UTQB 3EF7A 3VI3B 1VACB 4BA0A 1ND0A 1SM3H 5FGRA 1UXWB 2E7CA 3NJMA 5KW9H 5I8CA 3IGKA 1ACYH 3WFEH 1IQWH 1OVZA 4TUKL 4E41A 4EOWH 5BVPH 5T1LA 3JVGA 1TJHH 1V7NH 4RGOL 5I6PA 4TNWF 1VDGA 4WFGE 3T6ZA 5EUKA 5EA0H 1PD6A 1YUHA 3QW9A 1VJSA 1MIML 3ESMA 3DGGA 5A16B 3EFFA 3LZPA 1AQDA 3ZE1F 2YD0A 5DZPA 5BS0B 3BPCB 1E2ZA 5LGHL 2C9RA 4UV4H 5AOZA 2NY5H 3HC4L 5AL8A 3T77B 3FT2B 3IRCA 1A4BA 2CRYA 3QIBB 3FUFA 5DA0B 1NEZB 3QHZH 3ZE1B 5B8CA 4KJWC 1YY8B 1NIEA 4AENB 3QFJB 4LSTL 5I1EH 1BWMA 1HAWA 2IOMA 1R24A 4GKNB 4JANB 3O8XD 3KAAA 2BCMA 4MAUH 1M3JA 5K9KB 4APQA 2FB4L 1M05B 4S1DC 4B7LA 4JFOB 2ZIDA 1XGYH 2XWEA 2IF7A 4OCRL 2NNRA 2BY0A 1TZGH 2NY0D 2WBJC 4XCCH 3ULUF 3AREB 2YAMA 2BIHA 4TOYH 3PABA 4K07A 4TTGA 1EXGA 3AGVA 2X4PA 3L9YA 4PRHB 1WO2A 3B2UD 3IDMA 1ZTXE 2YXMA 4WIQA 1A7RL 4LVNC 4KKLC 4L29B 2I5YL 4QTIH 1ETZB 1MJ7L 1NC4A 1U93B 5KVEE 5C0JA 3DVNA 4X6EA 4YHIA 4FHJA 3Q8FA 1L9TA 1Z66A 3US1A 4FGMA 4P2YA 4X7TA 3GIZL 4F1SA 5F9DC 5EEWA 3GBML 2P5WB 3Q1SH 1QPPA 2F9BT 2WQAA 3LKNA 3DARA 3QFDB 2WC7A 3SBPA 4JX0A 1WDAA 2B1HL 4AIEA 3S36L 4L4VE 4X4YA 1NKRA 4CGTA 4YH6A 2Y36L 2NY3C 1X5LA 5T3ZL 4I0PA 3S35X 2VW6A 4K5PA 3VGHA 4JEGB 5J3HD 4IJ3B 5TQ0H 4F37F 1I8LC 2BY2A 5HVFB 3VFMB 1TF4A 4N86A 4L3EE 3WXWL 4F2MA 3MRIA 4G71B 4YC2C 4PY7A 1PG7W 2VDLB 4NJAL 4AZ8A 3MOBL 3HMXH 1CLZL 4K2UH 4K73A 1GOHA 3FRPA 3W5NA 2GC7C 1I3VA 3BAIA 2ADJB 1T1WB 2L7JA 1ODUA 5AENA 2A9DA 1F8TH 1D9KB 3H2WA 1SJVA 3W39A 2H26B 1IAII 4HHGA 3A6CL 4OZGF 4WSJA 3T3ME 2ZAGA 1TSRA 3LMJH 4L4TA 1A6UH 3P54A 3MSPA 5BZXA 3E7JA 3PV6A 4XBEH 1L0QA 1QSFE 4PJCF 5M95B 5JDSA 3UO1L 3KPMA 1RIUL 1IT9H 1JUFA 3NCXA 4NC1C 4HIJA 1QFWI 1CD1A 3MLRL 1BZDA 1ES0B 5IKCB 2P43B 2NY4B 3U30B 3K2UL 3B8SA 3N42F 1TZHB 4GW4A 3BSGA 2NY2B 3P1VA 4PRID 4YPJA 4LMQI 1XEDA 5BV7C 2VR3A 5FB8A 2ICEB 4PRIE 1IGML 3SO3B 1MF2H 2DY2A 5JOFA 3IDXH 1YMMD 4N0YL 4QRUA 4JQXC 3CVCA 2PPEA 5AZ2L 1JCKA 3IEAA 3O45A 5AKSA 3F7YB 1SGKA 3U0PA 4OFDA 5ESVA 5C0AB 4PJ5B 1WA2X 2Q7NA 2EDBA 4LPTA 4K5MA 1K5WA 5F7EH 5K1NA 3HAEB 3MNWB 4PRBA 2WM0A 4TUUA 2UVEA 4F9PA 4W9IC 4YGAB 2I85A 4JREB 4JHWL 4XVTH 4L2LA 2X6UA 1A6VL 1TZIB 1MLBB 2EP6A 4U0QB 2JELH 1X4YA 2ERJB 3VFWB 5F97E 2H32B 4OUOA 5MP6H 3LZLA 4ODVH 2A6IB 3TPUB 3EYFA 4HAGA 1FNHA 4R4BB 5KANG 5EWIL 2OXGB 4YVNA 4YHYB 4QHKI 3C2AH 2AJXH 2VSKB 3K5SA 2LGNA 2Z35B 4R2GD 2QPFA 3GTNA 1DBAL 3ARZA 3KWWA 3LN5A 3ZDWA 4S10A 4X7EC 5J11B 4HCRA 4OCYH 5E6RB 2OW6A 4WO0A 4YBHA 5FAAA 5JQIB 5E6IA 2J1XA 4K23H 1WWAX 4WFHD 4YNYB 5KSUB 1RUAL 1HIML 2OMYA 1CICD 5D9SB 1UFUA 4R96A 3C60D 3KXFD 4KPHL 3UTQA 3VI3A 4LAJH 1BOGA 1JNNL 2BJMH 1MRFH 5B1CA 3R8BB 4FFYL 2V2TB 5F71A 2Y06L 3VFWA 5I1EL 4UBDC 3FPXA 1AGCB 1KPUB 3LH8A 3NSXA 2AEPH 4PYGA 3GHBL 3T8VA 4WF7A 1Z9NA 3TEWA 2GBAA 3QEQA 1R9FA 3L4WA 2RQEA 3MV8A 3ML8A 2VJ8A 2YQ2A 4EKJA 1M7DA 3EJZC 3PE9A 4HCFA 2BSDA 4UNTA 4MXQD 1TJIH 1OP3K 5I26A 3RTLA 4NWTL 2C3VA 3GLZA 4FEMA 5SWZA 2ZICA 5HHPB 1XR9B 2QZQA 2R9HC 2XX0A 1H8SA 5LXVA 1ZA3A 3BWUC 4XOAA 3FJTA 3KPNB 1GY1A 4L0ZA 2I9LA 3C60B 1D6EA 3I2CH 5I6KA 3ET9F 4WDIA 2G5UA 1Z7JA 2KDGA 3QDJD 1GGTA 5EBMB 1AZRA 4BQ8A 5I0DA 1QHQA 2FT8A 4IGBD 4OSUH 2V5RA 2VWEE 2FL5B 3KGRA 3M17B 2DMCA 3PJSB 5HHXL 3BCDA 4N87A 5DD1H 5EU4B 3VH8G 1S3RA 3MJ7B 3UROR 3EJZD 4MCYA 1RKRA 3VB8A 3TNNB 3OLDA 3F6JA 1WTLA 1FPTH 4G5ZL 4UU9B 2QSQA 4JY4A 4NWUL 4ZG1A 3AT0A 1A65A 3D25A 5C08E 1JV5B 1LE5B 3KLLA 3FZUC 3HS9A 3UPRB 2K4WA 2PYEB 1SYSA 2ZOLB 4OZHB 3OKDA 3FUEA 3AS1A 4OM1L 2FBOJ 1WBXA 4KVCL 4MA1C 3KPQA 2I9LB 3C60A 3R1GL 4ZMPA 4G6AC 3PFUA 2BK8A 3OKEA 4G8IB 4NI6A 4XTRD 3AG2B 2DYRB 2KI6A 2G2RA 3QORC 4TVSa 1WWCA 4PB0H 3ILEA 4OZHF 1CS6A 1ZK9A 4GQ9L 1IQWL 2Z1KA 1MOEA 2RB8A 4OI8A 4R7NA 1J1XH 3FH5A 4QXWA 4YDIH 1H3GA 5IMKA 2FEEL 1G7PB 1X5ZA 2VL5B 4XBPA 2WLZA 2N01B 2AZUA 3WIHH 3S36H 3SDDA 4HJ0C 3BH8B 3V5KA 1T89C 4AYGA 4XODA 5JLZA 2GSIA 4M29A 4MXWH 5DD0L 1DCLA 4HIEA 2YD9A 3BRGC 3S4SA 4G8GE 4MA8H 1A0QH 1MY7A 3O6FC 4RH4A 5KBKA 5DMIH 2CLRB 5DZNA 4RESB 4IW4C 4RISH 1OAQH 4C57C 2XBZA 4Q9RH 1YEEL 3K1DA 2WIMA 2X9WA 4CA4A 2HMID 3QDGB 2R8SL 3VWJA 4GY4A 2IXQA 1NGPH 3L4XA 1I8MA 4OJEH 2DWEB 3QR1A 3K71A 3BPLB 1R34A 4O5LL 4YGVA 1NGWA 2W07B 5GS0L 4LARH 5I8OH 3QJFB 1IGCL 3VXMB 2ZKMX 4Y9BA 2IMMA 2XWXA 1E8ZA 4JRXD 2HUEA 2Z91A 3IFOA 4YL4A 3C5ZC 4ESKA 1QZNA 1GS8A 4N6RA 2DH3A 2D7TH 4OLWH 1RHHB 3KLQA 2XNAB 1QACA 2OMXB 3L1EA 3C09C 5I5IA 2VMDA 5JHBA 5KYWB 1PF3A 3F00A 5AB2A 5DR5H 5ICXB 2R29H 4F8OA 3LPOA 1ADQA 3HS0B 1E65A 5FIEA 2DKSA 3DO4A 1DHKA 1BZ7B 3V6BR 1QKZH 4NQTA 5IROD 1FCGA 3EFDH 2YFNA 4FZEL 4JKNA 1UT9A 4E41D 1IFHH 1ZD6A 3B9KC 1UD3A 1R0AH 3O4LA 3ZLQC 5MENB 5JMRA 1RXLA 2O5NA 3D05A 1QEWB 1I3RB 1E9OA 4L23A 3H9SA 5D2NB 1TXKA 3TJPA 4HSCX 2H3KA 1HZHH 1MQKH 1RFDH 3DK0A 1EMTH 2G9HA 1FGNH 2B9AA 5ERWB 1FHNA 2QQLH 4XO4A 2IV8A 1YYLL 3NJLA 1C08B 4RSYA 4DVRH 3VW3H 3ZE2E 2J2ZB 2G3MA 5EH1A 1HCYA 4GBXA 1UZ6F 4J3UA 1FZOA 4LSUH 2LVEA 4MJIA 3HMXL 5F89B 3I6GA 2FO8A 1MFVA 4HJ1A 2DLIA 1EIBA 4OM0L 5CILH 3U4EB 4GRLC 5KBDA 1RLWA 1K9TA 4QHNB 1USQA 3LQAH 3OAZH 4HZLA 1WFOA 3CXHK 1UCBH 1PZDA 3R7QA 2YXWA 1GIGH 4OFVA 1IILE 1HH6A 1A02N 4OQ1A 4QAWA 5T3XL 4GW5B 1JZ7A 1S3KH 3GXUB 2AJXL 3OM3B 5K9OB 1CFVL 5SWSB 2VDNH 1YJDH 1JHTA 4LPWA 3F04A 3OJ2C 1FG2B 3NFPA 3LQAC 1V3JA 2A9MH 3DOSA 3IDIA 4ODXA 4EF3A 5J89A 1JWSA 3QIWC 2EDWA 5ECGA 2AXGA 1BYPA 5ES4B 3CMGA 3H7LA 3APDA 2HVBA 2VDOH 3ABZA 4YXLH 1SY6H 1AGDA 3ULVC 4JJHA 3IVKB 3SDDD 4WFFD 1YQVL 3U36A 1IVLA 5IHUL 4JFFA 4RIRB 5GGSA 2DQUH 2VERN 2B77A 3JZYA 4M6ML 1LMKA 2OZ4L 4JM4H 3BN9C 1L0YA 4NKIH 4AMWA 5DJZB 4I3SL 4UQ9A 2GIXA 2HWZL 2GJZB 4D9QE 1JWMA 3L4YA 2WLNA 5KVDL 2YMXH 3CFKB 2EIJB 2F54B 1G1OA 1UD5A 2OMTB 2EDJA 1HTYA 3MJ8A 2VXSL 1MRDL 3FFOA 1G43A 4OI9A 3IU3A 4DQAA 4KHTL 4GW5A 3LKPB 1BQUA 3MODH 2ED7A 1JHLH 2N0MA 4F58H 1D7BA 4M6NH 1E6JH 2NZIA 5GS3A 4P48A 3KHQA 3ML9A 2K4AA 1HXMA 1TZOA 4Z3FA 2KERA 2XRAL 5IEHB 3QPQD 4Q7DA 1FBIL 4ZQKA 1RUKH 1J1PL 5IB2A 4HKXB 1Q72H 1H5BC 4DO6A 2X3AA 3CLEL 3PWUB 4HGWB 4DKAA 2BNRB 4Z0BL 3NK3A 5E2VL 5H35A 4I0KA 4KXZI 4BWTA 4W9HC 1XAUA 4DSYA 3B9EA 3C9NB 4FFWD 4N5EC 5TDOB 1V7ML 1JZ2A 3AAZA 4NCC2 2E4TA 1R3JB 5FKPA 5KYNA 4PR5A 2OMTA 1U8MB 4R7DB 3EH3B 4GSRA 5EU6B 3HNSL 3V4UH 2IPTH 4B0MB 3ZYIA 4MJHA 4JO2L 1OF2B 2CDGA 4GMTH 4XPTH 3VXRB 4W6XB 1OANA 3R19A 5EZPA 2FO1A 1AD0A 5BQ7A 3N50A 1JNLH 4M6AA 1XIWC 1XSKA 2QVTA 3OAWA 4QD2E 4LCCB 1E9OB 4AGQA 4MWFA 1WEJL 4TSCL 3SEPA 3W1ZA 3BIAX 3W5MA 1Y1UA 1EEZB 3K6SB 3GSUA 5E8DH 4DAGH 5AAWC 1S78D 3FU6A 4GBXD 4JM2D 2NSXA 2OJZH 2GJ6A 3IJSA 4KKAC 5CZVL 5KSUA 5EG6C 1OGAB 5DWPA 5HI4C 1KB3A 3WXVL 4OJDH 3VAEA 4XN5A 4YSDA 2IIJA 4JFDA 1OLZA 5JHDD 5GRWA 1Z5HA 2AEQL 3BKML 3N1PC 1DZBA 3JWNC 2PMZA 4W4OA 3EJQA 1DUZB 3O41A 5A2IH 1WZMA 4HV8B 4UILL 2V5YA 1UOWA 4RMTA 1WZ1L 5EO1A 2BW4A 4UTBA 5E6ZA 4OAWB 5KTEL 4ODHL 1RURL 3X11A 3AREC 2VH5H 4N2KA 5TQ0L 1EFQA 5AW9B 5IEKA 1P84J 4XVUD 1NUDA 4NN6C 1KBPA 3WV0A 2M2DA 2O93L 2Q76A 2VXUL 1GRWA 4QF1B 4A2EA 4H5SA 3HJ0A 3RVXC 3MLXL 4NDMB 3FTWA 1XO8A 4KROB 1LO5A 4ZNCD 1CFTA 1QMUA 5EO0A 3E38A 2GTWB 1L3WA 3ABLB 4OKVA 5D7SH 4HLJA 5EBWB 1KTDB 3ZPDA 1QQDA 4WCYL 4MA3A 5I0YA 3LPPA 1QRKA 4JGJA 4MWFB 5D5MA 3MROB 2XWCA 1T66D 3BHBA 4P9MH 3BVXA 4KKBC 5CJ8A 4HUXA 3M1BB 1P84K 3SDDB 3FC8A 3MZTA 2NUTB 5C0DA 2XWBB 3GIVB 5FO8A 4G80B 5DQJA 5GRVK 2NY1C 4FJYA 3HKZA 1XSJA 1A8ZA 4V1DA 3V0HA 2YQBA 1E4JA 1T0NB 2P44B 5DD6A 1NCWL 4JO8A 1JZ4A 3ZIMA 3K72A 1CI3M 2AQSA 4DCQA 2V8MA 2AJ3A 2VDLH 4R4FL 4F20A 2A4ZA 3ILPB 4P5KA 5DF0A 3DJTA 4DTGL 1WS7A 1T4KB 3QJZA 4ZUUB 3GLAA 1NFAA 4HIIA 3VFGH 2EUWA 1FFNB 3RWEA 4BZ1L 1TJGH 2Y6SD 1EFXA 3OKDB 4PVMA 5T1MA 2PTVA 3OSVA 1GL4B 3ULVF 1M6OB 3T2NL 4BELD 1QABA 4I0PC 5GSRB 4Z7VF 2OJEA 4G8IA 2VW7A 4RGNC 1BF8A 2FHFA 1QA9B 5E0FA 4BSJA 3A67L 2ZOKB 3F12B 4G7YL 4P4RB 4UCFA 43CAA 2Y0SA 1AHMA 1AE6H 4B96A 2V9RA 4NO3A 3WMSA 4DGYL 1S9VA 4TNFA 4P2OB 5TJWK 1XAKA 4XP4L 2AV1A 1V3MA 4NCDA 5E03A 5J8OA 4JK0D 3DX9A 4RX4D 1DR9A 1UOVA 1XH2A 1W0WB 5HGBA 3ECQA 5DJAA 5FF6B 3CFJA 1S7QA 3Q01A 4LOVA 1AH1A 1N10A 3ARBA 3W3BA 1URZA 2ZCZA 5HGAA 4TPRH 3ULVL 4H0IA 5ITBH 5HYIA 2CLRA 4JW3A 4O5LH 2WOBA 2XN9A 1HQ4B 1N8ZB 2QMKA 3K1KC 5I76B 3P9WB 1OK0A 3BAKA 3M88A 4FHBD 4DN3H 3F84A 4JM2A 5TTRA 1CR9H 2PXYD 2BVQB 3ARDC 3IMWA 3GSVB 4JFQA 1NAKH 3DUSB 4JG1L 3VACA 3G9AB 2NNAA 3V0WL 3T4YA 1F2QA 1GZPA 2DDQH 1X5AA 4O51B 5DUML 2XWRA 4HS6B 2VB5A 5MHSD 1TLKA 4UF7C 3QJVB 4NRXA 3AU0A 4HJIA 2P7TA 3I9GL 2AXHA 2FUQA 2PPDA 3K91A 5T1DH 1JIBA 2YBGA 2VE6A 4I3SH 1TMQA 3FONB 3SDXA 5BRZB 4LEEA 2XCMC 1BBJA 4PRDA 3OJDB 4XCYB 1QO3A 1PL3A 3C5ZB 3QG6A 3H9ZA 2X42A 3STZB 1RZ7L 1BOGB 1GYAA 3BDYH 1BZ8A 4YHYC 5DMGC 4O58L 3CNKA 1T7XA 3QNZA 3OD3A 1UG9A 4BFJA 2IG2H 4EDWL 4K9EL 4KAQH 5L9DL 4OLXL 1T22A 3LN5B 2IBGA 4P5TD 1F00I 3T8MA 3D51A 1ASQA 1RJZB 5A2FA 2KLTA 4Y19E 4BV1A 3UBXI 2K8QA 3IMUA 3L45A 3CBKB 3NCJL 3QWQB 4HC1L 1FA4A 4N0UA 5SWSE 3GUFA 4WI5A 2XUWA 4LIQE 5F1KC 2C3GA 3P11H 1C5CH 3TEZA 1YEIH 1BIIB 3VSVA 4ANUA 1O9VA 3QT2A 4F5CA 3ABMB 2EH7H 4PB9L 1A22B 5I6OA 2EYRB 3E6HB 4OKDA 4XPFL 3AU1B 1XF3A 2W0FA 4QKTA 4U1HA 4P46C 4WQOA 5F9OL 1BJ8A 3TS8A 2CZNA 1JL8A 4JHVA 1D3CA 3BKJH 4QRPD 4OIFA 3BQUA 1FQ9C 4P23A 1IKNA 5DLMH 1M7DB 4P57B 4R90H 1BMGA 5IQNA 3EOAA 4NZTL 3PNWB 5KSBE 2BDNL 2CDEB 1NZRA 3LD8C 2XG5B 5H4YA 4WW1A 5TE4H 4YGVB 4PLNC 2YPKB 1LK3H 3QUZB 4K3JH 3EOBB 5CGYC 3T8XA 3WY1A 3EJUA 4BK8A 3DSFL 1URLA 5EF2A 1WH0A 2FE0A 4QWWD 3CFUA 2GABA 4KV5F 4ZTOL 1KXVC 1I9IL 2IQ9H 3RWIA 2CDFA 2Z7ZA 1IM9D 4L1HA 2G60L 2DLGA 4RLDA 4BHUA 1IM9B 4NQEA 1PZBA 4G9FA 1OAJA 5EO0B 4JUSA 4YDIL 3U46A 1ZXKA 2NW3B 2I7SA 1JI1A 1H9DA 4YZFF 3AMLA 2FGZA 4GG8A 4K3DL 4M6NL 5E08L 4HIXL 1DCEA 1L7IL 4YDJA 1NBZA 4M5YL 4DKTA 1Q1PA 5I5JA 2D9CA 1GGBL 4OR1A 2K3HA 4I8DA 4JY6A 4F3FB 1TEFA 3ARGC 3FRPB 3LS4H 1SXAA 4W9FC 5DJ2A 4EIUA 5CBAA 2JKIS 1ASOA 5DC9B 4LDLB 1BGXH 3GIZH 4K9EC 2N3JA 1JZ3A 2WINB 3WFDH 1BECA 1NIDA 4LKXB 1JZ5A 1J8HE 2WLIB 4ZRGA 1NIAA 3B1UA 1PJ9A 3C6SB 5JOPD 2GT9B 3FRPG 2HP4A 5L2JA 5J6GA 1CGTA 3SOBH 2UUDH 1XBRA 3QRGH 1RULL 4DUWA 3QIWD 3BPNC 3MN8A 1FZMB 3RIFK 1QFWL 5DU7A 5EEUA 3O6MH 6PCYA 4XNXH 2ZYHA 4FL4B 4K5NA 1JAEA 2EADA 2BP3A 3TPKA 1BFVH 3F65A 1AANA 2UXGA 4CNIB 4LBEA 4JVWA 4QRTA 3NJFA 4PGZA 1ORQB 5A2LH 3TO4A 5DXWA 4KFZC 4BQ6A 4MZ2A 5ABDE 2XZZA 4G5AA 2C8NA 4JFZL 3MNZA 4UINL 1JOIA 5IOPA 1MCWM 3BP6A 1SLUA 3MX0A 1CDCA 3ZBMA 3WGUB 4L3FA 1EANA 3MV7D 3KCPA 2X6AA 1BPVA 5I82A 1WHOA 6FABH 4F92B 2BIIA 5CGMA 3W2DH 4ZX3A 1G7HB 1V55B 3ETBJ 4M5ZL 1QZ1A 1ZV5A 2VQ4A 3SCMD 1K2DB 2ZCKL 3IDMB 1MN4A 4PS4H 1XR9A 2O5YH 3CAFA 5DGQA 5JHMA 1AQ8A 2HPOA 1M71B 4HMEA 4IRJC 2Z7YA 3QUMB 5BZWA 3REWA 5ID1B 4FP8H 4IRJA 3IETA 4PJDE 4DK5A 4OLVL 3T04D 3UTTE 4UQBA 4QPEA 1OV8A 1RZJL 3UYRH 4G8EA 4V1DE 4CU6A 5L7XH 3TESA 4UQDA 2JQAA 2CMRL 2BZ7A 4YJZL 2KPWA 3OPZH 5BW7A 2AKRA 1XH0A 4P07A 3BT2H 1PZ2A 2H4EA 2X2UA 4HUCA 4Y4HB 2WLKA 4NQSB 1CFQB 4F2MB 4I4WB 3MJ9A 3KW7A 2P45B 3RVWD 4WW2B 3WSQH 1AJ7L 1RUPL 3GYRA 3UBXA 5IUSA 2RFXB 4LSPH 1RUQH 3B9KB 3D06A 1RCYA 1A1OB 3ZTDC 4NN6B 2EE2A 4LAQH 4M7ZC 1KBKA 3MRMB 3NN8A 1F8TL 1I8UA 1MUJA 3P3RA 4X6BA 5FDYA 1J0IA 4FFZL 5LGKA 3P0GB 4GYBA 3DSNA 2TAAA 1AS6A 1SVZA 1KXHA 2FVNA 5DUMH 3BE1H 5KVEH 5IT2H 1NMCC 4H1LB 3BFQG 5DJCA 1N0XH 3QJHA 1INQA 1CDUA 2DI8A 5TH2A 5IHWA 1P7QA 3EJTA 3TFKC 2FCBA 3FFCE 2ZKHL 4UDUA 2V0AA 5GGQH 1JK9A 1KNOB 1LWHA 2HCZX 4BXVA 1YMME 4G83A 3T3MB 3S88L 4YUEH 4GKZB 1VESA 2B1OA 3VGBA 2QSVA 3Q6GH 3OR7B 4QI3A 3U1PA 4Z3JA 5IB4B 3N9GH 1OARL 1G0DA 2CA4A 3QYMA 3N43F 2ETWA 4EEEA 3SCMA 4FQ1L 1T1ZB 1JRHI 4JG0H 4E42A 1YY9D 3WTYA 4N2GA 3AU1A 1E8WA 2YN3A 1A14L 4PLKD 4XC1L 4OV5A 2ZWKA 2YSSA 3EJSA 5L9DH 3N41B 1SJMA 1FRGL 3OWEA 4OU3A 1IBHA 3L5WA 4G6FB 4HPOL 4DP6X 4Y5YA 1CGXA 4P2AA 2FT6A 2EE0A 4QRUB 5F6HI