1D2PA

Crystal structure of two b repeat units (b1b2) of the collagen binding protein (cna) of staphylococcus aureus
Total Genus 92
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
92
sequence length
373
structure length
373
Chain Sequence
ETTSSIGEKVWDDKDNQDGKRPEKVSVNLLANGEKVKTLDVTSETNWKYEFKDLPKYDEGKKIEYTVTEDHVKDYTTDINGTTITNKYTPGETSATVTKNWDDNNNQDGKRPTEIKVELYQDGKATGKTAILNESNNWTHTWTGLDEKAKGQQVKYTVEELTKVKGYTTHVDNNDMGNLITTNKYTPETTSSIGEKVWDDKDNQDGKRPEKVSVNLLANGEKVKTLDVTSETNWKYEFKDLPKYDEGKKIEYTVTEDHVKDYTTDINGTTITNKYTPGETSATVTKNWDDNNNQDGKRPTEIKVELYQDGKATGKTAILNESNNWTHTWTGLDEKAKGQQVKYTVEELTKVKGYTTHVDNNDMGNLITTNKYT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Novel fold and assembly of the repetitive B region of the Staphylococcus aureus collagen-binding surface protein.
pubmed doi rcsb
source organism Staphylococcus aureus
molecule tags Structural protein
molecule keywords COLLAGEN ADHESIN
total genus 92
structure length 373
sequence length 373
ec nomenclature
pdb deposition date 1999-09-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF05738 Cna_B Cna protein B-type domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1140 Mainly Beta Sandwich Immunoglobulin-like Collagen-binding surface protein Cna, B-type domain 1d2pA01
2.60.40.1140 Mainly Beta Sandwich Immunoglobulin-like Collagen-binding surface protein Cna, B-type domain 1d2pA03
2.60.40.1140 Mainly Beta Sandwich Immunoglobulin-like Collagen-binding surface protein Cna, B-type domain 1d2pA02
2.60.40.1140 Mainly Beta Sandwich Immunoglobulin-like Collagen-binding surface protein Cna, B-type domain 1d2pA04
3RPKA 1D2PA 2XICA 2X9YA 3B2MA 3GLEA 2Y1VA 1D2OA 2X9XA 3GLDA 2XTLA 4BUGA 2X9WA 2X9ZA 2XIDA
chains in the Genus database with same CATH superfamily
2F54A 4OLVH 5TDPA 1QFUL 5E24E 4XPAL 3FAXA 3OPZH 2UVFA 3D2UA 1XX9C 3ZTJH 4YSRA 1BAFL 3N85H 1S7RA 3HMWH 2F15A 4AE0A 4BQ8A 1X3DA 2BM3A 5DF0A 2VZ1A 3FO9A 1JD7A 3F7YA 3LZOA 1KOAA 4P46C 4LGSB 3DMMA 1O7DC 3IVKA 1FVCB 2D3NA 3EO9H 2O5ZH 2W9EH 3Q5YA 3L7FA 1RIUH 4FQ1L 4PJIF 1RZFH 1T6WA 2OSXA 2HFGH 1A14H 3B6SB 4HF5H 1K5NA 3DV6A 5A43C 4FOMA 2XQYG 3OG6B 3CVIH 2C9AA 4ODUB 3PJLA 1CXIA 1YPZE 4PYGA 1KULA 1Y0LA 4ZFGH 4KKQA 4YHML 1X44A 3N41F 4YL9A 2A77L 3DOIA 5CNHA 2CAKA 1UT9A 2CPCA 3D52A 4W9LC 1SJHA 3HG1B 4AYBA 3FFCD 4GP4B 3GUTB 3H9YA 4PV9B 2UWEB 3K2UL 4Y5VA 3EJSA 1RHFA 2R69L 5K1NA 2W5PA 2IG2L 2WGNB 5LB1A 3U7WH 1M2VA 3VXUD 2AXGB 4PJEA 4PWIA 4M7KH 3OWRA 4FQIL 4IMLA 3ARRA 3VU2A 4A2GA 3W1ZA 3RGVC 4MB4A 3QO1A 1A8ZA 2O6PA 3CVIL 4FG2A 2ZWSA 3ZQXA 3VFNB 1CF1A 3DYPA 3FNKA 3MNVA 4Y9FA 1AH1A 2EH8L 4ADGA 2D0GA 1OB1A 4Z78B 4F8PA 1FAIH 3DSFL 5EC2B 5D70L 3VA2C 4O58H 4AC4A 1HN1A 1FH2A 4X4YA 2ZUXA 3T4AC 3WHXB 4U6TA 3X11B 1RK1A 4LNVA 3REWB 1C16A 2X2HA 1YG9A 5GGSA 1C5BH 1IC5L 3CPLB 5E8OB 5HTSA 3T0ED 4J6RL 3W0WD 4OTXH 2YKLL 5CBAA 2FBJL 2QJDA 5B39A 3FKUS 3PV6A 2XG5B 4TKWA 3WELA 3HCVB 4MA8L 3F7VB 4HAKA 1FFNA 3TV3L 5FS5A 1MLCA 4MRBA 2OMVA 2EXTA 4XPFH 3VFMA 4WDIB 4AYSA 3ZYOA 4WWKB 2FJFA 1ACZA 1YNTA 4WO0A 5BJTA 5D2LB 3X17A 1CQYA 4QIRA 2BVEA 3EF4A 2R0KH 3FDWA 2O93L 4OD1L 1SDDA 3UJJL 3JTTA 3OKMB 3RJOA 1KJVB 4NZDA 5F0LB 1F4YH 2DS4A 4TQ8A 4AVIA 3PHOA 2I7OA 2J44A 3EJUA 2BWDA 4EZKA 4NCC2 4HIJB 1OAXH 1B0RB 3IDYB 1DQLL 2F53A 3NA4A 4KZDL 2OI9B 2AHIA 4OFPA 1QSED 3CC1A 5L4JA 1J9TA 2DQJH 1SEBB 3WEOA 1XL4A 4Q58C 3WFEL 1UOVA 4FQLL 3N04A 5I1DB 4PRIB 2YAPA 4YDIH 3D30A 5BV7B 4JRFA 3IJHB 2IAAC 1OV8A 4QXUL 2N0KA 5E2JA 1S7XA 3PE9A 1MVFA 3BH8B 4PJHF 4U6VH 2NX5D 5FUZL 4F37K 1IT9L 1REIA 1U95B 4S0TD 1WA1X 1T0MA 1JK8B 2YMOA 2ZOLA 4BQ9A 5TGBA 3UFIA 4O02A 4I1PA 2APWA 4FKEA 4A2LA 3GPEA 1WA2X 5F3FA 1IQWH 2XQBL 1KZYA 2OXHB 4NUJB 3NCYP 1EFQA 2JWYA 2AJYH 2FSEA 5KYXA 4MD0B 4P0DA 1NCWH 1GYAA 3VG0L 2X6MA 3L5XH 1C7SA 3BPNB 3KWVA 4MJ6B 4GSDH 5DK2A 1RUPL 1SLUA 1I82A 3RUGB 2CDGB 5D72H 2EAEA 3DGGB 2QDVA 2YSSB 1H3GA 1O6VA 2X3AA 3PY9A 3PS6A 3VI4B 4TTDC 4DFIA 2DWYA 2G60H 4HS8H 2XWBA 3IXTB 1MCEA 3GXIA 1ND0B 2XXFA 3D51A 4KMQA 5IESH 3ZDZB 2JCCE 2N4IA 2ENYA 1LO5B 1MPAL 1DVSA 5E03A 5LDSA 4LFHD 3Q8FA 4WU5A 1SFHA 1DBJH 3HW7A 4ZO8A 1KJ2B 1XSOA 1T1WA 2PPFA 5FA4A 1JVKA 4Z8FH 4UINL 3HR5B 3K72B 3VWJC 1NBVH 2G75A 5GRXG 4MSWB 2OZ4H 4WW2A 3NMEA 4N3TA 2IV8A 4BINA 1YEGH 5TFSL 3S4SB 1AHMA 2X6BA 3H53A 4NQED 1GOFA 3AU1B 2BIHA 2XETA 5ACZB 3AG2B 3RDTD 5K1JA 4KI5D 3KYOA 5KSBE 3VXRD 2WSDA 4IEFB 3HBQA 5FYKL 1BX2A 1OPOA 3PXHA 2NNAB 1XGUB 4F9PA 3ME0A 4DAGH 3LNDA 4ZMPA 4PP1C 3CFBB 4EDWH 2H5UA 5C3IA 5GGRY 4YSDA 2WBJD 3LIZH 4KX7A 3C8KB 3HZ3A 4LOVA 2BFGA 4XMPH 5DK3A 2XVBA 3I6GB 1YMHA 5CZXD 3ZO0A 4JRYE 3U4BH 5AAMA 1FZOA 3F01A 4Z7WE 4XNUH 5GGVY 3O3AB 4L05A 4M29A 4XH2B 2WNWA 4LF3B 1BZ9A 3T1FB 4R4FH 4L8BA 4CA4A 4Q2ZB 5CCGE 3AS3A 2VAJA 4K3EL 1NEZB 1I8AA 4G8IB 3ESNA 5E9DA 4H1LB 1A7PH 4YFEA 3MLWH 2YPLB 3BDYL 2ZQKA 2ALAA 5DLMH 2RALA 4GRWB 4HWBA 4FCHA 3KG5A 3ARPA 3MBXH 3D0VA 2ID5A 3VGAB 3N1MC 4XPBH 4Y4FA 2PYEE 5IKCA 1HCYA 1IE5A 2NYKA 3MJ6A 2MQCA 1FCGA 2WZPD 2KQMA 2WVVB 3NPSC 8FABB 2OA9A 4AEFA 4F8LA 5HGBB 1HEZB 4U6YA 5B1JC 5EV7A 4M8QB 5LGKA 1XSIA 5FUOH 2LGNA 1LD9B 1NC4A 5EU6D 4YSUA 1XD1A 4WUKH 4OQTA 1MELA 1T3FA 4YS4A 4MXQC 2NNFA 4JDZA 1HS6A 3BZ5A 1CUOA 2ISDA 5I76A 4TUKL 3D25A 2NY7H 3BRGC 4E68A 1CE6A 4DP5X 1CURA 3WFBH 1A0QH 4GG8B 5FCSH 3EGXA 4EBQH 2LU5A 2YXVA 4GI6A 1CLCA 2BXZA 1C12A 4PJ7B 5F7UA 5FW8A 1TQWA 1OGAE 4KO9A 2EEBA 2OXGB 3T2PA 4F3FB 1JNHA 4TQIA 2H1PL 1LLAA 5KVEE 5DMGC 3N91A 1D5IL 5EUOB 4QOKA 2ODHA 4MAYA 1U91A 3O3BB 3QE5A 1UADC 4DEUA 4D0CB 4FTVD 4YDZA 4H0IA 2PP7A 5FYLL 5K39B 2VSDA 1H3WM 3KVDD 1LEKA 1UQSA 1WAEA 1UXSB 5E2UL 3DPDA 1RP8A 4GSXA 3WY4A 1Q9LA 4POZC 1HNFA 4JRXA 4Y4KA 3RILA 4LP5A 1AQHA 4HKXB 3DVGB 4ETQB 3DO4A 4KRLB 1EHLH 1BREA 4TNWK 1G6VK 2FR4B 3HPLA 3FQ4A 4M3KB 1NL0H 2LU7A 3WKNA 3P9LB 4PVLA 1IBGL 3H9SE 5AG9A 1XTMA 2WYIA 1T1XA 3SE6A 3V4PH 5SX5K 4LASH 3VUAA 5HHMD 1A0QL 1UOKA 3GSOB 4HFUH 4TUKH 1A6TB 3MRMB 2CG9X 2NY1C 4ZNEE 2KS0A 5HVHB 5ALBH 1TLKA 4M6MH 3C5SB 4FFWC 4GXVL 1UJ3B 5IIEB 3QCVL 4GUPA 5LAXB 5TDPB 3BFWA 3NJIA 4OZFB 4GYBA 4BV1A 3T65A 1AG0A 3TASA 3W56A 4TUOB 2MIZA 4ZXBD 3BAKA 5MEQA 3IAGC 3VD0A 3WMQA 1ZDQA 3VD3A 4PPTA 3FU5A 3QFGA 4JFYB 5E70A 1MCRA 1P5UC 4XPBL 4AQAA 1OW0C 1VA9A 4K8RD 4HT1H 2ZCHL 3K81A 1IC4L 1KC5H 1RUQL 1H0DA 4EEEA 4N2EA 4YEFA 1FO0B 1A7PL 3V6FB 2R15A 5LKNA 3IVKB 2P80A 2R2CA 5D8JH 1JXDA 3GRBA 1T5WA 3FB5B 4R83A 4V2CB 4OD2A 1UKQA 1ZT7B 4DP9X 3ZE0B 1U8IB 3BD5A 1FNGB 2FJHB 4XNUL 4CN4A 4F9PC 5JW4Q 3OMIB 4PTUA 2O61A 4ODUA 4GLRH 4KKCD 5KANI 3OHXC 2FLBT 4NPYA 4UQ2A 2R29A 1LWHA 3GUTA 4EDWL 1QRNE 3CDGB 3EDKA 3M7OA 1HKFA 3AG4B 3GTVA 4PV9A 5LCVL 2UWEA 3ULSB 4DAGL 2DEWX 3T6VA 3TO4D 3KEHA 5AOKA 2VMEA 1Z9SA 3A22A 2VZUA 1WQVT 2VB5A 4GRLB 2HX9A 4L8DB 5FYKH 2OJZH 4XVSL 4WFHD 5FYKE 1CD9B 2F6AA 4GRMA 4GUCA 1LDPH 5H2BA 5A2FA 3U2JA 3BPOC 4ZPVA 3I6LE 3P3SA 3Q13A 1XEUA 1HSBB 2AQ2A 3NFSL 2VT0A 2PMZA 5E1AB 2H2SD 1RZ7L 2VLLA 3B4NA 3CJJA 4UT6A 4Z78A 4HC1A 2OTUB 4ZOEA 3NZHH 4A68A 1EDYA 2XN9D 1CQKA 3AG1B 1OGAA 5DUPH 1JYXA 5KBDA 1XR9B 2FECI 2A6DA 1RK1B 2WV3A 3BAXA 3SKOB 2PTTB 1BM3H 3Q9PA 4LCCC 3HFMH 5C1MB 1F58H 1A6WH 5J3HC 1WRFA 2YOAA 3EGDB 4O9HH 2WKOA 2Y0SA 4IRSA 1GZPA 3MROB 5TE6H 2DLIA 2DWXA 5EF3A 1EV2E 3HI5L 2YMTA 4WDIA 5IW6B 4OZIF 4GW5A 1Z9NA 5L0QB 2A3TA 2XPGB 1A7BA 3RYMA 1LGVA 5T1MA 5JPMB 1U8QB 4OLZL 5FO7A 5IP4A 2ZUUA 2CJTA 4KXBA 5KSAA 3OKDA 3JTTB 1UH3A 4OGXL 4XVJL 5CGMA 1RUPH 1AR1C 4K55A 3R4RA 4KJPC 3LKPA 3NIFB 5F0JB 3VG0H 3CGTA 2WM0A 2L7QA 3CZSA 3PHOB 4HHGA 4P8QA 3UIYA 3VO0A 2AJYL 1D6VH 4HIJA 3S98A 2IOMA 2LAAA 5LLIC 5I5JA 2ED6A 4P5KB 1G1OA 3QBTB 1ZV5A 5B3JF 3QFDB 3JV0A 1SN5A 4KRPC 1WHPA 5DEGB 4RFNB 2E27H 1RIVL 3GSNA 4Z7OF 2P47B 2B1OA 3O6KL 3SQBA 1QLRA 2AVFA 4NNYA 4JRYA 4U6VL 5FUZH 3S9DB 1NCAH 1ONQA 3VH8G 2D8KA 5D5MA 3IDXH 3QDGD 4A2MA 3S2CA 4DGIH 3GK8H 2H9GB 3GZOA 4K9EC 3AROA 1C8QA 3K6SB 2WVSA 4FQLH 3FUEA 3I50H 4Q52A 5C08D 3WY3A 4JDEA 4EN3A 2GJPA 3JVGA 1BOGB 3MGOA 3KLSA 4BYHA 2EYRA 3EF7A 3K6OA 3V0WH 3IYLW 4YL4A 1DQLH 3IGAB 4R2GC 3U1SL 4YH6A 3UJIL 2VC2L 1JWSB 3L9BA 2WQUA 1RUAL 3U1QA 1NDMA 3STZA 4D0DA 1P6AB 1U36A 3TN0D 2X1QA 2XV2A 3MLXL 4JFVA 3EJZD 3RUGA 1MI5A 5JQHC 3GXFA 3TEWA 4GQPH 2HRHA 1CS6A 1U8LA 2COVD 1YNLL 2UY7A 2XIBA 4IJTA 3O6MH 4KITB 1H19A 2FX7L 3Q2WA 1QFWM 3IXTA 1MRFL 3QFJD 4XPFL 3BIBX 2FWOB 5K9KA 5I18H 3FH7A 3L3DA 2B4CL 4FXGB 2DI7A 4N6QA 4W9GC 3DURA 3ESUF 2FBJH 4ZFOA 2JQAA 2DV6A 5I8EA 1PDKA 3WN6A 2A6JA 4J6RH 1CGXA 3DLQR 4LCIH 5DJAB 3NK3A 3FOMB 5HYJE 2PUQT 2PO6D 2YEZB 3RGVA 2QSQA 1G6RL 3HR5A 3FRPA 3K72A 1WWWX 2VXSL 4NO2A 4OGAD 4ABUA 3D34A 3AQYA 4ISVB 3KNBA 4RGOH 5KYWB 5AZ2H 2E75C 4U1IB 3QRLA 3S4SA 2X87A 3MBEC 4JK0D 3L8QA 4PJ5B 4LGPB 5F97E 4ADJA 2GAZB 3BZ4A 4HAGA 4AQ1A 3NVQA 5MERA 4B95C 5E6ID 1SOQA 1FFTB 3G5WA 4AT6A 3TTSA 3WO4B 4X9YA 1CLOL 3K2UH 1JL8A 1KTLB 3MREB 3QAQA 1AXTH 4FJ6A 1G7JA 1KTDA 1X9QA 1YEJL 1ZHNB 5CUSH 1BBDH 4FI8A 4GFTB 4HXBL 2A77H 4MMYA 4MJJA 4XNYH 5DD1L 3U6RA 2NUPB 4I8DA 1U0QA 1QSFB 4KI5F 5GRUH 4IIQB 4YDVB 2HWZH 1GGYA 4R0LB 2H32B 2J2ZA 2WZPA 3O3AA 1F6AA 1ZLWH 1R3KA 1PLBA 1HWHB 1RZFL 1MNNA 4TL4A 1JN6B 1BZ9B 1RIUL 1YUHB 4FQ1H 4DUVA 5IB4B 3TNMB 2O5ZL 3BFOA 4EF3A 3POCA 3HE7B 1Q90A 4BE5A 4EI5C 5T1DL 3MLRH 5E9DB 2V7HB 4N5ED 5EA0H 3GXPA 1D9KD 2YMXH 3K4ZA 3B9AA 1I8LC 2LQRA 2Y22A 3GO1L 4EIBA 3H9SA 1A5FL 3D0VB 1T4WA 2R4RL 4IHBA 4Y16A 2BZCA 2X41A 1C5DA 2XTJB 3FT3B 3EO0B 2I07A 1LEIB 1BJMA 3ULUD 1TCMA 2GBVA 2NYZA 4X0KA 5ESQA 4HK0B 1QFUH 1HEZA 2D3VA 4RAHA 2JNZA 3GXDA 5FUCE 2MQ3A 3JUZA 3E0GA 2PPCA 4R90L 1RZKH 1J05A 2J6EL 4Y4HC 2WQXA 1KN4L 2YR3A 3CLFL 2F0CA 2J21A 1KIPB 1OAYH 4MJ5B 5F9OH 1CGYA 2PPAA 2JTYA 4GG8A 4WY7H 3VXMA 1C12B 1FRGL 3PHAA 2E8ZA 1W91A 2Q10A 3MGAA 3BPCA 4QUOA 3ARFC 5SWSA 3WN5A 1A4BA 4KMTH 1JNHB 2YXFA 1KTRL 2C9PA 3A4DA 3NA9L 2XFGB 1BXUA 4HPYL 1T0OA 2VOTA 3GSNL 4KTEL 3WNJA 2OSLA 4TPRH 3VB9A 1ZA3B 3P3YA 5A6LA 3JWDC 3FU8A 1ESOA 2J5LB 4F80A 5LN8A 1SHMA 4PSRA 1S7SB 3MLUH 1LEKB 4M1CC 2VL5A 2V17L 5LHDA 4WO4D 1E4KC 3P4OB 3R7QA 4UNUA 1N10A 3F85A 4QTFA 1USQA 5D7IF 4OFYD 2VXQL 1TOXA 3BQUC 5KSVB 1U93A 3WJJA 2NY4D 1PD0A 2RFXB 2E7LA 4OZIE 3K2MC 1YY8A 2IPTL 3MA9L 2W9DL 2WXGA 5E9DE 2HFTA 1HINL 3RKDC 2N1KA 3GSOA 3NEOA 3KPSD 1CU4L 3TWCH 2VMJA 4DVBA 1P4IH 1UA7A 3MRMA 3V0IA 5FECB 3ZKXC 3V5DA 3I75A 2HX8A 3D3VE 1FGVL 3ABLB 2E7MA 2NCEA 3QHZL 1ROCA 1A4CA 4D9LH 1HHJB 4NUGL 4D94A 1GOGA 4KK8C 1PIFA 1DQQB 4GUOA 1BMZA 1A3LH 5SV3A 1EXUB 5I6XC 4ZUVB 4LP8A 3HE6C 4GG6E 3D0LB 1CK0H 1J5IA 1DANU 3L4CA 4UDUB 4W6YB 4X9HA 1GS8A 5LDUA 1AC6A 3LZRA 3MRFA 3WKML 5LO7A 4CU7A 3GI9H 1T5WB 3ZT5A 1X5JA 4OD2B 3EO1A 5F3HB 4UZSA 2BIOA 3DRTA 2NQCA 4E9TA 4XBGA 5GRYA 4B60A 1ZRUA 4XNQA 3B34A 1QRNB 1Y1DA 2Q20A 4LLAA 4M00A 3WIHL 4A67A 1IZKA 2NY3C 3ULVE 3COOA 3QQXA 3SDYH 3K71B 2FNWA 4Z7IA 1N6QL 5IF0A 3OKEB 2UWEE 4UM8A 1KXHA 4P5MB 4U6XB 3F2LA 4W9DC 2VLKE 1NGPH 4M5SA 4I9WD 4ZRGA 1RMFH 2V3DA 3HEIB 2HP4A 1TVDA 3UJTL 4XVOA 5SWQB 4NUGH 4OFDA 1GGCL 1XWVA 1UM5L 3RNQB 2G2RB 4GRLA 1YMMD 3FT1A 5D1XE 3B5TA 4RFEA 4F2MB 4S0HA 4LCCA 4N2HA 3RQ3A 3Q06A 3V6OA 2CNYA 5C7XL 2IF7A 4DTGL 3HJ0A 4ZQKA 2CM6A 1JGLL 4I48B 5E1AA 3QWRA 5DD0L 2Y1AA 5LWYH 2Q8AL 2GK0A 5DT1H 2FLMA 3G9VA 4GSQA 4DP7X 3KXFB 5CR1A 2ZOUA 4FABH 1WSST 4KY2A 4ANKA 3VGGA 1MCCA 1N5YL 4MHHI 1RZJH 1HYSC 3FSOA 1QLFA 2V2XB 1D5XA 1QFHA 4QRBA 5CF3A 4FFZL 3MZGB 3LS4L 4E9WA 3GC3A 1RJYB 1BFOA 1HHIA 2ENJA 3MRGA 3CG8A 4TRPH 1MCOH 2VITA 2ZX5A 3V4UH 3WEXA 1HQ4B 4FQQA 1IBDA 5FC9A 2XWRA 5FK9B 1A9EA 2VKXA 3AUWB 1UEMA 3FFDB 3KLKA 2A6IB 4FG0A 1L5GB 1MREL 4P4RB 2EABA 2A9AA 4WWOA 1JF1B 5AVTB 5A6IA 2W0PA 1HOCA 2QSCL 3B3IA 4G8GD 3TPUA 4GW5B 4RMWA 3IF1A 1UYWH 2YA1A 4AJ0A 2VMCA 4IBLT 4TQPA 4Y5XA 5T1MB 4AENA 3GSUB 2JKWA 1L3WA 4OM1L 5FYJE 4BFGA 5JPMA 2C4FU 1XF2A 5A40E 4XPGL 4WCYL 2CO3A 4TPRL 3UAAA 5KSAB 3GSNH 3QPQD 4KTEH 1AQ8A 3KL5A 3DXAA 2NY6D 4UQEA 2N01B 4G9FA 5FX3A 1UXWB 2F53E 4PWHA 3I6KA 1OGTA 1KT2A 2HH0H 3WTWA 4KK9C 1M4KA 3CHRA 1Q0EA 1FFOA 3EH1A 3FBQA 2DL9A 3IGLA 3QFDA 4DKFL 2R51A 2VYRE 2G0KA 3CHXA 4NQQA 1JGVH 5D7JD 3VNYA 5DMKB 3DTXA 1UCTA 3D18A 3U30B 4NNYB 1YDPB 4YSEA 3MXVH 3KGSA 2WZ6A 2J6EA 4KWUA 4HV8B 3HN5A 4YSCA 2X4RB 4JDVB 3VGFA 3GXMA 4LGRB 2AMUA 3WG7B 2VDKB 5JQIB 4X8GA 1S9YA 4A63A 1PQZB 1PL3A 3ESMA 3UCRA 2FZ3A 2R4RH 3U2SA 4UTAA 4FF9A 3ARED 3ZKND 3T8VA 3CFEB 2J1WA 3QUKA 3HAEB 3L2MA 1PZSA 3V0AC 4RA3A 2YLKA 1SYSB 4IRJD 1P7QB 1MG3C 2W38A 4XMZA 3UZQB 3PWNB 3AQDA 1P53A 4L3CA 1EWHA 5BPPA 4XNYL 3TBBA 3DX3A 3HS0B 5CUSL 2X4SB 3MRPB 4AJYV 4ELKB 1DVZA 3LYRA 4X2UA 3W3BA 2FK9A 3QNZB 3VXSA 2ZXCA 1U3HA 2YIHA 3OAZK 4ODHH 1VGKB 1GJIA 3ZSSA 2PW2B 5AENA 2R8SL 3NCJL 1LL1A 2GSMB 5GPRA 3VJ6B 1J88A 1ACXA 5C0EA 5AOJA 3O3DB 4DP8X 5E08L 4Z7WB 2GFBB 1WC7A 4JM4L 5L2JA 2F1BA 4W9EC 1W0VB 2FYYB 4PWFA 3APFA 3V5HB 4CMMB 2D9QB 3S5YA 1GZQA 1KBBA 3PQYB 3KNBB 4YFLF 4M93C 2ITEA 1JWUA 3IGKA 4HAFA 5E6RB 1SHSA 4OB5L 3LKSA 1KIRA 3AS2A 2CIIA 5AQ0A 2CRMA 1I7UA 4U05A 1MWAL 3SDCC 3T0VA 5FO8A 5LNEA 5EG6C 4Y5XC 1RK0B 3DGDA 5B38A 1F41A 5GXBB 5AB0A 1CLZH 3ESOA 5TTRA 3QCUH 4Z6AT 4KKAC 5C0IA 5C0RH 2HVBA 5T1KA 5I1IH 3TEXA 1RURH 4ZMLA 2P7TB 3FPYA 1QTPA 4KFZC 2MPVA 4LDLB 1KTLA 4RIRB 5CWSA 4ZUWB 4FTDA 4G6ML 4M1GL 5LQBH 2KZ1B 1BJ8A 1CE1L 4RMVA 4ATWA 1MRFH 2B9AA 4WIQA 1YPZF 5AKRA 4QR7A 5FAAA 2FNBA 4AOFA 3O6ML 1Q72L 1QKZH 3EHBC 3BZFB 2JB5L 4Y2OA 5H4ZA 4PRIE 4A38A 3WE1A 1WFOA 4HUWA 3SGEH 3UEQA 4AM0B 1U3ZA 5FFGA 2RQ8A 4LEOA 1QFOA 5DJ6B 4RMUA 1AD0A 1ASPA 3L1EA 1P1VA 2G4GA 3H9SB 1F2QA 2X4NB 3V0WL 1C5DB 3C5XA 1F1DA 3Q44A 1YMME 4K5MA 5CP3A 4C4KO 5CP7A 2YRLA 3R4DA 3W38A 1RZ8B 3BW9B 5BMFH 4RDBA 1N7MH 2CR0A 4N2IA 3O8XC 4I9WE 1SOKA 2JJSC 1YEWA 2NUTA 4XP5H 3QUYB 3S34H 2ADIB 2WTPA 4XGZA 4C56D 5EO0B 3OAUL 2C3WA 2F58L 2DN7A 3CZLA 1BPLB 4PG9A 5KAQF 3BMVA 3CZKA 2ZAIA 3O6KH 4ODTL 3NP4A 5KW9L 1IM9A 2WWNA 4MJ5A 2QVFB 3KBHE 3KCPB 3NBNA 1LE9B 4PR5A 2CD0A 5C07B 3T2NH 3AT8A 5GQBA 2ZOKA 3NCMA 1P7KA 1P4BL 1CDYA 3GUFA 1KCWA 1TT6A 2X1XR 4LCWE 8PAZA 1ZT4A 1R5IA 4PRPD 3QQNA 1JHTA 2X38A 3MA7A 4RAUA 2XQYA 3TWYA 5KW9H 1SN2A 5I8OH 1BQKA 5A2CA 2BJML 2CPUA 2GTZB 3JT2A 3QFJA 4PQXA 2W0LA 2F58H 3TBVB 3T1WA 1BF2A 1E30A 5EIIG 3PAZA 4HCRL 1S3RA 4L0PB 4XWOC 1VFAB 2XTJE 2XZZA 5T3XE 3UZEA 4I88A 4U1JA 1LP9B 4A6YB 3VSUA 5I73B 4HPOL 1MFBL 5HDQL 1I53A 2AEWA 3O0RL 2YGPA 1U8CA 4JB9L 3C5ZB 1R1CA 2E76C 1BM3L 2Y3NA 43C9B 5AFAA 3QUYC 2YPKA 4N2CA 5E9DD 3LB6C 1AO7D 3FH8A 2IDUA 2BIPA 4HWBH 3ES6B 1YY8B 4GRWE 1SBSH 1Q9OB 5E4OA 1UD2A 1CWVA 4ANUA 4OF7A 3K4AA 2VN7A 2Y23A 4GQQA 4C59B 1E5YA 2XVLA 1MNUH 4QTHB 2XWEA 3I75B 1J48A 5C70A 2WN2A 4KC3B 3MYJA 4MXWH 5EEZA 3H4HA 1CFNB 1I7RB 3LQMA 2NXYD 3DARA 4JFEA 1QZNA 4Z95L 4Z7OB 5AAWA 4H8HA 1RURL 3PABB 5I1IL 4PH8A 1EXUA 2Y06H 3AY4A 3DBXA 5JIQA 5DMYA 1VGEH 1LTXA 3VMPA 1TO4A 4I18B 3G5VA 3T6WA 3LQAC 1MQKH 4IBWA 5DUBB 1LK2A 1CICC 3MRHA 3NK4A 5DD5H 1NM4A 5C0FB 2VRKA 1A1OB 4NN5B 3AUVA 4GLRI 2L7JA 2Z7YA 5GS1C 5K93A 5GSRA 2C34A 1FNAA 3DRTB 3L4YA 2VDOH 4DKDC 4EXPX 5GZOA 1FJ1A 1ZWIB 4JHVA 4U6HB 1BD2D 4HMEA 1ODAA 2WLKA 3H7LA 2KZKA 4TSBH 2ZCZA 4ZZFA 2VLKB 1HQRA 2PYEB 4Q56A 2CNZA 1MLBB 5ES4B 3H9ZA 1VB9A 4NPKA 3QUXC 2WLZA 3GHBL 1RAMA 1A1NB 4JQVC 3GSVA 2WSPA 4AQEA 2QKIB 5SWQA 3PL6D 1QWHA 4U0RB 3KLAA 1CF8H 5F89B 1QSFE 4M8UA 4J12A 5AVRB 4IDJH 4RFEB 1MFEL 1RJLB 3EFFA 4CSTA 4NO3A 2Z8VC 2LU3A 3D69A 2V2WB 5JW4M 3BXNB 1BPVA 3JV6A 1RV6X 4I48A 2O26U 2HUEA 2UYLB 3MUY1 2BDNH 5F7LB 3TBSA 3K8KA 4NKOA 3QC6X 4QYAA 4GG6B 5HI5D 3KXFA 5DJ0A 5E56A 4W1TA 4NHCL 2PCFB 4JN1H 2V2XA 4MAYC 4R84A 1F97A 3PDGA 2EJ1A 3BT2L 1NL0L 3NSCA 1RJYA 1JOIA 2XU9A 4FLHA 3KYKH 1D5BB 3EZ8A 5JOPE 3RBSA 3NQIA 1HQ4A 3QDGB 4FQQB 5L8JB 2IMNA 1G7IB 5GJSL 3N5AA 4FLRA 3OM3B 5DSCB 4JQIL 2FGWL 5DGQA 3FUJA 1U8MB 3TJHD 4M6NH 5E6IB 4DGWC 1QUNB 1EAOA 3UTOA 2GY5A 1PBYA 2LTQB 5BVJA 3VXQA 4L9DA 4NQDA 4WJKB 1UT1A 2CK0H 2OR8A 2BVQA 3HNSH 3H9HA 5GS1B 4XNZB 5H4YA 3MR9B 2HRPH 1D5IH 4MA1C 4X6DF 12E8H 4JFUA 2VR9A 2VUYA 4UNIA 1CYWA 5DFVD 4YHLL 4Z9KB 2XI9A 5HJ3A 3I6KB 4DZ8A 1OGTB 4Z3JA 4FQCL 4Y2NA 1E0OB 2JCCB 1AHKA 4N90E 3UTSA 4HOMA 1KXVC 3OR6B 4NFCA 3ZDZE 2F7RA 4HWEL 3THMH 2X4TA 1A22B 3B1UA 5D4IA 2AKRA 4TL5A 3ASOB 1KNOB 5F7WC 5J11B 4B3VA 3DTXB 3MLYH 2VJ0A 3NCCB 2XSKA 4L8SC 2XA3A 3QXDB 3G5YB 3QFJE 3MUHL 1BHGA 3L3KB 2IH1A 3V2AR 2WBWB 1MREH 1IM3A 3BSHA 1TZOA 3Q5OA 2X88A 1SJVA 2WANA 4PN6A 5F9DC 3OGOE 1P6WA 4ZO6A 4IS6A 4KMLB 4OLWL 1V3LA 4G6JL 2IADB 4YHPB 5IUSA 3NJJA 1PQZA 3LS4H 4HWZB 3QZMA 3K80A 2FZ3B 3C75A 3UH8A 2VDNB 2XN9A 1ZLDA 4I5BA 1AO7E 1GZHA 3BDYH 4N2FA 2XV3A 4X6FB 2WCGA 4HVBA 1R5VB 1NANH 5DD0H 1VFBA 3OD3A 2BSED 4JS7A 4KOCA 3P11L 4FYTA 1I9RH 2DWEB 2FUQA 3JVGC 4RWHA 5C97A 4XXWA 1SYSA 2WTRB 4MD5A 4YXHL 5B8CC 4I2XA 4P05A 2YOCA 1MCQA 3MX0B 1GGCH 1AJ7L 2GJJA 2ZYHA 3L48A 4G8FB 2NX5A 3HS0A 3RDTB 1IKFL 3QUGA 3W2DH 1T21B 1TNMA 1Z5HA 1ZPUA 4PP2B 3VXSB 3BEVA 4QCIB 2AK1L 2GUYA 2NSQA 1I1FB 4PJ5D 3SDYL 5KVFH 2KYIA 1JRHL 4MS8D 1I9EA 3QJQB 1VCBC 1IQDA 3M17B 4LPWA 4L3EA 2DQTH 2JJUA 2JKLA 3HG5A 4UQ3A 3Q7JA 1W0VA 5TFSH 1HESA 3TP4A 1G9ML 2XV6B 3EOAB 3FQUB 1OZTG 4FEIA 5D93B 1JWUB 2YAEA 5T3ZD 1BG9A 1FQ9C 4HKBB 1UA6L 4UOW1 2CIIB 4G8EB 4AV4A 2A6KB 3KGRA 2BCKB 1IX2A 1I1AB 3AB0C 1RK0A 4C56E 1UB6A 3ATEA 2DF3A 1G0DA 3K0WA 5AUMB 4Z76B 2QPDB 4XX1G 1JGEA 5LAPA 1A3LL 3X2QB 4K23H 2XZQL 1KYUA 2EC8A 5AL8A 3S3JA 2X6CA 4IRSC 2RTTA 2NZ1A 3M1BB 3BIKB 4N0RA 2OJ1A 3WMSA 4PJHE 3QI9A 1AVAA 4BSVB 4GS7C 4YLQT 3S37X 3MRDB 1S78C 4HS8L 4EKJA 1KIQB 2ICEB 4Z77B 2ZUSA 3ZDXF 1PIGA 3KYAA 3ZTNH 2J8HA 3MCKA 4PY8J 3H3BC 3ZK0A 4MNQB 4AM0A 3HRZA 4JE0A 3ZN6A 4CILA 5DZOA 2JQMA 5C0JA 5IVXB 3ZDXB 2ROYA 4DOHB 4LEOB 3UBFA 2EDWA 4NP4L 2J8UB 2C9RA 4PRID 2CIKB 4QY8A 4H5SB 4Q9QL 1AD0B 1LVEA 2WO3B 2Y6SC 5KSAD 5LBSL 1N8ZA 2OR9H 3I6LD 3SZKC 1YEDB 4CVZB 1WFMA 5AKSA 3FAWA 4N8PA 5D6CA 2P24B 2CMRL 3CWGA 3TL5A 4MJ4A 1HHGB 2HLAA 1IT9H 1FC2D 1DSFH 3TJEH 1HI6B 1ACCA 2EDHA 1MY7A 5IZ7A 3OHXA 4TF4A 2BWIA 3C9NA 2IDFA 3Q1SH 3ZE0F 4QRPE 5DR5L 1KPRB 2BHFA 1HL4A 2DKUA 1KFAL 3TXAA 3VM5A 5F1SA 4YIQA 4PJ7E 2IGLA 4NIKB 2DD8H 5EUOF 1JFQL 2R23B 2Z7UA 3QWRD 3HE6D 3MZTA 4H8VA 3VNZA 1D2PA 3C2AL 1BBJA 3M86A 5J6HA 2X44D 5MI0C 5DURB 3IMUA 2QTVA 1A3RL 1M05B 3RBGA 5EDXA 1IGML 1OAYL 4RAUB 2YD9A 3QQ3A 3EYFB 5E00B 2E74C 1XSKA 3GMNA 4MRCA 4UT7H 4BA0A 1RZKC 2KL6A 3MRLA 3QXWA 4GAJL 3IFOB 3MMEA 5ALCL 1MVUB 1E67A 3NCBB 3KPRB 1KCVL 4DO4A 4J23A 2QPSA 4MCZB 2H41A 2OAAA 5KVEL 4QD2E 1S6NA 5I1JH 2ZP0T 5SWSD 4NQXA 2X89D 1MH5A 4XNZC 2XV0A 1SHWA 1XO8A 4ZYKB 3TV3H 5AAPA 2OMNA 5I2IB 5E8NA 4JPQA 4U1JB 1LP9A 4P48A 1CD1B 1GY2A 3E38A 3VG9C 1P4LB 3SE4C 2O5YH 4NC1C 4MNGB 1R3IH 5KSUB 4K71C 3FC8A 1FN4A 2ITCA 2DKSA 43C9A 2VDPB 3D2UD 3D09A 2YPKB 4YLBA 5A16B 2JB6B 7PCYA 5CZKA 4PJXA 2D3LA 3MLRL 4YSAA 1ACYH 1VJSA 2ZKXA 4O58L 4K7PY 4PJFF 4R7DB 3U9PH 2ARJA 3BJLA 1E8ZA 5I5IA 2X3CA 4XE5B 3K2KA 5DTFA 3ROOA 4KXCA 1RZGB 1I85C 3IBEA 4Y5VC 2KPNA 2HWZL 3VQ1C 2AJVL 4YO0A 4Z7VE 1O5DT 5AVVB 2FBOJ 3RZCD 2G2NA 2EACA 3H7BA 3OXSB 5KJRL 3B7YA 3BE1L 5EU4A 1C1EL 5IW3A 1K4DB 1KB3A 2C3VB 2IG2H 5I66B 1TUPA 3AWEA 3R18A 4R0LC 5TH2B 2IFFH 3T0DA 1EX0A 1HKLH 3JT0A 1R3LB 2EE0A 3BVVA 3DBXB 1SUJA 5C2BL 3L3GA 3P2TA 5DYFA 4X98A 3TYFB 4FHJA 5FA3B 4W9FC 4PLJC 2E86A 3P3RA 5EEWA 1N26A 1QFWL 1DEEB 1FNSH 1PNDA 5EU5A 5BUPA 1A1OA 3OKNA 3RA7L 1CIDA 3RWFB 3V6OE 1E5UI 1OLZA 1ADQA 3LZQA 1EDQA 1FORL 5TQ0L 1ZXKA 4AH2B 5MEOA 1ZWIA 4WEBH 5D1ZC 4JN2B 1ZEAH 1NBZB 2GJZA 5DVOA 1NAMA 2B1AH 2CGRL 1BZEA 3TGXA 5EU6E 7TAAA 3BWZA 4LRIA 1K72A 1E42A 4XZ4A 3O11B 3VXPB 5LN4A 2APBA 1U6AL 4YSOA 5KUMA 4N0YH 2JJTA 4R4ND 4AQEB 1D7FA 4KK5D 3VFVB 3KDMB 1AXIB 1S9VA 3IDGB 1RJLA 1O7DE 2WHVA 2WVTA 5DJYA 2EDJA 1K2DB 3HRPA 4JANA 1FL5B 3GHPA 1A9VA 2EH7L 2P3YA 5EZLA 3BXNA 5I1LB 3ALWA 2YN5A 3LPGA 2P8PA 3MLXH 4ZS6C 4K2UH 2UYLA 1P5VA 3TBSB 1GGBH 3GNML 5ABDE 1S7RB 3CHSA 3NRQA 4P06A 4EQ3A 2JK5B 3TT3H 3OKOB 3CN4A 4JRYD 3RVUC 2XVKA 1TJGL 2CUHA 1OPGL 3EOYG 2QDWA 3B7TA 3FO1B 3MRKA 3UC2A 3RI5F 3RZWA 5IEKA 4NGHL 1L3NA 4FDWA 2W07A 3TBTB 4NZRH 3AY4C 4JR9L 5EZIH 3DHPA 1FNFA 1P7HL 3B6SA 5DRXB 2NY3B 4JO2H 2ZNXA 3MV8D 1NCAL 4OGQC 5AW4B 3DV6B 2J72A 2ZG3A 1QUNA 3ULVD 5L7XH 3NFNA 4M8VA 3VXRE 5D2LF 2WP3O 1A4KA 2NMSA 4KI5E 1IFRA 3OB8A 3WLWC 3TPKA 3IFNH 1PG7H 1QI3A 2M8XA 4WEEA 2YD8A 2BH0A 1HT6A 1EJOL 1VADB 3N2JA 4JG0H 3UEZA 3IJYB 1NFAA 4WW2C 5I71C 3LEVL 1J18A 2DEYX 1E8XA 1M2VB 2E4FA 3B5GA 4LBAA 3PWLA 5TK2A 4MQSB 3NPSB 1BD2B 1WA0X 3GS7A 4DGYL 4J3TA 1P7QD 32C2A 3LXCA 3RRQA 4AK1A 3QUXB 2G3ZA 5INCA 2OKMA 5I19L 2I69A 3OB0K 1UVQB 1ZVSB 3QXUA 2JTDA 1SM3H 5AOLA 3RUGE 3C5JA 3VQMA 1FZMA 3I9AA 4ZW7A 4WWID 4F1ZA 3FUHA 5GGTL 2WBJA 2HN7B 3GJFB 3KR3L 3QO0B 4N5UA 4TOYL 4X4ME 3RHWK 3V95A 5I0WA 3H42L 5FM5O 1GPOL 4BM7A 1QWUA 1AXSB 3KWXA 4HJ0D 2KT6A 5KUKA 4P3DB 4P5SA 1HWGB 3DK2A 4U1KB 3CPLA 2UX7A 1TTRA 4I77L 4LVNC 5E8OA 4QRTA 1V8HA 1A6WL 4LDCA 5D7SL 5DRWB 3SGEI 3HFML 2IADA 4W9JC 4WVRA 4YHPA 7CGTA 3TIDA 1IARB 2VDPL 4NYLA 4I13B 4Q6IA 2VZSA 5DUPL 3VFMB 2EDRA 1GKOA 4ES8A 1ZV9A 1RCYA 1Q38A 4G7SB 4IKIA 2YUVA 2DZEA 2ZXBA 4IYKA 4O00A 3BJ91 3O0LA 4G1MA 4ZDHA 2Z31B 1QNIA 2DWEA 2ITDA 1ZPLA 3WGUB 2ATKB 5BRZB 4BDVB 5D71H 4UIMB 4ODVH 4UANA 5AD0B 5JMOC 4XVSH 3EG9B 1XF5B 3MX0A 4UBDC 1L6ZA 4PRPB 5EFIA 1I8MB 1B0RA 4RETB 2ZIDA 4FNPA 4J4PD 4DO5A 3R0MA 1DL7H 1KENH 4XWGH 1T21A 4HU8A 4PP2A 3QDJD 5CM1A 1LWRA 1BIHA 2J3SA 4G6AC 4B7LA 5ECGA 4QRQA 2X0WA 2IBGA 4KRPB 4M02A 5I26A 3EFDH 3TC9A 3IJHA 4HQQH 1IQDB 3UYRH 3M17A 3IGUA 3SE4A 4ZXBA 4LL1A 2YXWA 5PAZA 4PM1A 1GW6A 4Z7NF 2ICCA 4TNGA 3X12A 3F7LA 4C47A 5HDOA 1KPUA 5TGBB 3FN3A 4MMZA 2E6PA 2EDXA 3CD4A 1SMOA 3LEXB 1KPVA 2OXHA 1MFMA 2V9RA 4R4BB 4N68A 2I26N 2X0VA 5D55A 5KYXB 5DVNA 4JCMA 1DBBH 4JJOA 4KQ3H 3QZBA 3V4VB 5A2BA 3V52L 3ULUE 1BLNB 4UAOC 3Q2CA 1CGVA 5KSBB 2EIZB 4YHNB 5IBLD 1LO4L 4NPJA 2YSSA 4JG1L 5FGCB 1DQVA 3K4DA 3RTQA 1BYNA 2Q3XA 1X6LA 4WI8A 4UYPA 3T0EE 1CLYH 5GGQH 1DN0A 2VIRA 1WAPA 4JPIB 2YZ8A 4IMKC 2MOQA 3UTQA 2HSIA 5IJBC 4FLQA 3O6FC 2Q7NA 4FZEH 1SY6A 2G2PA 2E7CA 5EOQL 5EU6A 1J8RA 2XN2A 2CDFA 4Y9CA 1BVLA 2IWEA 4QY8B 3BWUC 4ICXA 1NDGB 3O8XB 1BVZA 3ZDZF 2VDQL 2NY2C 1XGQB 3C6LD 1ULVA 3BAEH 5FA4B 3SD5A 2QQNH 2P24A 4L9LC 4GT7A 4UM9D 4MSWA 3WUWB 1UD3A 2IGFL 5ITBH 2ADGA 3RWIA 2YA0A 1H3XA 4GIPD 5AYUL 3UTZB 4YPJA 4EE2A 2ZE0A 5I0YA 3CX5K 4GAFB 5FOJA 4X7TA 2WNGA 1YQVL 3CIAA 1A4JA 1XGTB 3SBRA 4IEFA 1FG9C 4GO6B 2YS4A 4NAQA 2AK4D 4G70B 4LLMB 1MHCA 2AJSH 4HSCX 5CJXC 2AEOA 4XB8A 3JBG7 4J4PC 1KACB 4NZFA 1PLCA 4EUPH 4M48L 1ZSDB 1TZHA 3FQWA 1SN0A 1CDHA 3QI9C 3ECBB 1U3JA 1YEIL 3C8KA 4KXAA 4YHKH 1QPKA 1YECL 2WC7A 3AQZA 4H8QA 2W8CA 3O3UN 4P46A 1U8HA 4EBQL 4B9IA 1M05A 5HYJD 4OF5A 2Y3AA 3O2WL 2R7EA 1W0WB 2H3NB 2VR4A 4LHJB 5E00A 5F0MB 5A2JH 4FXGC 3V5KB 2KLTA 1UACH 3IFOA 4WSGA 4WUKL 3B37A 3T6QC 4FFYL 5MEPB 4ZTEA 1NEZA 2JKTM 3L3JB 4G8IA 4JFFD 4BZ2H 4H2AA 2AQNA 5A7EA 5JW3L 1R75A 4RFOL 5I6OA 4X6BB 3O81A 1LP9E 4KO6A 4EI6B 3NIFE 4RGNE 3D4YA 4M6OL 2IV9A 5BQ7B 5ETUA 3I84A 1AGBA 3ZKMD 2ITCB 3FN9A 3F05A 4W9KC 1I31A 3MRIA 5HGBA 2JB6A 5DLML 4U6YB 1IV8A 1INEH 2VR5A 1URIA 3L3OB 5IMOA 3T77B 2Y36L 3IMSA 4DSYA 5L8KB 1H15B 4ALAH 1N0XL 3QEQD 5DTFB 1DQDH 5AG8A 3GSXA 5LBGA 3OZ9L 4JCWA 2Z92B 1RK7A 1IGIH 4NLHA 5I76B 5C08E 1YEEH 2PWEA 5DMIH 3BCFA 1OARH 3MUGA 1NLDH 2WBKA 3QG6A 5C07E 2BK8A 3VI3E 4YX2L 2PN5A 4PJ7A 5BV7L 1OP4A 5I5MA 1MEXL 5HPMB 4H25A 1NOLA 5EU4B 4A2EA 1AGDB 2Y7MA 1E27B 3IRCA 1H5BA 3QPXH 4F3FA 3B2MA 4MB3A 3VDAA 1AR1D 2VERN 4JW3A 1EZSA 3P1VA 4QOKB 2WD0A 3VSTA 2QMJA 2CLVB 4ZMVA 3Q8EA 4WNQB 3NACL 2J71A 3WFCH 3LTVA 2P48B 5CILL 4AE1A 3KL3A 5F7NC 4DO6A 4R5VA 1QRKA 4I0PD 3F62A 4P2OA 4WFEE 3BVUA 5EU5B 3AS0A 1H3VA 2O6EA 3QDME 3QQ9C 1T80A 5IFJA 4IOFC 5T33L 2QGEA 1EO8H 4XMWA 1LJMA 2DDQH 5E0QA 4HLZH 3SEPA 3D06A 3WUZA 2FQDA 1QAWA 4AH2A 3GMQB 3T71A 5L4FA 3U30C 4R7LA 4LHUD 4ZTOH 3HPLB 1G9NL 4PJXF 3FQNA 3H3KA 2D0FA 4K3JH 4CSZA 1I3GH 2FD6L 2AP2A 3BUPA 1IAMA 4ZSOA 2Q2EB 2CO2A 4YLCA 2G4EA 4PS4L 4X6EB 4CADB 1TEYA 4ZAKB 1KG0A 3MC0A 2WXNA 3L3IA 1DLHB 3KH4A 3KDMA 1WITA 4POYA 1FG2A 1ZLUH 3BIAX 3T3MB 2G60L 3N40F 3AREB 4DQAA 3NH7H 4PJFB 1JCKA 3O2VL 2AEQH 3LNEA 5JR1L 2PR4L 2ZT9C 3BP7A 1K2DA 3HNVH 1UJ3A 4YWGL 1S2EA 2X53A 5D72L 2GI7A 5I0ZA 4L8CA 2ORBH 3KBFA 2AI0H 2YFOA 4EIZC 3TA3C 4QXWA 4BFOA 4X8JB 4GSDL 4HJGA 4HIPA 1P5VB 1T22B 3HIZA 4JFYA 3MN8A 2XKNB 3PL6A 4CN1A 4PP1D 4PV8A 4BBWA 2X4OB 3HS8A 3AABA 4D9QE 1J12A 5FYKD 4WFHE 3GS0A 1NJ9A 1S4IA 4K3DL 1AI1L 2VLJB 5JXEA 2W07B 3LRMA 3TBTA 4M5ZH 1ZT7A 2RCSH 5B3JE 1TIUA 2NW2B 1LWJA 2H8PA 4LNRB 1DJGA 4BH8B 1MCJA 2PP9A 3LQZB 1HXMB 3JQOB 1OALA 2VLRE 2OL3H 1N67A 3HC4L 1A4KB 4GXUN 4S1DD 4NPYB 4UQ2B 5ADOH 3IDMB 5HD8C 1DUZB 4IIZA 4NQVB 5I1AA 1M9SA 4XC1L 1NICA 1GGIH 3CDGA 4ZOCA 4QJ5B 1FGNH 1ZD6A 1OD9A 2DQFB 4Z7AA 5ILTH 3QA3A 5AW6B 3H0TA 1XCTA 1AGEB 2A5UA 1F4YL 3WJJC 1IFHH 4PVBA 1E9OA 2YAHA 1UVQA 1ZVSA 3D85D 1HH6B 1R17A 4OD1H 2QKSA 1ZE3H 4LQFL 4R96B 4N0UA 4Z7VF 3WLBA 1HK6A 5J5EA 4GKSB 4NJ9L 5F1KC 3MNWA 2HN7A 2X40A 3ULUF 2VKWA 5HGHA 2DB8A 4OZHB 4PJGF 5GISL 2Q3ZA 5BRPA 1AXSA 4NQSA 5D4HA 3BP5B 4P3DA 2AJXL 3BGFC 1LILA 3SKOA 1YN6A 3ETSA 2MCMA 3CN0A 4HCFA 1F5WA 3MCLL 1GGTA 2YKLH 5DI8A 4YZFF 1CC3A 2NT1A 1IAOA 3CK0L 3EGDA 2Y1ZA 4KUCD 4NQEB 1D9KC 4KZ0A 4RBPK 4KXZI 1R4XA 3QORC 4I18C 3W9DA 4XO5A 3X1FA 5EF2A 1Z6JT 4BHUA 3IAPA 5F88B 2R9HC 4BKTC 5IT2L 4HXAH 5D70H 1DFXA 2GUOB 1CFQB 3BP4B 3IPBA 3O4OB 3EYQC 1XBDA 3E9UA 4G11A 1MJUL 3CZGA 1UWXK 1ETZA 4JX0A 1IAII 4OZGF 2IJ0C 3ZLQC 3WNNA 3X3GH 1KJ2H 2ATKA 5BRZA 3SYAA 3ZL1A 4BGDA 2OJEA 3EG9A 3QWOB 3SPJA 1OD7A 2K6WA 2ED8A 4HZLA 3T2QA 2OMTB 4RGNB 2NPLX 5JW5B 2R69H 2CBMA 3CAFA 3QUZA 4FTVE 4M4RB 2UXTA 1XEDA 3OJ2C 4O2CB 4A66A 4ODSL 2GHZA 1OSPH 2XYBA 3SY0A 5EBLB 4NT6B 3CVHB 1VZGA 4LSUL 1UEYA 2QGBA 1NAMH 4P59H 1N59A 3ASNB 3C5ZC 5FHAH 4HF5L 4FQJL 1A14L 5D5MB 1ZVYA 4ZXBB 3X3FH 3WD5H 3LB6D 2XA8H 4GRWF 2DBLH 3HB3C 3N44B 2YJLA 1KBWA 1JPTH 3GJEA 5EOCJ 4KX8A 1NOAA 5INDB 2BVOB 4WUUD 3UMTA 1JHLH 1U2CA 2P26A 4YAQB 3CN3A 5AL0A 3TO2B 4PLOB 4LCWA 4X7EC 2DJUA 4Y9GA 3TS8A 1DVFD 4R4BA 3NJGA 5DZNA 1JWSA 3N85L 3RHWF 4EIUA 4JFOB 4L37B 1NDMB 4X99A 2VH5L 2BVPB 4YDMA 2M26A 4NBXB 1WBYB 4A55A 1MWOA 4D3CL 4PFEA 2PYED 3U4EA 4C83A 3X14A 2UY7B 4FKKA 4JO3H 1NFIB 1AMXA 5IHHA 4UT6L 1DN0B 3BCDA 3G6DH 4KO7A 4PJEE 1OEZW 3HFFA 2PO6C 5TF0A 3UCQA 1UOLA 2K45A 3TT1L 4R9HA 2F5AH 4PJ8A 2FWOA 5G5DB 4AGPA 3DA0A 2OTWB 5D9SA 5JXAH 4JKNA 3NSXA 4M43H 3QIWC 2VLRA 5CSBA 4KU1A 1NDGA 5DJAA 4HIXH 4PGDA 1XGQA 4DH2A 3RGVB 4KK8D 4ZAKC 2TRHA 2JMRA 3FHEA 3GKWH 2XTJC 5EHFA 2R29H 3TIEB 3FH5A 5BVPH 2DM7A 5GGVL 5F1NA 1DVFA 1JPGA 1F4WH 1WWCA 4GOSA 4ISVA 3RWIB 5KYWA 2WAQA 3DETC 4JPVH 2H2SC 5KYUB 1WHOA 1NKOA 4PJ5A 3NIFF 3WNPA 2ITFA 2JIXD 4L5FL 3BZ4B 3FYEB 3P30L 4ZFFA 3X13A 2K4WA 2Z8WC 2XACC 3NCEB 4LLMA 4AT6B 2VRAA 1YEHH 4HA1A 1FO0H 4KAQH 1GYVA 4G6KH 4WFED 4GP5B 2KKQA 2O4EA 5EZOH 1MFAL 2NY5C 2XG4A 4H88L 2NY5L 1T2JA 5IY5B 1FVDA 1ZSDA 2GC7C 2CKBH 2R39A 4G83A 1TZ8A 3AVEA 4AIZA 2BS9A 4L5FH 4MMYB 1O9WA 4KHTL 3EGSA 1OP5K 3HPJA 1M7IA 2Y7QA 1YRKA 4XOAA 2N7AA 5EMYA 2MFNA 1YJDL 3SKNB 5BVPL 1C9SA 3I9GL 3FU9A 1CFBA 2ATPA 4W81A 2Y24A 5EF0A 4IRSD 1I7TA 1XIWC 3HE7A 5E2WH 5E8EB 4JY5L 2Y7LA 3DVIA 3T3PE 2V7HA 1NQBA 2FEEL 3QWNA 3LX9A 1G7MA 3FU0A 3DGCR 4NN5C 4ELDA 2WXHA 2K3TA 3ARGA 4UZGA 4H26B 3QEQE 4ZX6A 5EN2B 2R1YA 1HCZA 2DH2A 4NHUA 4OJAA 4ERSL 5BOPA 3E8UL 1H8OA 3CMOH 2X6UA 2K6YA 5ANHA 3FZUC 2P49B 4Q6YA 3RNKB 5IJKC 1N64H 5ETUB 2OMXA 5IROA 3G08B 4LSRH 2X6VA 3HI6L 1DSWA 2HJLA 3G6DL 4GNKB 4JAMB 1JCVA 3HNTL 1GKEA 4APQC 1ZDSA 3UO1H 3QUML 2XTSA 2BHYA 2N59A 3D12B 4JO3L 4AIEA 2ICWI 3UGUA 4D3CH 1YAZA 3SQOH 2TSAA 1INDL 1W72H 3ULVF 4FFZA 4G80B 1F8TH 3Q8AA 1J05B 3BGMA 1OCOB 2VH5H 3DX7B 5CMAA 3W82A 1ORSA 4PW4A 2IAMB 5E99L 3BDXA 4YBQC 3ZYIA 3TCTA 3ARBD 4WV1B 1OKEA 1XGYH 3MUUA 4LDEB 1RZQA 4XZUA 2HG5A 3PXJA 1X5IA 1OTSC 2WUCL 2BPBA 1NGQH 1M6OA 1JHLL 4BFFA 3DUSA 5HHPA 1Q8MA 3O4LA 3WN5B 4ZTPL 4MA3A 1ZVNA 2GSGA 4OM0H 4OLUH 1NCCH 4BK4A 1R9FA 3LZLA 4YXLH 1KEGL 3TESA 2ZSVA 3ARDB 3VI3B 1CGSH 5J1AA 3NTCL 2WWOA 2ZTBA 1FYTA 1N19A 4RGNC 3LNIA 1EZVX 4S1SL 4F33B 5HDBF 1WPCA 4DCQA 1BECA 3JZYA 4JFDB 3W0WA 2MKLC 5KWYC 2QLVB 3FCSB 4XCNB 3CQQA 1OSPL 4GQRA 1YMMA 2AK4E 3UAJA 1DBKH 5D1XC 4B9FA 4Q4IA 3FRPG 2A7BA 4BXVA 4FZ8L 4OUOA 2DLFH 4D9RD 1M6UA 5HDBE 3CXDH 4XCYA 1KMGA 5HYSG 1A02N 4YDLB 3RJQB 1W6LA 4FFVD 5JYMA 1H9DA 2R56H 1F1GA 1XF4B 2E46A 4LEEA 5TQ2L 1S9KC 1J87A 2WN3A 2OFQA 4KKRA 1H3PH 5BO1L 5A7BA 4ZSOB 1A6UL 2CR6A 1PKQA 5AWNH 4TLSA 3W9EA 4QT5B 3KWUA 3MO1B 3PV7A 3IU3B 2W88A 3SDAA 4TQEH 1QYGL 1UTDA 4CADA 5CHNA 4NM8L 4RRPG 4E9SA 3E3QE 4F8TA 1DLHA 2Z91A 3OXRA 4RQQB 3R8QA 2GCYB 4PJBF 3V5DB 1N4XL 1AZRA 3AREA 1AY1H 2HG0A 5DWPA 5F21B 3VGBA 2IQ9H 5JPNC 2ED9A 2F54B 5ID1B 5EBWA 2F7PA 4E41A 3QDJB 2FVNA 4Y1TA 3Q6GL 2VUKA 4QRAA 4PRHB 4X8JA 4HJJH 4D7PA 1SF3A 3DDGA 3FZUD 4BUGA 1NBYA 2RD0A 5C6PB 4BZ1L 5GISH 5I9QC 3QSKB 1LO0L 2BMKA 2DYPA 2VDLL 3H55A 2BP8B 25C8L 4UAOB 3WNOA 2VDRH 3DMMB 3UMNA 1Z2KA 2GB2A 1F18A 1IAIL 1CFVL 1P5UA 3MNDA 2ZUTA 4XMKH 4E0RA 1KTKE 1V3JA 4APXB 5E6ZA 1CBVH 4XBGB 2NDFA 4X6CB 1K5NB 4J3OH 1A6VL 2WLMA 2G0LA 4TYUA 4MCYA 2PKDA 5D1XA 3ZDYE 3RTQD 1LO2L 4QMEA 4HBCL 5F96H 5IQ9A 5HPOA 2LV4A 4N25A 4Z5RA 1CD8A 1S7UB 3K71A 3T0EC 1T4KA 3CSYB 3IDMA 2YN3A 3OKEA 2WB1A 5ADOL 3O45B 4JKKA 2L7EA 4O2EA 2J1ZA 5EH1A 1YYMH 3ZX1A 2XJLA 1BYPA 1MCNA 1GYUA 2M1KA 2CDEB 1M7DB 4L9LB 3AY2A 4J3WA 3ZDYB 1ADQH 2YD2A 4BK5A 4FA7B 1F90H 3CXFA 4M5ZL 3IFPA 2R2HA 1E9QA 2ZPKH 3LEYH 1HH6A 3R7RA 1AI1H 5B1AB 4AEIL 4R96A 4F7MB 1NC2A 4S1RH 2SODB 4Q8BA 4AQ8C 5KG9B 3L45A 1K8IA 1UENA 3V4LA 1U41A 5D7LB 3TU6A 1KELL 5HGHB 1EMTH 4JGNA 2VERA 3PWPA 2C1OA 3R06A 4N2BA 3NAAH 4AUJA 2ICEC 3REWA 3WENA 3CFKB 2EQDA 1OSEA 1HHIB 2AZUA 3MRGB 2ZUQC 3S36X 4BUHA 4JHWH 1RLBA 3WEXB 2PPEA 2XG5A 2YD7A 1DFBH 4N2NA 4JNXA 1L5GA 3FFDA 2A6IA 1K4CB 4P4RA 5KS9F 2XOTA 4TVUA 5I6MA 2VDKL 2OMVB 3W9DB 3G5XB 4PJAF 1NCOA 4LKXB 5AB2A 3D39B 5CR8A 1R3JA 5BJTB 3OQRA 3CSFA 2IQAB 2XT1B 4N2AA 4UWQB 3NN8A 3E3QC 4JHAL 3O8XD 5E95B 1KJVA 1I3GL 3S35H 3HZKB 4DPAX 4LPVA 2DAVA 2NTFA 3OKLA 3PGFH 3PXLA 4KUCF 1FH5L 3DROA 2H4EA 2DQCL 3F12B 1NKGA 4HZLB 5DVMA 1IGFH 3POHA 5IWLA 3WEAA 4DZBA 2YLHA 3QUZB 5B1JA 4PJIE 5KVFE 4YQXL 4OCRH 1SFDA 3ZHLA 4B96A 4WTWA 2XTLA 3HI1B 4YGVB 2VL4A 1LNUA 3NRPA 5HDBB 3GMLB 2YQ3A 3LQAL 1EEYA 3LH2H 1RVFH 3WFHA 4NT6A 3CX2A 4UNVA 1DCLA 3DIFB 3LIUA 1OY3B 1HFUA 1I8IB 2WVUA 3QQ4B 2DWSA 2GTWB 1OE2A 2LFEA 2R0ZL 4QKXB 1RVFL 1ZLVK 1UM4L 1IEAA 2LHAA 3KPNB 4NERA 4PIRF 2YQBA 1DP0A 4GIAA 1DN2A 2X4RA 3DI2B 2A9DA 1L9NA 4KKBC 1T0MB 3BVNB 5IMMB 1PAMA 4GMSH 4WI6A 1EBPA 3L08A 4OIIL 1Z5LA 5BV7H 1OQOA 4HIEB 3LNHA 1MHHA 3GINA 1FNEB 2MNUA 5DMIL 4FS0A 2Z8RA 4YDJA 1X7QA 4J6IA 1SXAA 3QIUC 4NS0A 3OZ9H 4DN3H 5AKVA 4JQIA 2WW8A 4ALAL 4GIOA 3LS5L 4IRZH 4UZUA 2EUXA 1MJJB 4MB5A 3UABA 4JCLA 3JTSB 1PEWA 3VI4A 2YPVA 1UXMA 4P2RA 1A9BB 5CLXA 4NDMB 3EYSL 4W4OA 1YYLL 1Z66A 4WZ9A 4UOZA 2QR0A 2EDEA 1FF5A 5C0CD 4DT2A 3WE6A 2X4SA 3MRPA 4M6OH 5I1CH 3L2LA 4KXZH 1EZLA 3GRWA 4FQHB 3IN0A 3DOSB 1ZT1B 4RFOH 1MRDH 3FSWA 3P4MA 2MCG1 2VLRB 3ZE1F 1ECZA 2OSYA 1N18A 3D39D 4NN6B 1GGUA 1TJXA 5HJGA 1E3ZA 2EILB 3S36L 2J88L 1SJEB 5IBTL 1I9JH 4FX5A 4X4ZA 5CEYA 3VJ6A 1Q0YH 2WQAA 4PWGA 3O3DA 6FABL 2GFBA 4NN6C 3S35X 4PJ9C 2FYYA 4XR8C 4CMMA 1DVFB 5F0PB 3O2WH 2V0AA 4WW2B 5H37H 4A2HA 2VWEE 3QHFH 5HHMB 2YJQA 4G6AD 4WUUE 4NKMA 3CSGA 3JV4B 1KIRB 1SVBA 3TVMD 4UDTB 3V4VL 4UT9A 5B38B 1WZ1L 4M48H 3DRQA 3GI8L 1RZJC 5C0IB 1EA9C 1G6RB 1YNKH 3MQIA 3KPSB 3GB7B 4Y1AB 1TQBB 3GBEA 3N44F 2X2JA 5GRZA 5JQ6H 4IIQC 4DJMA 4OCSH 1YQVH 4LU5L 1WUNT 3FPXA 1NBCA 4B9CA 3IXAB 4YUEH 1CBVL 2PXYC 3X1GA 2ADYA 3ZIMA 1IBYA 3FFCA 3EGSB 3VTMA 4HJEA 4G72B 5AOZA 3NIDF 4XO3A 4U1MB 5ITBL 1JXKA 3BWAB 1YCSA 3RAJL 4BK8A 3V4PB 2A99A 2VLMD 3RWGB 2VDRL 4LSTH 1Z7JA 4XH2A 1ZLEA 2XLLA 1IMHC 1ZS2A 3B2VH 5I8CB 5K9JH 3Q1EA 3CZEA 4G9DB 1E4KA 1U58B 3MRQB 4X5QA 5GZOC 3UOAB 5C8JA 1EJ8A 1EK3A 3ECVA 1RY7B 1BJ1J 3DX8A 3FO2B 4BQ6A 1I4FA 4XNMB 5I15L 5AW5B 4JY4A 1AZVA 2DMBA 2R1YB 3HA0A 4L1LA 3A24A 4PJ9B 4NEHB 2VC2B 4L4TD 1PS3A 3DO3A 3BW9A 3MV11 4WW2F 2HJLB 1ZKAA 4KX9A 4ZMTA 1CLYL 3INUH 1N4XH 3GD1C 3PJSA 5CEZE 5KVDE 2E9JA 5SWZD 2YKKA 3FU7B 4KROB 4BSWA 3SN6N 1L7IH 4QRSB 5J8OA 1LD9A 1TMCB 3TF4A 1YNTF 3ATAA 4YHYC 4DN4L 2FHCA 3CFIC 3ATBA 1R0AH 3QS2A 3D9AL 5BO1H 4BRVA 5SWSE 5EWIH 1F0LA 1UKSA 1X4ZA 2EC9U 3QDHA 4ZS7H 1MDAA 2VZVA 4WV1A 3GBNL 3EGXB 1ETA1 4YXKH 2UZYA 4XZUB 1NGYB 1KUMA 2ZOKB 5I8KL 2OYMA 2JKRM 3DUSB 5HHPB 1RUMH 4URKA 3SBPA 3S3DB 4TVPH 2B3IA 2Z4TA 5IEHA 5LGHL 3V79C 5HHNA 1DDTA 1TMQA 2YEVB 5AW8B 5DEFB 3UGXA 1NPNA 1JK9B 2WQVA 4LVHC 2GTZA 2ZXDA 4MAYB 4S1SH 5ECJE 4PJGB 3EFDL 3UYRL 1JMZA 1FYTB 2ZUQB 4GI8A 4UTAH 1CGSL 3SO5A 4ZMQA 4N2KA 1IC1A 1WWAX 2FAUA 1J1PH 2DLGA 2FJGB 4XCNA 2VLRD 4OLUL 2JELH 4WI2A 1TG8A 4OZGE 6TAAA 3PNWA 2J25A 2ZF9A 5MENA 4HKJB 3DVGA 1QR1A 3N42B 1NKRA 4U3SB 2AEIT 4XPTH 4K8RC 2R1WA 4G8GB 4LVHB 3U7YH 3V0JA 3ES6A 5DU7A 4B7IA 1DJIA 3P2DA 4I85A 1KZQA 4GW1B 4H1LH 1NCBL 5IOPA 4DKTA 4D9QD 2WQRA 3IDYC 1XXDC 4WI4A 4DKEL 5L9DH 3QUMH 4RQQA 3E2HB 2CXKA 3HNTH 1JNLH 5J89A 4NQCE 5EC1B 5CN3A 3H1ZA 3VVWA 4C4BA 2BSBA 2MKWA 3EJPA 3RWDB 2VNCA 4QXTA 2AQRA 3AAZA 3MBEA 4QRUA 4TUOA 5MEQB 4RDQG 3PABA 1TDQA 3BKYL 1X5MA 2J4WH 4LK4A 5HYSB 2VQ1A 4LBEA 4KQ0A 5ADPH 4ZBJA 4LE8A 5JIMA 4KJYB 4XVUC 3G5VB 3KR3H 4TOYH 2UY6A 5HP5A 1U4FA 2EINB 4Z7WF 4I1NB 3SBWA 2EIEA 2Q5BA 1YJDH 1G7LB 2JKIS 4MDJA 4MWFA 4LSQH 4OAWB 3FB5A 3EH3B 5D7IE 2HT2C 5GSRB 5T5NF 1OCWL 4B6ZA 4XP6H 3HE7C 5CEXA 1SVCP 1LXMA 1FJ1B 2PW1B 2C3HA 4DGVH 1UD6A 3U79A 5J13C 5T3ZE 2ZWLT 3A4EA 1X4XA 4MCYB 3V55A 3BDBA 1NUNB 2H1LM 2C8NA 4CDHA 2VCOA 3IFLL 1S7UA 1Z9PA 2APFA 1EJOH 1BZOA 1MLBA 4JG0L 4WEMB 2DPKA 4HUCA 4PW9A 3IFNL 1HZHH 3RVTD 3OF6D 1UFGA 4BRJA 4ZODA 3ULSA 3GSVB 1J8HB 3PQYD 5L7XL 2WKGA 4G5AA 4OIAA 3RZCB 2CDEA 1VHPA 1I1CA 2F68X 3GMRA 4N1HB 5D7IA 4L8DA 3TVMA 3HZVA 4MNQE 4BZ2A 1BA9A 3F6LA 4N8CH 1U2HA 4ZPVB 1E9QB 5DRZA 1E28A 4NGHH 3CFQA 4HS6B 4MYWB 5C07D 2D4FA 4Y5YB 2UX6A 5HHOD 2XUWA 4NKOB 3FS9A 2ZKWA 1IKNA 1UXLA 2W81C 4LLVB 5DJ0B 5JXAL 2C1OB 5MP6L 1ASQA 1DVFC 1E90A 1XR9A 4ESKA 1Q0XL 1TJIH 4LKCA 3C08H 4JO1L 3SQRA 3QH3B 1G7IA 3ALXA 1XH0A 4MXQD 2EE3A 4AKOA 3ZL4H 1HL5A 1UUSA 3MXWL 3UL4A 3MROA 5FPIA 4PJDF 4OZFH 5DVLA 1OM9A 2CHXA 4GAYA 3RVXC 4JO4H 2OBGA 3VXUB 5E6IA 5DZJA 3CH1B 1H6UA 3P0VL 5IG7B 3EBGA 2Z1PA 2XPGA 4N8VG 4Z7UB 2YUZA 3VXQB 4NQDB 1H9VA 1WGVA 4GINA 2X28A 1OL0A 4PJIA 4NIYE 1YEKL 3CFCL 4JFFE 5E4EB 2CQVA 4JFQB 3QJFB 3QIWD 4OJEH 3F12A 4CU6A 4Z3FA 1ZEAL 2KLRA 5HVHC 5DJDB 5IW1A 1ZS8B 4XB3A 4MX7B 2OM5A 1FORH 2KZBA 1JPTL 1Q9KB 4P5KA 1GMEA 5CIPB 1B4TA 4S1DC 2XA8L 5DD6B 4APQB 3IDNA 4XC3H 3DPBA 5H35A 4N8VB 5AYQA 1BEYL 4P59L 1KNOA 4MFHA 1QLRB 4JL1A 1DQIA 3QQ4A 4JLRB 5SX4H 5DUJA 1OAJA 1E4XH 4JG9A 2HKFL 1G87A 2IH1B 4ILDA 1IGTB 1OHZA 1WFIA 4LCYA 4M03A 4QOKE 4AIOA 2EXYC 4IS6B 3MLPA 4KY1L 3MGOB 3PWPE 2EYRB 2HXAA 3GT6A 4RZCA 5K9OA 3RLSA 3IGAA 4QXGH 3K5SA 4HUVA 1GCFA 3WNLA 2IDSA 4GQZA 4HIIA 2DTML 1BW8A 3ARDC 3ULUH 4QDGA 4AZUA 4X6FA 3WU1A 1RHHB 3FSVA 2R0WL 4OGYH 5FB8B 3H2QA 4QJ4B 1JNNH 3B3BA 1A6AA 1KLFA 1MJJA 1E3FA 1I3VA 1U8PA 3AXLB 4V2BA 5E5LA 2WTRA 4MD5B 1CYXA 5EEYA 1NCHA 2Q9OA 4PUBH 2AEPL 3GSWA 3FFOA 4FLSA 2JCWA 4DP2X 1OANA 5C6TL 1M71A 5JA8B 1G9EA 5D6DA 5L0QC 4MKTA 4ZPTB 1NUDA 4CNIB 1U2YA 2JXMA 3DURB 3EUUA 4HIQA 1AQDA 1F6FB 2W60B 2XPYA 2Q1EA 2MPAH 1QSFD 1ZT1A 4N2LA 4ZFOB 3T08A 2UZIL 3RU8L 4NQDE 3MKGA 1PY4A 4NNXB 4YC2C 4U0RC 3SDAC 3CFJA 1F4XH 3N3EA 1VF5C 4KPHH 4X7SH 5EZJB 5ALCH 1TEFA 1T1ZB 3FRPB 4UT7L 4UQ3B 5DHYA 3LH9A 2BHZA 2OL3A 4KPHL 4X7SL 3EOAA 1F4XL 3AADB 1U8KA 1THCA 3PNRB 2BW5A 2UZIH 3RU8H 2ZWNA 2LW3A 1QFWI 5CS7A 4PJHA 1XH3B 3ECUA 4ODWA 3IWVA 4KDTC 2BCKA 1ZGLB 1I1AA 3EDDA 3UGEA 4ZFZB 3AACA 2CBTA 2FJUB 3DRQB 5AUMA 3WTUA 4X9IA 4P2QD 2NW3A 3B8SA 3DKHA 2FO4B 5FGSA 2OL3L 2K8QA 3C8DA 3A47A 2GITA 2H2PC 3WS6C 2ZG2A 4PUBL 3TA3D 5D1ZD 3O9WA 4FMKA 2CE6A 1ZHNA 4DF9A 3BPNC 3BKML 3QI9B 4Z0XB 1ZTMA 3QDJE 3OMZA 5I24A 5IHWA 2N7SA 5TPWH 4X9FA 1QSFA 5CKAA 3Q8BA 4MCMA 4OGYL 3AT0A 5I71B 3BWAA 1H6FA 4HD9A 4P5RA 4HIHB 43CAA 3JTBA 4K3DH 2EDOA 3UPAA 1F6AB 4DGUA 3MCKB 4MNQA 4L3EE 3GSQA 3EYOA 4HC1L 4QXGL 1U58A 3DX2A 4PWEA 4Q9BA 3RWEA 3C6LB 5LBSH 3GLAA 1CT8B 1U8NB 4PI2A 1CBJA 4Q9QH 3FTUA 1QSVA 4HUXA 2AABL 1O6TA 5FW7A 2JSFA 1NGXB 5DC2A 2QQLL 2NQDA 1D5RA 1VESA 5FHBL 4U7SA 1QZ1A 1PCSA 4PJ9A 4P07A 2VM9A 2ERJB 3UDWC 1AGCB 1PVHA 1PMYA 4K3GA 3SDDD 2NY2B 5KBKA 2OQJB 1HCVA 3IS1X 2ENSA 5FGBA 4RAVA 3PJSB 2PLTA 3ESPA 1N5AB 3IPFA 1MY5A 3FRUB 3TA3A 5HGGS 2ICWA 2CHNA 5DQ9B 4X7FC 5D93C 3KZ8A 1KPRA 1XCQB 5IROD 5L4MA 2VR7A 3UAFA 1MWAA 4X5WB 3FW6A 4YIQB 3HVNA 1QA9A 2OTPA 4OGZA 1G9NH 4I87A 2RGSA 2UZYB 1GC1H 1B88A 3EJYD 4A1RA 3AQXA 5JW4R 2KUTA 5EEUA 5J6HB 2JCCF 4FP8L 4FFYA 3CFCH 5JDSA 3ZKQD 2VM3A 1S9XB 2VN4A 4DP6X 1R34A 3VWKA 3S4SG 4M61A 1BZDA 3S96B 3WGVB 3QQ3B 3QB7C 3CE1A 4LEXH 5DHXB 2FT8A 4U1HA 2OSLB 3SGJC 1TYRA 4XPHL 4QO1B 3RFZB 1KYOK 2O5XH 2YAQA 3ZL4L 2JH2A 3DX6B 4NC2B 2HTKC 5B8CB 2FWLB 2WWMC 1X4YA 3PWVB 4R5TA 5DS8B 1SQMA 3RWHA 2Y5QA 3P4OA 1IKFH 4FXTA 1EVTC 1QR1B 1Q94A 3MV8E 1P4LA 1AJ7H 1YLBB 2IWGA 2R4SL 1FE8H 1FN4B 3GTNA 1NLDL 4QHMB 2G5BB 4XHQA 3RZCC 4YXHH 1MFDL 1P69B 1U93B 1IGIL 2E8YA 2RFXA 3QEGH 5HYFA 4F20A 2HVJB 5LG6A 1QATA 3FB8B 4NZUL 3IU4H 1DQDL 4HUUA 1GAFH 1N0LA 1E8WA 4G7YL 3VXTA 3DO7B 1L6XA 1HWWA 4Y4FD 4JPSA 4UQIM 3OZKA 3QG7L 1K3IA 3UZVA 1R5WB 3FB6A 5FYLD 3RDJA 3PHQB 1SXZA 2WCSA 4YO0B 2MHAA 4AKQA 1YVLA 1J5DA 2X9ZA 5HYQA 2APXA 3U83A 2EVIA 4L1DA 4PBXA 3VFWB 3I74A 4AMKH 3R19A 4G6JH 1GXEA 3AAZB 1A6ZB 2K9FB 5BW7C 2IALA 2QQKH 5I66A 4CN6A 3CUPA 3NJLA 5BZWB 3TCXA 1XH1A 2VWEC 1A8JH 5FCUH 3ARBC 4F5CE 2IBBA 3ILQC 4IBUA 2Z35B 4XP6L 4OY9A 3D0LA 3S3SA 4UDUA 4XCCL 5ID0B 1WIUA 3MTRA 3KWTA 4XP9H 1KGXA 3ARUA 4XXDB 5J56B 3S5LA 3RVVC 5I1GL 2WQWA 3EO1B 2I32A 1T5XA 1YO4A 4XMXA 1QVOA 3CLWA 4FQCH 2B5IB 4K9EL 4YFDB 2N1TE 2ZWYA 1NBZA 2GJ6B 3QQDA 4TM9A 4LLWA 2X09A 1TCRB 3L3HA 2Y6SD 1SMDA 2GJ6E 3BH9A 4NB7A 3BVDB 2B2XH 3VXPA 2FH8A 3ERXA 4O51A 1KB9J 4UM8B 5FGBC 2JJVA 2CK0L 4U6XA 2DKMA 2IPUG 4R97B 3MUJA 4RWYL 1USZA 3FONB 3EADA 3FCBA 3ULVL 3KBPA 4U33A 4FERA 3MJ7A 3KGTA 5L9DL 3BOVA 3TVMB 2FGWH 4G1EA 2H47C 1ZY9A 5GJSH 3L1FA 1NCBH 1XV8A 4CUCA 3QIBB 1HC1A 1T1YB 2OV0A 3UBGA 3WTVA 3BVWA 3V0FA 3M45A 3QRBA 3BT2H 4RRPM 2AQQA 2R83A 3HAEG 2GK0B 4XPTL 2OMYA 5ITFB 2OW7A 2X4PB 3BESR 2P80D 5HY9B 2DJSA 1KBGH 4X8CA 4GPVA 4QI3A 2W80C 3O6LL 3FO1A 5E2TL 4KZCA 2VITB 4Y8AA 1KJ3H 3QH3A 1D9KA 1JZHA 3L4TA 1KTBA 4N0CD 1MFEH 4R4NC 3QHTC 5EO9B 2XY1A 4AVKA 5JZ7C 2BLFA 5DRXA 1LO3L 1CF8L 1MCPH 3MBWB 3TPUB 1L0YA 3KMDA 3IF1B 3EHBD 1ZLSL 4AEHL 4Y5XB 4AENB 1LE5A 4HUKB 4AGNA 4F37F 3CDFA 4PJIB 4RBPH 2GEEA 1VPOL 5L6YL 5CJBA 4WF7A 1DJSA 2ICES 4YXKL 3DTUB 1J9SA 2ZKMX 3MV01 4XNAA 1HVXA 1VPOH 5GZNC 3AREC 1UXWA 4LARH 4FTVB 1WFUA 1XIWD 5IW1B 4B9PA 2OULB 5AVXB 1GS6X 3AITA 4KVPA 3D9AH 2AK4A 1Q9KA 3QUXA 3B5HA 5KBMA 3Q48A 4F7EA 1XB6A 1MW0A 3IDNB 3HZMB 3BSGA 2K70A 4YHZL 1EGJA 1KWKA 3FTSA 4IW4C 2F53D 1EHKB 5F6IB 4LCUB 3GM8A 4PLKC 2P1YA 3CHPA 4JGMA 4BD4A 1DBAH 2OLDA 2W0FB 4MDRA 1I1AC 4O5LH 4AX3A 3ARQA 3ZZQA 1JD9A 4QRPD 5DURD 1CL7L 1KBGL 1ASOA 1KTJA 2Q86B 1QW8A 4NRXB 1PZ2A 4KUZH 4QRTB 4Z95H 3CVBA 5AVUB 4EXKA 2XWDA 4WHTB 1S9YB 4NP9A 4DP4X 3FMGH 1JJUA 4HBQA 4RZCB 1ILSA 5K9OB 2XVGA 2WWKT 3WDJA 3WY1A 1QBBA 3K91A 4JZNB 3LAFA 3MHZA 4I4WA 4LSTL 1GOHA 3IJ7A 4U2ZA 4QRRE 3F6IA 2OX5B 4LSVL 2BZ7A 3DJTA 4I3GA 1MQ8A 4XAWH 3G6AA 1BFVH 4KNSA 3UTPE 2OMWA 1PZAA 3IDUA 4U3HA 1KLFB 1N2RB 5DUMH 4ACTA 2PR9A 3TCLB 4U4IA 4YUEL 2OYLA 4RWYH 4BDVA 2IANB 3Q2NA 3HRZC 5AD0A 2JJWA 1V55B 3P3TA 3PWNA 1BQHA 2B2XL 5IM7B 4L3CB 4XP4L 2BWQA 3FTXA 4PRPA 5EFIB 3O0RH 4KKAD 4PAZA 3QJSB 3VU1A 4NNPL 3RFZC 1MFBH 4I77H 1QBMH 4U0QB 3LKNA 2C9VA 5T1JA 3RVWD 2WZ5A 4PSPA 1PGRB 2W60A 3H42H 5DJ8B 2CJ3A 4MBOA 3BVXA 3D4ZA 2ZOOA 4QRQB 4QAWA 5GRWA 3QHFL 4AIXA 2VLKD 5BZDA 2CH8A 3MLZL 5A1AA 4XP9L 5C0DB 2BY1A 5C0EB 1SM3L 5CGYC 5I17A 2K3HA 2ZXEB 4H0HB 2X2IA 4A7GA 3G9AB 5FFLA 3X12B 3TBWA 3K7UA 3M1CA 3S36H 3U48A 1KXQA 1WCBB 2PPDA 4XX5A 2IEPA 1MCWW 1XZ0A 2VLJE 2WBJC 5F72S 2LABA 2H45A 1KPVB 4Y2DA 1I7UB 5FYJU 4HHAB 2QQKL 3T2NL 3MUZ1 5CZXC 3M07A 1SLWA 4Y1AE 2NW3B 3LSOB 4ODTH 4NENA 5FUCC 3BAYA 4NRYA 5BUGA 3KW7A 4L5FE 3BEWB 1IVTA 2EYSA 1B6DA 2EIZA 4PJ5E 4YHNA 4JO2L 5PCYA 2E0PA 3ESVF 3BI9X 4JFPA 1ES0A 4GKNB 1HZLA 3WFDH 2VIRB 4JHZA 3MRCA 1N7ML 3C6LC 4Y2OB 3QEGL 3CN2A 1MFCH 1MFDH 2KZWA 5KBNC 2JI2A 4HUWB 3GSQB 1P6FA 2V33A 1INQB 1PZBA 1MJ7H 1L9TA 1TITA 2QQQA 3EJRA 3D3VD 3BN9D 4JKMA 2Q8BL 3BLBA 1NFKA 4MJIA 3ARVA 1ZANL 4M7JH 3K8MA 3O8XA 1HAWA 5D2NB 3ZSTA 1UC6A 3WIFA 2F54D 1UHVA 3D85A 3ECWA 2D73A 3VA6A 1FDLH 3IDIA 5E94A 1WE5A 4AW7A 4OJFL 3UG4A 3L7EB 4X8XA 1NCUA 3HHSA 1CJYA 2D31A 2CRYA 4J1UA 1P84K 2X70B 2JB5H 5EORH 5ESVA 3KPOA 3HBGA 3SY6A 4GBXA 5KS9E 3HTLX 1V54B 5IBLC 1WP6A 5IQ7L 4WGKA 4LEXL 2NXZD 2CA4A 3M46A 2WXPA 2ADIA 3FTGA 4O2FA 3FRUA 1UB5B 3LQAH 4X7TB 1EHXA 4G6MH 4KKLD 3TA3B 5LQBL 1NPUA 1U6AH 4HZ1A 2ICWB 4JFZL 4KK9D 2F1EA 5F7DA 1FIGH 5TDOB 3VD1A 1IGFL 3QJHA 5ICXB 4X5WA 4F7KA 2CGRH 2AV1B 5EPMA 1FH5H 3IJSA 3QCTL 1QG3A 4MJ2A 5C07A 1FC1A 3ECBA 4EOWH 3L5HA 1P7KB 3SBWC 2A9NL 2NY0D 3BZEB 4LHUA 2AF2A 3D3VA 1HSAA 3G5ZA 2PETA 3KHOA 3QZWB 4N90D 2ZP8A 4WQOA 2R7EB 1LHZA 2H3NA 1TYJA 2VABB 2ZCKH 3OAYH 4NRZA 5GJTL 5CJ5A 1B2WL 4S2SB 3V5KA 4KTGA 1GSMA 2CKNA 4QO1A 5MEPA 1KCSL 2Z93B 5I5RA 1JGDB 2GABA 4TULH 4J2QA 3FSZA 2X4UA 2D2OA 3AU0A 1HKLL 1SOXA 3RL2B 2IFFL 2FX8H 4ZO9A 3RP1A 2WP3T 1W16A 3BKCH 5LNGA 3LN5B 2RIKA 4NQUA 2M2DA 5BQ7A 3FT9A 1COBA 1TTUA 4E9VA 5HGDB 4HETA 1UZ8A 1AGBB 3V0VB 4QGYA 5CSZB 4IBZA 3BKJH 3MODH 4FQXC 2N56A 1JZ5A 3HHRB 2X4QA 5JOPD 3L3OA 3T77A 2PCYA 3WS3A 1ZV2A 2CSPA 4FNRA 4H40A 1VZIA 2MEJB 3CLEL 5EOCL 1N0LB 4ZK8A 1TSHA 4LLUA 1ACYL 1EJ6A 1U33A 3VXMD 4HULB 2PABA 2BOBB 3BKMH 4FNUA 3I2CH 3MACL 1OOAA 1R5WA 3FB6B 3KJ6L 3W5NA 2P5WA 4IU2A 1AZCA 3OTTA 3QG6B 1XMWA 5SX5H 5JTWA 4K4KA 3MYJB 2OK0H 1GCYA 2EKSB 2I5YL 3MLSH 3TN0C 1I7RA 4BFKA 3LXBA 2YXMA 1H5BB 2V9TA 2WXKA 2CRIA 3ETBF 3JV5A 3MNZA 1Z9LA 1ODUA 3SOTA 2QSTA 1XSJA 2ESVE 5BZWA 1HXYA 2CUAA 5I1JL 1JHKH 4BKLB 3CNKA 4ZX4A 3CVHL 1RULH 2L04A 2BOCA 4Q0XL 4P2QB 4XCEA 4I18A 1PW3A 4XMKL 4N0UE 5A2IH 5DUBA 2JKXA 3SDCD 1IAIH 3OLEA 2A9CA 1U3HD 4ZX5A 4G3YL 3VD7A 1TVHA 1QSEA 2EXSA 3ZHDA 5C0FA 3HKZA 4XXDA 5AVSB 3GIVA 5IFJB