1D2PA

Crystal structure of two b repeat units (b1b2) of the collagen binding protein (cna) of staphylococcus aureus
Total Genus 92
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
92
sequence length
373
structure length
373
Chain Sequence
ETTSSIGEKVWDDKDNQDGKRPEKVSVNLLANGEKVKTLDVTSETNWKYEFKDLPKYDEGKKIEYTVTEDHVKDYTTDINGTTITNKYTPGETSATVTKNWDDNNNQDGKRPTEIKVELYQDGKATGKTAILNESNNWTHTWTGLDEKAKGQQVKYTVEELTKVKGYTTHVDNNDMGNLITTNKYTPETTSSIGEKVWDDKDNQDGKRPEKVSVNLLANGEKVKTLDVTSETNWKYEFKDLPKYDEGKKIEYTVTEDHVKDYTTDINGTTITNKYTPGETSATVTKNWDDNNNQDGKRPTEIKVELYQDGKATGKTAILNESNNWTHTWTGLDEKAKGQQVKYTVEELTKVKGYTTHVDNNDMGNLITTNKYT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Structural protein
molecule keywords COLLAGEN ADHESIN
publication title Novel fold and assembly of the repetitive B region of the Staphylococcus aureus collagen-binding surface protein.
pubmed doi rcsb
source organism Staphylococcus aureus
total genus 92
structure length 373
sequence length 373
ec nomenclature
pdb deposition date 1999-09-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF05738 Cna_B Cna protein B-type domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1140 Mainly Beta Sandwich Immunoglobulin-like Collagen-binding surface protein Cna, B-type domain 1d2pA01
2.60.40.1140 Mainly Beta Sandwich Immunoglobulin-like Collagen-binding surface protein Cna, B-type domain 1d2pA03
2.60.40.1140 Mainly Beta Sandwich Immunoglobulin-like Collagen-binding surface protein Cna, B-type domain 1d2pA02
2.60.40.1140 Mainly Beta Sandwich Immunoglobulin-like Collagen-binding surface protein Cna, B-type domain 1d2pA04
2XICA 2X9XA 3GLEA 2XIDA 2XTLA 2X9YA 3GLDA 2X9WA 2X9ZA 1D2OA 4BUGA 3B2MA 2Y1VA 1D2PA 3RPKA
chains in the Genus database with same CATH superfamily
1BD2E 1BFVL 4NAQA 3UTTB 1E5YA 5AVSB 5CGYD 1CGWA 2Q3ZA 2YSSB 1TG8A 1EZSA 2E86A 3O2WL 2P46B 1XF2A 1JNHA 2OJEA 3MCKB 1Z32X 3CSGA 1BF5A 4XMPL 2ZUWA 4WJKB 3CBJB 4GG6E 2R39A 4P2AA 4ZOAA 2YQ2A 3P30L 3KXFD 3Q5TA 1MKFA 3EO0A 2XZAH 2D3JA 4HS3B 4EI5C 1OGTA 4AUJA 2EH8L 3OPZL 1UWXK 3CWGA 4JO3L 4WDIB 2FJUB 1KTRL 1XZWA 3WKQA 3SGKA 4G8IA 3ML9A 1U95A 2V5RA 3T6WA 4IU3B 1VFBB 3PL6A 2Z31B 4QRBA 4ZW6A 2B16A 2KKQA 3FHAA 1I1AC 3QIUD 3J2PA 3GM0A 3KYOA 4ODSH 1WD8A 1OE3A 4OR1A 5BZXA 1HQ4A 4FTVE 3WGUB 4YSUA 4K3DH 5DDHB 3U4BH 4YDIH 5HHQA 4QF1B 4MXVF 4FJ6A 1X5ZA 4UOJA 2RQ8A 3QJVB 4XN4A 3TN0B 4L48A 4XBPB 4MQTB 2EDMA 4M7KL 4HK3N 2XRAH 2VTFA 3BCFA 3FT4B 1TETH 3MV01 4OI9A 3FCSA 2AJSL 2ZKYA 1CICD 3BVNB 2LR4A 5IV2B 5JQHC 3M1OA 4QMEA 3MLWL 2ZNWA 3QAZB 1L9QA 3LD8C 1G7MB 4J2QA 4AW4A 1RHHA 1RULH 5GISL 2JIXB 4J6RH 3SYAA 1EGJL 2O1AA 1HQRA 1ZLUH 1TTRA 3E6HA 4DQOL 1UM5H 4I3SL 1A4JB 3CFBA 3ZIMA 3L3IB 3E80A 2QQLH 1ICTA 1CBVL 2CG9X 4HFWB 4I9XA 4IOIA 4AYBA 2A2QT 4K8RD 5EEVA 4D9RE 4XXCA 5HYQA 1FNEB 1RJZB 1ETJA 1IGTB 2Q76B 3F5WA 5C2BL 4LHUG 4KKAD 1NLBH 4BFFA 2E56A 4KPHH 3VFUA 1WAPA 3BW9B 4KRPD 4G6ML 1UC6A 2Z31C 1U4FA 3EO9L 5B8CC 5BUGA 3RKDC 1IV8A 3EO1A 4FG6D 5F89B 1R3KB 4KK8C 1R5VA 3IFPA 4U1HA 3M17B 2BIQA 2IH3A 1BSIA 4WW1B 2VDML 5AW4B 4HCFA 3TN0C 2GTQA 3ATFA 1WUZA 4FFYA 1XCQB 5ALCH 2CKBH 2FLMA 3QFDA 4KJPD 5A2KH 4KQ0A 2GFBA 3BE1L 5DRWA 2BMKA 5F7EL 2E6JA 2ZWZA 2CBTA 3HB3B 1RUPL 4FQPA 4IKIA 4Y16C 1VB9A 3D3VE 1U3ZA 4DAGL 2P52A 1J8RA 3OAZK 3KS0J 4H20L 3OPUA 3U82B 3W9DB 5JOFA 1CU4L 5FF6A 2FZ3A 1B3JA 1NC2D 1IEAB 2WLLA 3FF8A 5DYOA 1NIBA 4TUOB 4O9HH 3OAUH 3VFMA 3BQUA 3UC0L 3MN8A 2BW4A 1JV2B 5HY9A 3FS9A 2X05A 1ORSA 2HB0A 2XIBA 3D39E 4PY7A 5C3LD 2VR9A 2GITA 1AO7A 1EEUA 3LAFA 3GXFA 4KKCC 2WLMA 3MTRA 4ADJA 1OTSD 3A22A 4YBHA 2R1WB 1AP2B 2H41A 4HAFA 1U92B 8FABA 4ZUWA 1B0IA 2CU9A 4P5TB 3T0EE 2Q7YB 1B0GB 2OYKA 3JWDC 1X7SA 1CFSA 3AG4B 4JJ5A 4U1JB 3WIFA 2ZX8A 3B4NA 3QWQB 5MEOA 3H0TA 5HDRA 1U93A 5J6HA 3WDJA 4P57B 4X0NA 3CFIC 1JPGA 2O6PA 5HDLA 1OM3H 1LM8V 2YA0A 3FXIC 2MCAA 3V0VB 4N20A 4Y88A 1DQLL 2R23A 2O5YL 3DXAA 3PXJA 3TBWA 1SF5A 1DBJH 3T4YA 4F3FA 1NCWH 1E8ZA 5AVQB 2XWZA 4Z7NE 3OXSB 4EI5A 2P3YA 4XPGL 4FI8A 4PR5B 1XL4A 3ARDB 4MVBC 3HB3C 4MD0A 4I9WD 1H3TA 1FNGB 4LCYB 4FQXD 4XNAA 3KMDA 2M2DA 4AC4A 4GO8A 3SKOB 5IFHH 1ADQA 2ZXDA 3EG9B 3MR9B 3IFOB 2X4OB 4NGHL 1G5GA 3ZE2E 5DQJB 4LAQH 4OT1L 3FQUB 3AG1B 1UENA 3VD1A 3QI9B 2GY5A 2Z0UA 1I1AA 4GP8B 3SOBL 3BP4B 2BVEA 4X4KA 2DQHH 5G5DA 3QR1A 1NCJA 1JHTA 1A7RH 1YEJL 1U6AL 1BCIA 2F54D 3J07A 4KO6A 4RFEB 2P5WA 2CBOA 3E9UA 4R96B 4A7VA 2Q8BL 3U36A 3UBHA 3E3QC 3KXFE 2AABL 1JS4A 2BJML 3AAZB 1IT9H 4RISL 5E08L 3FQXB 1HFUA 1SVZA 1EAOA 3ZGHA 5C07D 4LSPH 4S0TD 4RDQG 1BBDH 4P5TC 5CZVL 1N12A 3ULUC 4YVNA 3ZZLA 1MCBA 1NFAA 4ZX3A 4AQOA 2FECL 3KPRB 4ZUTB 3UBFA 2YD1A 3KBEA 4F8PA 2WP3T 4KV5E 1MUJA 1BQRA 1QFWM 2XICA 2YSSA 2C3GA 4L1SA 4LO9A 4HOMA 2EP6A 4OCWL 2VL4A 3BRGC 5AB0A 1THAA 1UKQA 1KTLA 3P77B 1HZKA 3DVFA 2ITDA 3S4SB 3WENA 1I7ZB 4R0LC 4PLJC 2OCJA 4HHGA 4GLRH 5I8OH 7PAZA 3V0JA 3ARDC 2CZNA 3N55A 3QPKA 4DFHA 4ODWB 3ZKNC 2AHIA 2NY1D 4N0UB 4H1LH 4HXBH 3F00A 3ZDYB 4GXVL 5FYLL 1PZ5A 4I77H 2UZIH 4LVNB 4YQXL 4HU8A 1MVUA 4L8DB 2O5ZL 1ZLVK 2FVNA 2Z31A 3L3GB 2ICEB 5CGBA 2J4WH 3QI9C 4AG4H 5B8CA 4K71B 1OCRB 4KMQA 1HHGA 4X7TA 2VDPL 4AX3A 4XVJL 5DFWH 3ESUF 2J3SA 1KCVH 5DVOA 1G9NH 3D1MC 3TN0A 2W65B 5K9QI 5F88A 4XBPA 1C8PA 1FAKT 4JPKH 1CD0A 2OW6A 3CDCA 1M53A 5F7AA 3LRMA 4Y4FB 3BVNA 3GMQB 5MEPB 1KCBA 4JM0A 5HHPB 2FRGP 4Y16A 1G7MA 1JGIA 3CFCL 1FZMB 5IK3B 2ED9A 3SDAC 4NCC1 4NENB 2JIXA 1HHIA 4PBVC 3D85A 4RMTA 2E9GA 3BN9D 2PCXA 3HMWL 2OXGB 1A4JA 4J8RB 2OZ4L 3L3IA 3QUMH 3WU1A 5AKSA 2FR4B 2E5EA 3O8XB 1DL7L 3KNBA 4KNTA 1F4XL 3RE0A 4DN3L 1CB4A 4OZIB 4Z78A 1F42A 3LH8A 2K8QA 2KS0A 1TQBB 3WMSA 3HN3A 3QXDA 2O5XL 2IWGA 3MJ9L 2DQTH 2CBMA 3MXWL 3D4YA 1IILE 5JHDB 5IROD 4LVNC 3WSQH 4NXKA 3RBGA 4IDJL 2C7FA 5D96C 2ICEC 5DQ9A 1KTBA 2BSSA 4YDVB 1ZDQA 3CX2A 2P1YA 4K71C 4LKCB 4Y19D 3RJOA 3CV5A 1R3KA 1R3JB 4ZDHA 1R5WB 1KB9K 1U21A 2VDOB 4JVUA 3AS0A 1C5CH 5KSBF 1UH3A 3LKPB 1YG9A 3IKCB 2YPLD 2YRLA 3Q01A 5LN8A 3QA3B 1W8OA 2P45B 3CDGA 3BUYB 2R56H 3F7LA 3QFJB 5ESQB 5J11B 5DYFA 1XCQA 1BREA 3ABLB 3ZE0E 2VR8A 1F3RB 1KN2L 3LNHA 4FLHA 2XJKA 4TUKL 1CFMA 4KTDL 3V5HB 1RY7B 1OSYA 5C0CB 4S1DD 3AACA 2DQJH 1OGAD 1NOAA 3QUHA 4KMTL 4XTRC 3MGAA 3HA0A 5D70H 4Z95L 3W9DA 4I2XE 1OF2A 3W56A 4DEUA 1IEAA 3BKMH 3FOMA 3R8BB 1PX8A 4KRNA 3L1OL 5B39G 3T6XA 4ZFOB 2WN2A 1IAKB 2X87A 4TNGA 3FUFA 4WHTA 2EO7A 3PV6B 3UCQA 5GGTA 1MWOA 5FB8A 3LEYL 2OKMA 3T8MA 3IDMB 3G6DL 1HOCA 5IHLB 1QP1A 1X5MA 5C8JA 3MACL 7CGTA 3DOIA 2BHFA 2I26N 4N5UA 2ICES 2A9BA 4U7MA 4YZFE 1TQBC 2WKOF 2VKWA 3U7WL 3LV3A 1MFDL 2YPVA 2X1OA 4YHPB 1UGNA 3FUDA 3FAWA 4I9WE 2BRRH 3QDGD 4P5TA 4X8XA 2Q7YA 2EE2A 4WI2A 1B0GA 3EHBB 4C56E 3LRHA 1EBPA 4IHBA 5DZAA 2BVQB 3QUXD 3PHQB 5JR1H 1E3ZA 4P57A 1NAML 5CR1A 4F1ZA 5JYMA 1XCWA 1P7QA 1TIUA 5IQLA 1H3PH 2OJZH 4KY2A 1SVBA 2R2EA 5IM7B 4EDXB 1RI8A 2XUWA 5J11C 1ERNA 4IBTA 3TGXA 4EQ2A 4R0LA 3L48A 1RJYB 3QJQB 1N4XH 1H0DB 1FV1A 5AEAA 3HHSB 3OXSA 4UQDA 1Q1JH 2AZUA 4KUZH 2CJTA 3ARDA 4PR5A 4U2YA 5IZ7A 5JIQA 4YDZA 5C07E 3ARVA 1FNGA 3FQ2A 3MJ6A 5CEYB 3RUGF 1BZOA 3EG9A 3MR9A 3IFOA 1N3NA 2ODHA 3CVHL 3SPVA 4KK6C 2X4OA 2ZKWA 3QIWB 1A6WL 1SDDB 4M7JH 5IBUG 2D3VA 4YDLB 5I1GL 3FQUA 1GYCA 2VDKL 3QI9A 1I9JL 3ARFB 4ODUB 4AL8L 3BP4A 5DI8B 4CU6A 1ET8A 5EH1A 3UFIA 1MEXH 5D7JD 2RA1A 4N2LA 4AMKH 5F3BB 3OG4B 4ABQA 4Z7WB 4QOKD 3OMNB 1TTAA 3GJEB 5FO2A 3RLSA 5C6WH 2WC7A 4IIQB 5CJOH 2X28A 5IB1B 3SDDD 1YN7B 4TSCH 2WSDA 1U8KB 3IPBA 5B39A 1SUJA 3VA2C 3RJQB 3CHQA 5E1QA 5E9NA 2Y3AA 1THCA 4Q89A 2RIKA 3RA7H 4KY1H 3MRCB 3DTUB 2VSCA 3EHBC 5CUSL 4YHIA 1T20B 4ZUTA 1DVYA 2JXMB 3SDAA 3HUJB 5HGAA 1YPZF 2FBJL 5J6SA 1AXTL 1BEYL 2PCYA 3KPNA 4K7PH 1IGFL 4XCEB 3SCMD 3TVMC 1VEOA 4OD3H 4JDZB 1B4TA 4FZ8L 3RVUD 4EAEA 3QWOB 4J8QA 2X5PA 3NFPB 2YLKA 2YUVA 3OKEB 2VERA 5I76A 1ZMYA 2ZG2A 3UGUA 3ZMRA 2VDNB 5I5MA 1H5BB 3NCMA 5D1ZC 2A83A 3MRKA 2NY2B 3Q44A 2APSA 2XPGB 2OMYA 2FTAA 2BVUA 4OFQA 4XI5D 3WO4B 3DX8B 4GYBA 4N0YH 3ECVA 5E03A 3ALWA 5H35A 2ICEA 3KCWA 2NUPB 4ZRGA 1PGRB 1J9SA 3PJSA 3U9PH 3WNKA 2VUKA 2E47A 4U1MB 3QJTB 2MNJB 4MA8H 3TIEB 3I3DA 1KXTB 5I16A 3IFLH 1KB3A 2H9GA 1BVNT 3SE8H 4RBPH 4XR8C 1U8PB 3WELA 5A2CA 5E1HB 5GHWH 1E8XA 4LDOB 1KC5H 1XF4A 2Y5EA 1U8MB 2ZSWB 2ZXEB 2HKAA 4GFXA 2NXYD 3VFVB 2RACA 3B3IB 3QP3A 4MJHA 2BNRA 1FI8C 4RLDA 1H3GA 4KVCL 5FYJU 1JN6B 2B2XH 2J8UF 4U1IA 1VGEH 1FLRH 4UB0L 3TPKA 2Z93A 1FZMA 2JKXA 1QFOA 1T2QH 5SWQB 4J5VA 2B3RA 5I1DB 2OMVA 4NENA 3U7YL 3DBXA 1SN5A 5EU7E 1N0XH 4HD5A 4JB9L 2EUZA 4Y19E 1TQCB 2YD3A 4WHCA 4OZGA 4PLOB 1YEGH 5EZOL 1TVBA 3RGVB 2YPLE 3P0YH 2IXQB 3S2CA 4JFVA 4DQAA 3FBKA 5DEFA 2ZXAA 1OP9A 2DQGL 3JUYA 3QAQA 2ZUVA 4NUGL 3CSYB 1MFCL 2EDLA 1BIHA 1OSEA 1YEWA 1NM4A 2NY2C 3MDJA 4Z0BH 5EORL 5A2BA 3QEUB 4O5LH 5DZLA 3G3LA 3C6LB 3S0PA 2XNAA 5CFAA 4PVLA 5IFJB 3QHZL 4NQSB 4PGJA 1D5XB 5ISZB 5EIIB 5KAQF 3S88H 1GSMA 1OGAE 1IGYA 4GI8A 4N6RB 1TF4A 3TBCA 2LFEA 5TH2A 4YDVA 4LKCA 1IM3A 5E00A 4LZKA 1R5WA 4LARH 3BDYL 1RUKL 4YSEA 1EJ6A 2BCKA 2HJLA 2ILLA 4NBXB 3KWTA 2ZYIA 1Q72H 4Q0XL 3EYSL 3LKQB 4WKZA 3QA3A 3GI8H 2YBGA 3SGEH 2GT9B 3BUYA 3K6FA 4KDTC 3RX7A 2C4FU 3N1QC 3H54A 1OALA 4O2FB 3TJEL 1QLRB 3CXHJ 1PAMA 4X7EC 1J8SA 1MHPH 1M9WA 3KJ6L 2XV6B 3V7MA 4N86A 5FUOH 3CK0L 1NGWB 2WLZA 2YMXL 3EYVB 5GRUL 3UZQB 1T04B 1M7DA 1PSKH 2G30A 4LE8A 2W59A 4WUUD 1IBHA 4FXLA 3HJEA 4MB1A 5FO8B 1TQUA 3QDGE 4U1LA 4I0PC 2B1AL 4OCXH 4F37F 5CCJA 2HTKD 1E4XI 5BVJB 2I5YH 3C2SA 2X41A 2X6MA 2P5ED 3HG1E 1Z1WA 1IAKA 1GR7A 1YYLL 2AVFA 1M71A 5MEQB 2EYTB 3RGVC 5BJTB 3IDMA 3QCTL 4GAGH 5F6IC 5E1GA 1O75A 3QRBA 1IBDA 4L5FL 4YK4B 1SMAA 3SOTA 2HFFB 2CK0L 3TBYA 1I75A 4G5ZL 3O3DB 4MRBA 3S37H 1TQTA 2HG5A 3BH9B 1ROWA 3FFCD 3ASOB 4GKZA 4PS4H 3WKNA 3VQLA 4F9PC 4HFUL 1KBGL 3C6LC 4YHPA 4FYTA 2E59A 1BYOA 1ECYA 2B9BA 3DYMA 4GUCA 4JG5A 1L9OA 5KANG 3V7AE 4N68A 3AT0A 5C0ND 1H3WM 1Y6KR 2BS71 2BVQA 5T1DL 1P9MC 3WY4A 3PHQA 3SSGA 1D5MA 4ZOBA 1IJ9A 4G71B 2A6IB 5C6TL 5BO1L 1NGQH 1BQUA 5AG9A 3HE7B 4EDXA 3TVMA 5FV1L 2V33A 3X1EA 2XT1B 1IL1B 5I74C 3FO0H 4LT7A 4QOKE 1ZT1A 4HULB 2J56A 3VFSA 3QRLA 2BRQA 1YEIH 4Z7VA 2P8MB 3ULVC 4U1SB 1RJYA 1ZDSA 4UILL 2FO4A 5D1ZA 3LH2H 4NKMB 3TX4A 3VFRB 2OAAA 3MRBB 3O0RH 4PJEF 4ODTH 1NUFA 3PQYE 4ZMAT 3T08A 1DBBH 1LO2H 3B9EA 2WXLA 5DHXB 3FT1A 4MGXA 3TIDA 1UYWL 4N8VG 3V0AC 3LNEA 3H6AA 3NFNA 1JSYA 1U0QA 2HFEA 2DIJA 4NJ9H 1JVKA 5AD0B 2KZWA 3NUKA 4QXGL 4LSDA 3UTSB 2XY2A 3H42H 4POYA 2XTJC 5ABZA 5HDQH 4UQEA 1L6XA 3P02A 4TXVB 4Z7WA 4UTAA 4HUWA 4YK4C 3GJEA 1IM9D 3K2UH 4M48L 5D7EA 1YN7A 5INCB 4IRSB 3V8CA 3QDJB 5BRZE 4KWUA 3OAYH 2I25N 4UTBL 4PJ9B 1WC7A 2Z3FA 2UWEF 4QCIA 2EDTA 5BOJA 3VXRD 3LMJL 3MRCA 2R4RH 4U3SB 4RMBA 1JGEB 4ONOA 1T20A 2JXMA 2GTWB 4LASH 4MDIA 3CZGA 2CHZA 2AF2A 4NFCA 3N9GH 4GKNB 4GUQA 1NFDE 1LWHA 1XO8A 4BSVB 1T0MA 3VFNA 4IBQA 4XCEA 4OLZL 5LXGL 4IKJA 1AQMA 3H9HB 4JDZA 3RVVC 1A8ZA 5DO2C 3TM6A 1FL6B 1PY9A 2CPUA 2DWDB 3BZDA 5T5NG 1JTTA 3NFPA 3OKEA 2FWUA 1RMFH 2BIOA 4U6XB 4HUVB 4ISVB 4L8CB 5D2LA 5B3SB 3JV4B 3I74A 3CH1B 1PLCA 5AW9B 1D6VH 4XP5H 2DLHA 2CXGA 2WXOA 4AIXA 5JW4R 1SZNA 4HV8A 1JZGA 2DV6A 2HH0H 5FA4B 4AH2A 1VADB 1G1KA 5E0FA 4V11A 3BD3A 5EU6B 2H26A 2H3XC 3KBFA 3WOVA 3SQRA 4D8PB 5C70A 3KWVA 2NUPA 1QHPA 1CLZL 3ZQXA 3P40A 2P8LB 2BVPB 3VH8G 1E5AA 3V52L 4LHJB 1R0AL 2G2NA 3VW3H 1IQWH 1NOFA 4LMQE 4JG0L 4LCIL 2OCFD 1KXTA 4NC1C 4N2FA 5TE6H 1P4LB 2VDOL 2OCCB 2YFNA 3DMMC 2K7QA 1JFQL 3CQQA 4HSAC 4KDTA 4N8VA 2K4AA 1YNLH 2ZSWA 1U8MA 4IRSC 1D5RA 5EZJB 3UTOA 4X0KB 5J3HC 4PJ9C 4OM0H 3RWFA 4H7VA 4HDIB 2BIHA 1YEDB 1KXQE 1U2YA 1URIA 1F6LL 1F4HA 3TZVB 1KPVB 2CMRH 3GSVB 1L5GA 3MROA 2JELH 4I0PA 3VDAA 5SWQA 4XC3L 4EIUA 5CN2A 4OZFG 4APQB 4Z5RB 2DQDH 3IDGB 2V2WA 3FCGA 2IH8A 3UZVB 1IX2A 5EOCL 1CQKA 1WICA 2IGFL 4ES9A 1KBKA 4MJIE 4L1LA 3R7RA 2WW8A 4Y2DD 4AEHL 3RGVA 4U0RC 4ZFOL 2D3LA 2XA8L 5D5MB 2W0LA 1PPIA 3HNTH 3WD5H 3QJHB 3GSNA 2L04A 2BHZA 4PJCF 4KXDA 4NP4H 1QSVA 2UX6A 4J27A 4W9ZA 3VM5A 3ZUNC 2JVUA 1D6EA 2V0AA 4F9PA 4ZS6C 2C3HA 4HCRA 3C6LA 2YEQA 4PWJA 5K1JA 3QZPA 4WUUE 1ORQB 3HS8A 5EIIA 4N6RA 2RALA 2W9DH 2NX5B 4XNZB 3L1EA 1KGUA 3NZHH 5IHZB 1UKSA 1P9MA 3B2MA 1RZQA 2P5EE 2WXNA 4B9ZA 1B4RA 4IGBC 2M83A 3QZOA 4GNKB 5JIMA 1A6ZB 3LKQA 1R3HB 3RPBA 1FE8H 2ZOKA 3P69A 1O7DE 4BZ1H 2GT9A 4KH9A 4ZAKB 5B4MD 3MJ8B 4EVNA 1QLRA 2HPTA 3QZMA 4GQPH 5F72S 4AVIA 5EU4B 4Q6IB 2OL3B 3UZQA 3FFCE 4MQ7B 4B9PA 4OQTL 3KDPB 3MCLL 2QQNL 1NL0L 1TZGH 3CZUB 3LKOA 4MHHG 1A4AA 3A0OA 5KJ4A 4A2GA 2R69A 4F57H 5BVJA 4CBZA 4M7LH 1D2OA 4PV8B 4KZDL 2VDLB 1JPFB 1EMTL 3D4GA 5IT2H 1DFBL 2OMUA 5E8NB 4GP4B 2OTWA 4IBYA 4HCGA 1MFVA 2HKFL 5IQMA 4BK4A 1UASA 3OG6B 3S3CB 5GGSY 5I1CL 5DK2B 1XH0A 2Z1KA 5LHDA 4NWUH 3V0HA 4DN4L 1WGVA 4L3EB 4OZFA 3FFOA 4JGJA 3BH9A 1SJEB 4YSSA 1CURA 4I1NB 1QW9A 4PH8A 3V8OA 5JHBA 4KJYB 4XN8A 2ZAIA 1ETB1 2V9UA 3D0VB 3L9BA 2OYLA 2FDBP 1OCWH 2PR9A 4NJAH 1D5ZB 1SF3A 1U8OB 2ED6A 4K5OA 1WG3A 2YJLA 1PLAA 1TJMA 1FYTD 5I30L 4GKSB 5A6LA 1TFPA 3HOGA 5IMLB 4ZAKC 4FQQB 1DZ0A 3GPEA 3DROA 5I15L 3H3PL 5I6OA 2HN7A 4PJIA 2VUOA 1SM3H 3VSQA 3VYOA 2ESVA 4XN5A 2OMZB 3II2A 3TA3B 3VB8A 3LKSA 1FNFA 4TQHA 2NY4B 4UWQB 3VXRE 3NACL 1B2WL 1YUHA 3ASWA 3BIAX 4ONGL 5CAYB 1UA6H 4FABH 1X5FA 2ZNXA 3ECWA 3F05A 4D0DA 3JTSB 5AD0A 2Q87A 2QTEA 3KWXA 4RFNC 5B21A 2F6AA 3HMXH 3RVWC 2DM4A 5FCUH 1Q0YL 2AV7A 2AK4B 2IADA 1WZKA 2NMSA 3NA4A 3LH9A 2RH0A 5EZPA 5IR1B 2C3XA 1UZ8A 5MENB 3K71B 5INDB 2C9AA 4NT6A 1LLAA 3DMMA 3C8KB 4G80A 1YC7A 2K45A 3UDWC 5DZNA 5INCA 4IRSA 1HWWA 4PS7A 1KGYE 5I28A 4PJ9A 5F1KC 3IXTB 3PU7A 2DQFA 5F7BA 5DJCA 4P9HC 5EA0L 2L4OA 4U3SA 1JGEA 7TAAA 2GTWA 1GHFH 2NY6D 3MREB 2DBLH 4GKNA 1F90L 2TRYA 4N87A 4YHLL 1BJ1H 2Z6FA 1T4KB 3SKNB 4OVVA 2YGOA 3H9HA 5GGVL 3D51A 2PUQT 1RU9L 1B9KA 4F8QA 4NO3B 4QRPA 4U6XA 4HUVA 4BRJA 5DS2A 4L8CA 4N2MA 1HTYA 5GS1B 2V3EA 4JKMA 3JV4A 1L9NA 4I5BA 4BFKA 4I88A 2MHAB 4UU9B 4GKLA 2VZUA 2OA9A 3TA3C 4QXTA 4HXAH 3BC9A 5FUZL 3N04A 2VH5L 4AI7A 1SYVB 1VADA 4BE6A 1ZVYA 2V9RA 1BZ8A 2OYPA 5EU6A 4KK9D 4PJFF 4D8PA 2F8IA 4PGCB 4PWIA 5DC2A 1FBIH 1P5UB 1XEUA 1VACB 2BVPA 2OXHB 3CMGA 1YY8A 1QTSA 4ZPVB 3QDAA 3GTTA 2J1YA 4OKDA 4F1SA 4IGBA 4NRXB 2OSLB 4HGWA 3FN3A 1P4LA 4PRDB 2MMXA 4R8WL 3B5TA 1FFNB 1N59A 3BKCL 4HALA 4R7VA 2KLTA 4FNLL 4B53A 4NAMA 1S7XA 4KBPA 3V5KB 5MI0C 2Y1VA 1A5FH 2HRPH 2J20A 4X0KA 1USZA 1JTPA 1YEFL 4LP4A 1QFPA 4Q8BA 4B9CA 1KGJA 4M29A 4C4UA 3BRFA 2JCCE 4IYKA 1DLFL 4HDIA 1XXDC 4J3UA 4DNLA 3OKOA 3O3EB 3FUHA 5CJQL 2MCMA 5DC9B 2FSEB 4PJAE 3MV8D 4PUBL 2BOBB 1AY1L 1SEBA 4BSJA 4YN3A 4EOWL 2E9IA 4TSAL 3SGJC 2B5IB 3FU3A 2FUTA 4WQOA 3UEZA 3TV3H 1NCBH 4YXKL 1M7IB 3QWRD 4GG6B 5GJTL 1FFOA 3RPKA 1FAIL 1RZIB 4OZHB 4N85A 1JWSB 4G6FD 5GS1C 1KIQA 2DF3A 1D9KC 4MMZB 2ZONA 3VXME 3T0WA 2KERA 4LNRB 2MKWA 3FB6A 3ZDZB 3K8KA 1USQA 4GRLD 5BRPA 4WGKA 3CGTA 3I84A 4H8VA 2W1NA 1MSPA 4PREB 1KJ2L 3BKYH 2E7CA 3K6NA 4MNGA 4L2LA 1MJ8H 3SO3B 2NX5A 4X6CF 4DOHE 4YHZL 5FM5O 4XPTH 1P5UC 4AW7A 3P11L 2VXVL 1FYHB 2B39A 3X1GA 3SDCB 5AOKA 5C0BD 1A6ZA 4MQXC 3EOAA 1R3HA 4U4IA 2KLSA 3ATAA 4HHAB 4ZAKA 1HJCA 1N5AA 4ZO7A 4PJ7E 3HW7A 2WMPB 4Q9RH 5IVOA 4PRNA 5DS8B 3RIKA 1TSRA 2OL3A 2WYIA 3PYCA 4LIQH 1PX4A 3SDXE 4AKPA 1OAUL 4X4ME 4ALAL 4R2GD 2IFGA 1ROCA 3ROOA 4Z77A 1KIRB 4OTXH 2XWJB 4PN6A 5C0AD 3IMTA 1ETZB 3WNNA 4PJGF 4W70A 2OK0L 2B5IC 4IRZL 3GRGA 4QTHB 2WVSA 3DC0A 3OJ2C 1XAUA 5KVGL 3SD2A 1JPFA 3AADB 3GSRA 3DX9B 4XNQB 3VXUD 2VZTA 5E8NA 3DDFA 2CA3A 4EN2A 3S9DB 1EX0A 2EVHA 2BSTB 1O9WA 1MIML 3QORC 3WLWD 2HMID 1A0QH 5AALA 3NIFF 3HAEB 5DK2A 3CDZB 4MMZC 3Q9QA 3JUZA 1CE1L 4OY9A 2YAEA 4L3EA 1BLNB 4YPGB 3UDWA 1E7UA 2BINA 1SJEA 4H0IA 4ZMLA 2R1YA 1R5IB 2NNFA 2VZ3A 1U8QA 3WE6A 5IBLD 4PV9B 4KJYA 2AXWA 2IDCA 1Z6JT 3DI3B 4WY7L 2X2UA 3P2BA 5D7HA 3SO3C 1SY6H 2B7DT 2HVKB 3SYCA 1U8OA 4D7PA 3UAJD 4HIHB 2P26A 2FATH 3KPMB 2W92A 1X5YA 2LLNA 4JRXB 3GFUA 2HT3D 2HRLA 4GKSA 1MLCB 5DT1H 4G6AD 2X1PA 2GUOB 4P3DB 3GI9L 4KQ4L 5E6RB 1UXMA 4PYHA 5HDBF 5E7FA 1BHGA 3TASA 4UT7L 1EHLH 2WTPA 4LHUB 4CKQA 1S5IL 1QMUA 4YSQA 3MCYA 3KGTA 1QUNB 3TA3A 4DO5A 2WXGA 3VYNA 5KYYB 1TO4A 4OLYL 4QAMB 4NUPA 1NUNB 1ZK9A 1JZ4A 4AYFB 1X5GA 4FQLL 1XF5B 1MH5A 3VGAC 4JY5L 3JTSA 1N6UA 1I7RB 3X17A 3QZWB 4KKNA 2OQJA 5F1OB 4B7IA 3D39B 1J8HD 3RWIA 3L9RB 4OCRH 5IR1A 2VZVA 3K71A 4MCYB 4L29B 5MENA 2ZX5A 1MG2C 2DQUL 4NQDD 3DJZA 2BY2A 1I85C 1EA9C 2A9NH 4WW2C 5FA3B 3VI4F 3FHEA 3GIZL 4A2LA 2PTTB 4BCYA 3RWGB 1FF5A 1BZ9A 2W8CA 4KVPA 1AS7A 1N6QL 3NA9H 1XL6A 3OX8B 3K4DA 1HT6A 3BISA 3OB0K 4DPAX 2WZ0A 1D5BA 1AXIB 2AJYL 4XBGB 3LEVL 4GMTH 4AJ0A 3SGJA 1GAFH 5KSAD 2ZZUT 2JQZA 4UT9H 2R2HA 2BP3A 2C26A 1TSHA 5GZND 4NRYB 5L88H 3TF7C 3OHMB 3FZUD 1RZKC 2DYPA 2IWFA 2BFVL 1P2CB 5GS1A 5I0VA 2C5DC 2B8OT 1D9KA 1JK8B 2YZ1A 3FUJA 4FG4A 4WK0B 2K70A 2MHAA 4UU9A 4W9GC 4MHHI 4NQEB 4N8CL 4LQFH 4ZNEE 1OAZL 4HUMB 4X99B 1HHHB 4R4NC 5I1JL 1SYVA 3JT2A 1OSZB 1JD7A 1RV6X 5AWNL 1DVFD 4DP2X 3E7JA 5FYJL 3L17A 5GGRY 3WDHA 1CL7L 4X5QA 3MV8E 2EE9A 2ZKHH 3BLPX 3MNWB 3QO0A 4PGCA 1P5UA 1I9IL 3UP1A 4B0MM 4J28A 5L2JB 4GPVA 4F93B 2EYRB 2NXZB 3KAAA 2E76C 4ATTA 2LFGA 4FFWC 3WFCL 4PRDA 4JO8A 1CQYA 1CXEA 3V4VB 2FH6A 1T21B 3OJDB 1G6RH 1HESA 4TNVK 2I9LA 2KQNA 4W9JC 3V5KA 1RK0A 3SE9L 2EO9A 4KC3B 4L4TB 3T0EC 4W9EC 2YBRB 2J72A 4HS6B 4HIEB 4H5SB 1E5BA 2EKSA 1EFXB 4Y1AB 5CMAB 5DRXB 5EBWB 5HXMA 3NCEB 5JLZB 1N10A 3PWLB 4GRWH 3MRIB 1F3DH 4KFZC 2XV0A 4PI2A 1JMXA 1T5KA 2G4EA 2V17H 2VYRE 4UCFA 3ZQWA 2FSEA 1WSST 2BOBA 2R29L 2C4XA 5AZ2L 1ZCRA 3OR7A 4HKZB 3LKRB 1M7IA 2GK0A 3FRPG 2AEPH 1IB5A 2DWEB 5AFAA 4GG6A 1RKRA 1RZIA 2ZUYA 2EE3A 1OVZA 1OTTD 2VDLL 5C0BE 3QORA 5EOQL 4JPWH 4MJ6B 1BMGA 1I7TB 4MMZA 3RDTD 4LLUB 4LNRA 3VFTB 4MS6A 4ZMPA 4ZXBC 2DQCH 3AMLA 3CX5K 5HD8D 5F7WC 1GW6A 1YA5A 1QAWA 4LIQE 1FVDB 4WI5A 1CBJA 5KZCD 3KJ4B 3OKNA 4ABWA 4OV5B 3DSFL 3CSPA 5CGYC 3S34H 2BSRB 5C0AE 1F58H 2VLLB 4FTVA 1OO2A 3CQPA 4GT0A 3VCLB 3P2DA 1BFSA 1TLMA 1Y07A 2DWTA 1HXYB 3VXUE 4KKPA 3WAJA 1ANUA 2G3NA 1RIVH 4KAQL 5TF1L 3EGSB 1DVQA 5FHBL 2P4AB 5FLUA 5L0QB 2K1MA 3WS3A 4AY0A 5E1AA 3M86A 3RNKB 5E4OA 5BW7C 2UZYA 3HG5A 5LLIC 4OF6A 4NI3A 3GLDA 1GIGL 4IKNA 3LQAL 2J1KA 4MQSB 4PV1C 3S3BB 2F7PA 3DPBB 4JHWH 3L2MA 2VXQL 5AVWB 3QIUC 1UTDA 1JZHA 2YN3A 3L5JA 3Q5YA 3QXAA 5H37A 2E9WA 4M3JA 3D69A 5ICXB 3HZMB 3INUL 3JT0A 1QBML 3E8UH 5DMIL 2AZAA 5DC0A 1B3IA 3HAEA 3O41A 1F2XK 3CDZA 4FI7A 5D4QA 3T0VA 4ZK8A 2PO6D 3ARQA 3GC3A 4CVZB 1I85A 2DLGA 4WW2A 2IWEA 5DRZB 1XFPA 4XMWA 2JJSC 3ZJAA 3AW5A 3L13A 3MGOA 2QPEB 4H8WH 2VLKD 1R5IA 5DZOA 4LU5H 5B7FA 2A1WH 4PV9A 1S3RA 4O4YH 1Z9PA 1U8IB 1FL5A 4YC2C 3P3UA 3BAKA 4I0CC 1O9VA 4JY6B 4PRHD 3CFQA 2O6FA 4K94C 5DEJA 3BZ4A 4KI5F 1VEPA 4JRXA 1O7SA 1J1OH 2A4CA 4YXHL 1J8HE 5AVRB 1MLCA 3LB6D 4JO2L 2ZOOA 4I85A 3AMKA 2DDQL 2AKRA 1AJ7L 3N2JA 4KKAC 4Y4KD 5FAAA 2Y72A 5A16A 4W9HC 3DUSB 1J5HA 4PJDE 1Q0EA 3DO4A 5F9OH 5L2KB 1G0DA 2AGJH 5T1MB 3OJVC 5IQ7L 1BQSA 1LP9E 3RGBA 1QUNA 2VQ4A 5HPMB 3GRWA 3EYUH 2ZYRA 5KYYA 3KPPA 4GW1A 3NCCB 5DUPL 4PCYA 4WNQA 1BJ1J 2FBRA 3HI6L 1IFHH 5AKVA 2HJFB 3MBXH 4AYFA 3P9MB 5FOJA 1TEGA 2IBZX 4G6JH 3VGFA 5J89A 3VD4A 2Y36L 1RIUL 2W9EH 4JZOB 3HE6D 4NSKA 4HK0A 3D39A 3VD3A 4DZBA 3UJTL 1I1YB 1IC1A 3N40F 5BMFH 4QXWA 3TT1H 4JDTH 1ZA3B 4JM4L 4MCYA 4L29A 2MKLC 4QRQA 4XHJD 2X6BA 5TQ0L 3V5DA 5BUPA 5FA3A 43CAA 2H1PL 4DK6A 5C7XH 1N5YH 3IDXL 2PTTA 3MYJB 1XBDA 2OPCA 3T0EA 3RWGA 3VG0H 2QADD 3BAWA 1KCUL 1KCLA 1W0VB 2D73A 1CGSH 2YFOA 4GRMB 4C56B 2ZTBA 1DVZA 1LNUA 1ILUA 2YKLH 3O4OC 1T1YB 2CJUH 1SFHA 5EB9A 4M56A 4F7TB 2J7LA 1BFVH 5E2WH 3AZUA 3PIQB 2IAMB 3T2LA 3FONB 4NKQB 3C5ZB 5CWSB 2OTUB 1NGZA 1KGIA 3KLHC 4TTDD 2FIKB 1RPKA 4JRWA 2VQ1B 3VYPA 2IOOA 3U79A 3VI3B 1RZJL 4S10A 5DA0B 5L7XL 2GTZB 1WIPA 3MNZB 4A2FA 5SWSB 3PGCB 3SKMB 5CF3A 1JK8A 1UWXH 4FFZA 3ZZQA 1IAIM 3KH3A 4ZXBA 2GVYA 1ZJAA 3G6JB 4PRBB 3GSOB 4NQEA 5E4IA 3QUYD 5IHUL 2EH8H 4X99A 2ZXCA 4JO3H 1RLBA 4GRWE 4CN6A 4L4JA 5C0FA 2EE0A 5EFIB 4FQJH 4V1DD 1QFWL 3C09B 2KPNA 3MLRL 1HL4A 5FS5A 3X1BA 4YBQC 4M4RB 1C1EL 3TCLA 3TV8A 2VRKA 3FOLB 3KXFA 1OT4A 3LXBA 5HYJB 4XMKL 5KOVC 1E2WA 3Q13A 4NQCD 4M7KH 4NO2B 4H1LB 3TH3T 3EZJB 4FQXC 2DI7A 2YBRA 4F92B 4H5SA 2B15A 5EBWA 1EFXA 2AJSH 4FHKA 5CMAA 1YAIA 5DUBA 5BW7A 1Q9LB 3QUGA 1QO3B 2X9WA 3MRIA 3MLWH 4ZZKA 3CXDH 5DJAB 4BZYA 2QEJA 1CXFA 1KYFA 1YNTB 3QIUA 1I8MB 4UQCA 1QWHA 2YD5A 3GBEA 5GISH 3ZDXE 1XF3B 2O61A 5AW2B 4HKZA 5L4FA 1EGJH 1FZJB 3HIZA 3LKRA 3WIAA 4P46B 3L81A 3BVUA 4KU1A 1JXJA 4DQOH 3NIDE 4E9TA 3QBTB 4IRJD 2MEJB 3DOSB 5D8JL 5F7DB 4U1KB 3IJHB 1AS6A 2PYED 3CPLA 4LLUA 3PUUA 2JJSA 1N6VA 1KYAA 5C2BH 1OF0A 2NDGA 4LFHD 5DVPA 1GL4B 2BOCA 3QEQD 1FCCA 3BO8B 5C3IA 1ZVSB 4PS3A 1WAEA 1F86A 1BWMA 3EOBA 4OV5A 1G9ML 3ZOAA 2PTUA 1NCAL 1UFGA 1WZ1L 2FCBA 3ZHFA 4BBWA 5KTEH 2WBJD 3EO9H 3MRMA 4IM8A 2J44A 4JPVH 3EFOB 1MNNA 3DX0A 5T5FL 3VDCA 3HG2A 1G7QA 3GLEA 3QQ3B 5I8EB 5I1AB 1XR9B 4R4FL 3ARBB 5D7KE 3T5WA 2WKGA 5E6IB 2DAVA 3NEXA 4HJGA 1X4XA 4N5EC 1QRNB 3VJ6B 2EDYA 4UIKL 1DQVA 2F7RA 3DJRA 3OAZH 3S36X 2XWCA 3BE1H 5F7EH 3CHOA 3F58L 2DYRB 4BRVA 1XIWB 4NHCL 4XMUA 4ZW8A 2AAVA 2D9CA 3MMEB 1C12A 3IU3A 4H20H 4W9IC 1TMCB 2Z4QA 1CU4H 1R3LA 5T33H 2C1OB 3BOVA 4PRHE 4YFLF 1G9NC 2VOTA 4P46C 3GB7A 2AFNA 4QRTB 2EEBA 1RZFH 3UC0H 1GKOA 3ROLA 5DD0H 3AG2B 1CYGA 3VU2A 4ABUA 2FQDA 1MW0A 1FHGA 2ATAA 1JRHI 2CKBA 5E23A 4CVZA 1Z9OA 5C6PB 3FMGL 5DRZA 3D34A 5E6UB 3GNMH 4MSWA 2UVEA 1JGLL 2FT8A 3C08L 4ZO6A 3ZKQD 3W38A 5HSFA 4MYWB 3TCXA 2L3BA 3KLSA 1DN0B 1A3RH 3M7FB 3BPCB 1A6TA 2FJFA 5EF0A 1DJHA 3MRGB 1JGVH 3BN9C 4HZLB 3C5JB 3HNVL 4OJEH 4XO9A 3STZB 4KI1A 1KLGB 4RRPA 1IU1A 1KTKE 2L0DA 1LMKA 2C1PA 2VB5A 1G1OA 3MA7A 3JTBA 2X70B 1UWEL 4NOFA 3ARBC 4L8BB 2DM7A 1Q0XL 3MRQB 5AOMA 5HVHC 1E8WA 2AITA 2R0LL 1L7TH 1KJ3H 3DUSA 4Z7OE 5L2KA 3HUJF 4HZAA 5L8LB 3UXFA 2R0ZL 5IROC 5T1MA 3U4AA 4H26A 4RGOH 4O00A 4XPGH 3HHMA 4I2XA 4AQEB 1IQDA 5HPMA 1HXMB 1BBJA 1XIWC 2C9SA 4OZ4B 5EU7C 1QPKA 3I2CH 1B6UA 4UQ3A 1WA2X 1BJ8A 1PKOA 4QKXB 2HJFA 3MRFB 4NGHH 5F3FA 1UB5B 4K5NA 1WWAX 3X14A 3GKWH 1BM3L 2HG0A 4UM9B 4M6AA 2Z92B 5DHEA 3SOBH 5IB3A 3PL6D 4DSYA 4UT6L 2EEFA 4U6HA 4MBRA 1HJBC 5IOPB 4JFQA 3O6ML 5KJRH 2JLPA 2EXSA 3NJNA 1PG7L 2AABH 3MYJA 3V4VL 5F44A 1U2CA 4FQXA 4S1DC 2JMRA 4CILA 4EBQH 4QJ5B 3NG5A 5E08H 3E6FB 4C56A 1W0VA 2GBAA 2DIBA 1UB6A 4K3GA 2DN7A 1RP9A 4B7LA 15C8L 4F7TA 3ABGA 1LJMA 4V1DE 3GHEL 2YIHA 3HCVB 3PIQA 3H85A 1E9QB 5CWSA 3FFDB 3QW9A 5L9DL 1V3JA 2AV1A 1XGUB 3HG4A 3OB8A 4JG1H 5GGQL 1F8TL 2FIKA 2VQ1A 4OCWH 3VD0A 5LO7A 3VI3A 2G4GA 5FWQA 2CUHA 2GTZA 5ESVB 1KT2B 1LDPL 3MNZA 3TBTB 3BP6B 3UACA 2EEXA 1A7PH 2FGZA 4UUJB 5GGUB 1F3DJ 3LXAA 1S8DB 3SY6A 3GD1C 5KYNA 4PRBA 25C8L 3R8QA 3G08B 3FL7A 4RSVA 1E9PA 1ZLVH 3W39B 4PP2B 3BUTA 5FYLD 3NSFA 5FYLH 1JYXA 4Y4HB 1VZHA 4YQXH 3NJGA 1RUQL 2VM3A 2O5ZH 2RHEA 2WLKA 5CBAA 1IAMA 1AQKH 1R1CA 4UV7L 3UAAA 2XKNB 4XWOD 5J1AB 4PS8A 4S2SA 2A3TA 4WTZG 2GHWB 5EDSA 2VDPH 1BAFL 2QMKA 2ZP9A 4Z0XB 1BZ7B 5E5MA 3RB5A 3ZT6A 5BRZB 3Q8BA 4BUHA 2PYEE 5F9AC 4NO2A 1SJMA 4H1LA 4DO4A 4MB4A 3I50L 1MDAA 2NT0A 3F7PC 3QEQE 1TCRB 1E4WH 1QO3A 4OLUL 4WK4B 2CQVA 2H0JA 2CDFB 3IMUA 5DJAA 2F08A 1I8UA 2X3AA 1B90A 2ZX9A 4YHNB 1CFQB 2PW1A 4DK5A 2P7TB 4GMSL 5D7JC 3H4HA 3QIBB 5IG7A 2W95A 1QWUA 4P46A 3X3FH 4G8FB 4EJ1C 3WKYA 5BXFB 5FKPA 2OZ4H 3D0LB 5FK9B 4HJIA 2FGWL 2D4FA 3SDDC 2FSDA 3CLFH 5KSUB 4U1KA 4JO5A 3IJHA 4HSQA 5KS9F 1QUPA 3F3HA 2YQ3A 1NCDL 1IC4H 3PXHA 2J8HA 5EBLB 1F4XH 1KJMA 5HPOA 1M7XA 2VR4A 4WK2B 3NN8A 4FHJA 4YHOL 1JG9A 3M1CA 5AW3B 1HEZB 4JN2B 2O5XH 3MLVH 4RWYH 5DJXA 4GP5B 3GXPA 2DKUA 1UACL 3MXWH 5D7SL 2BVOB 2F19L 4IDJH 2PPAA 2WZAA 3FN0H 1GZHC 3QUMA 1ZS8B 4NZDA 2VLJD 3LQZA 3QEHB 5I8EA 4NXSA 3ARBA 2WZ5A 3NDZE 3O3BA 2YPVL 5BV7H 3L4YA 4JM2D 1JE6A 2ZWLT 3CFJA 2O26U 5DJ0A 2IALA 3EJQA 4HJTA 4RH4A 3UJIL 3RY5A 3DXAD 3DYOA 2YPKB 1IC7H 1KN2H 5IROA 4YJZL 3GBNL 3BGFC 1F11A 1FG2A 4LSTL 4TL4A 4NUJB 4TUKH 2Y7OA 2FHCA 4WTZA 1F4YL 4HKJB 4I89A 4KTDH 1XIWA 1YY9C 1XR8B 2X4QB 3MMEA 1DQMH 1U36A 4ZT1A 1VFUA 1SQMA 4MJIB 5FYKL 1RVFH 2W0KA 3VMOA 4XPAL 2ZD0A 2E7BA 3Q2VA 2YPLA 4IHOA 4OUUA 2CCVA 4MNHA 3V7AG 1WJ3A 2WJ5A 3QDME 5I66B 5DHDA 1VFOA 1DTUA 3LEYH 3O81A 1WPCA 3G6DH 1VPOH 3N3EA 4CA4A 2P5WD 3QYMA 3VX1A 4AT6A 4DKFH 3UTQA 3HR5B 3TPUB 1SOKA 3F7YB 4ZMOA 1SHMA 1OGAA 1MFDH 4AQ1B 1P84K 1DN0A 2ZJSL 3GF8A 3HNSL 3BPCA 3HC0A 4PTUB 4W6YB 5IREA 1IKFL 4P9ML 4HZLA 3C5JA 2VT0A 2I60L 2J1ZA 5CCHE 2IMMA 4PJ5D 4CNIB 5LXVA 1O6SB 2VLRB 4ZQTA 2X70A 1NAMH 3QRGL 4LPUA 1HIMH 3UTTD 4L8BA 4TKWA 3AU0A 4AQ8C 1HILA 3MRQA 4A66A 2SEBA 5AL0A 1NMAL 3TEWA 5I0WA 1TU2A 3HZVB 3BYTA 1JNLH 1ZA6B 3MLYL 1CIDA 3GS4A 4ZW5A 1JYNA 3QDGA 1BP3B 1AHWB 2HLEB 1E6OH 2Z35B 1HXMA 4W4NA 3STLB 4AQEA 2GSIB 9CGTA 4OZ4A 5I17B 3ATEA 3HG1A 1NGXA 5E4EB 5FHAH 2HJKB 2BP5M 3QQ9D 4Z76A 3FO9B 3MRFA 5CM1A 5I9QC 1A6WH 2IGLA 5I1GH 4NC0B 4UM9A 1HH9A 1I9JH 3WS6C 5C0DB 3KPLB 2Z92A 1G7HB 3T3MB 3APFA 2Z31D 3ATDA 3C75A 3RKDD 3OKMB 3SY0B 2J73A 4C58B 4F58H 3BVXA 1OAKL 2G9KA 4KK8D 3S97C 1FO0L 2EC9T 3QO1A 1TCMA 1ZEAL 5IOPA 2PF6A 4BHUA 3JTTB 1CMOA 3TN0D 2HT4C 4GIPD 4P2YA 1O6TA 4MMYB 4Z9KB 5F7KC 4AQ1C 1IGCL 3QGVA 2HTKC 2VZ1A 2QSVA 3DTDA 3GSQB 3MO1B 5CUSH 5FYLE 2OR9L 2A73B 2GSGB 4RNRA 5D7JA 1UM4L 4Y16D 3OZ9L 4TTGA 5CJ5A 4GAYA 2FBJH 4ZSOE 3S35L 1AXTH 1BEYH 3IDNB 4G5AA 3JWOL 4QOKA 4MXWL 4YHKH 2JIXD 4IBSA 4M8QB 3VFGL 4FZ8H 4UAOC 5ESVA 3SDDA 2EACA 3PQYA 3TFBA 5LUMA 1F1DA 1U3HB 1CGYA 3VTTA 2QGEA 1BF2A 1BVKB 2FJHB 1QBLL 4NKIL 4BZ2L 5ITBL 3G08A 3CFDA 1E2VA 4DKEL 4KKCD 3RWHB 4F7PA 2Z4TA 3RTLA 3QXWA 3W39A 3X13A 1VGKB 4UDTA 2I7OA 4OKVB 5IHWA 3U46B 2CRMA 1WBZB 1A9EA 2XKNA 1JYWA 1B0WA 1GZHA 3F6JA 1Q94B 5KBKA 2N59A 4KOBA 4Z0XA 1JF1B 3WTUA 1RUAL 5BRZA 1BQLH 3AM8C 5IQ9A 1VENA 2VM4A 4LPXA 1QLEL 3UG3A 4ZTPL 1HHJB 2KYIA 3TFKD 4X6CE 1S9XB 2XKSA 4ONFL 4R7DB 3WEXB 3LZLA 2MPAH 4AQAA 4KVCH 1A47A 1B0RA 1YC8A 3PP4L 3HEIB 3PDOB 2CDFA 1NDTA 3SPIA 1NFDA 4R7NB 4YHNA 1S46A 4E9RA 5DMKB 3HB3D 1AOZA 1U8JA 2NQDA 1UOVA 4OIBA 3BWZA 3MNVB 4JB9H 4X6DF 4G8FA 5D7IF 5DZPA 2HFGL 2AERT 3FO1B 2IBZY 3NQKA 4HMCA 2GEEA 2VLJE 2NYYC 3D0LA 3IS1X 5IVZA 1IZJA 2F53B 3WNMA 4NO0B 5E70A 2H3NB 1FDLL 1PDKB 4XOEA 2QVKA 4PW9A 5GGTH 3Q48A 3VWJB 3IU4L 5EBLA 2YGVA 1WP6A 2B1HH 5FGCE 3MVSA 4GLRI 4H4NA 4XNXL 1YUKB 2IPTH 4S11A 3L9EA 3DXAE 5HGDB 5C1MB 5JIDA 1NUGA 4F33A 4PJGE 2GAZB 3OKDA 1XSIA 5CHNA 1P6AB 1S9YB 2BVOA 2MTPA 1ITBB 1LEKB 4XE0A 3QHZH 2WZPD 1JVLA 1AKJB 4OCSL 1SXCA 4P5TD 4WO4B 3CIAA 4N9GA 2AEOA 4NQUA 3NIFE 3ULUD 2FWOB 3GJFB 1YECL 4N26A 5IHBA 3BDYH 3ZW3A 3QEHA 5BNXD 3K5RA 4LESA 3LKNB 1KN4H 3T71A 1UT1A 1PNCA 4WWKB 4AQ8A 4G8GE 3HZKB 3DX6A 1QSEB 3X1FA 4XZ4A 1PKQE 2A77L 5HVFB 5A7EA 5H2BB 5C9KA 3PAVA 3WEMA 3QQDB 3RNQA 1KXQA 2P5WE 1ZIAA 5KJ7E 2V2TB 3KJ6H 3NJXA 4OIFA 4K23L 4EIZC 1GMEA 5GRUH 3VGHA 4AYID 1KYDA 1DEDA 1S2EA 2HVJB 4B0MB 4YO0B 2AJVL 2GI0A 4R26L 4J3OF 2X4QA 1PBYA 2ICWA 4PWHA 1PL3A 3ARDD 4UBDD 3ZKND 2B1AH 4OF3A 4TSBL 4X6BA 1ZGLA 4MJIA 3RPIB 5LBSL 1JL8A 2IV8A 3MUJA 3QR2A 4G7VH 2EDXA 2Y22A 4PJ5E 4I3RL 1ZTXL 3ZTDC 4L3AA 4MDJA 4B9FA 5HDBE 2P80D 3WS6A 1YYLH 4OB5L 5I66A 2QL1A 1AGCB 3C60B 1HOEA 3JSSA 3VXMB 2NZ1A 3QI9D 5SWZE 1CTOA 1R3IL 2APXA 5BQDA 3UTTE 4Y9EA 4HIIA 4OM1L 5HP5A 4EF3A 3QJZA 5IQOA 4L5FH 2WXJA 4F9LC 2CK0H 2WINB 1AIZA 1UOLA 3LIZA 4UOZA 5IB2B 3BJLA 3VRJB 1E0OB 4WUUA 3F7YA 4JR9L 3EH4B 4HFUH 4AQ1A 3VX0A 2XZZA 4ADIA 4MAYB 4DFIA 1LK2A 1IFRA 5LG6A 6CGTA 2JLLA 2P5EA 3FW6A 2V3DA 4OJFL 1G9EA 4UTAL 2C9XA 5IIEA 4CNIA 1O6SA 1X9UA 4GBXB 4Y2DC 1N70A 5EO1B 2EIZA 4JFUA 4FOMA 3QCVH 1H19A 3KPRD 3SDAD 4JLRB 4HJJH 1JXDA 2YEZB 3ZMNA 4WWKC 3W3BA 1CD9B 1GYWA 3W0WE 1KIUA 3CG8A 4QNPE 2GK2A 2H6PA 4K3JH 3F7QA 1HKLH 4BFIA 2D7TL 4UYPA 5IJVB 3GBLA 1UVQB 2WANA 4WV1B 2LTQB 3ZTEA 3DTXB 1UM6H 4Y9CA 4CBPA 1WVZA 5LBVA 3STLA 3T3PF 2PNDA 3CFKB 3DX2A 2H8PB 4MB3A 4EZJA 3VRLF 4HK3J 2HJKA 5LDSA 1UYWH 3FO9A 1U8NA 2VXTH 3PNWB 4NUQA 1A14H 2J2ZB 4MJ5A 5C0DA 3WNIA 4OCYL 3FB7A 4QXGH 2DTML 4BUGA 5DO8A 5K9OB 4Z1PA 1PS3A 4YAQA 3SY0A 5B4MC 3UG4A 5E24E 5CNHA 1M4KA 3AM8A 1H15B 4M1GL 3JTTA 3GGWA 1PFCA 8CGTA 5JO5A 12E8L 3AABA 4FEMA 2AK1L 4UTBH 1MI5B 4KDVA 1NFIB 4MAYC 1UXSA 5IMOA 1TTBA 5JZ7C 4Y4FD 2BNRD 3LMJH 1S7WB 4PJ8B 3DO3A 4MS8C 2EABA 3RL2B 2X9YA 3BVWA 2A73A 4FYQA 1NSNL 4A67A 4MA3B 1NMCB 4XTRD 1R17A 1F3JA 1S4IA 3RIFF 1D7FA 3IDNA 2JFCA 4OLZH 2PYFB 4M8QA 4RMUA 4UMSA 2GJPA 3WFHB 2P9RA 4P99A 2GC4C 2J71A 3PWJB 4DGWC 5I6MA 3G5ZA 3E38A 5HJBA 4PW3A 1KLFB 1TJGL 2WNKA 3X12A 3O8XD 1BVKA 1H3UA 2FJHA 4NQVA 3VXRA 1G7LB 1UJ3C 1ZV2A 3WHE1 3FTGB 4BHUI 3RWHA 3VXNB 2N01B 2WWKT 4E41B 1MW1A 2FEJA 3ZTNH 1JGUL 2XN9B 4NCC2 2EINB 1NCUA 4OKVA 1MOEA 3U46A 5JHDD 1WBZA 3TC9A 1ZWIB 3GSNL 1E28A 5AVXB 1AZUA 3F85A 2KLRA 5JHMA 3Q2WA 1TPXB 1XMEB 2RMNA 1A4CA 3CCHB 4LCIH 4M6ML 5FGSA 5C0GB 5TE7L 1JF1A 2YEVB 5I1IL 1BMZA 2VDOH 4HCRL 3CZSA 2MQCA 4OD2B 4M62H 1JFQH 3VXPA 3ABKB 2VXUL 3QNYA 2CD0A 5I2IA 2VKXA 5T3XD 2ZCKH 1MCKA 1S9XA 2KZBA 1KB9J 3ZRSA 4JPIB 3WEXA 3FU6A 1U8CB 3AB0C 3NFSL 3BXNA 1ZGLM 5SV3A 3U7AA 3EOTL 4ZMNA 1ET5A 4M7ZC 3T0XA 1UH2A 3FQ4A 2CO4A 4HIJB 4XGZB 1CTNA 1WFOA 1ZXQA 2D8KA 4UQ2B 4W9DC 4XC3H 5DUML 5C0CD 1NMCC 1BXAA 3NSDA 2Y06H 1J10A 3MNVA 2ZWYA 4KK6D 3ULUE 1QVOA 1SJVA 3FO1A 5DHMC 2ZCLH 5FW6A 2CHNA 4AENB 2WXIA 4D94A 5AYUH 3ET9F 4AEHH 2W60A 5FW8A 3RZCB 1T7WA 3E2HB 2BXYA 3CLEL 4NZTH 4DUVA 4F9LA 4HF5L 4FZEH 2AJ3A 3P3TA 4KH2A 5I19L 3LYRA 2VC2L 3Q0HA 3WXVL 1NM9A 5FO9B 5KW9H 4U1NB 4ZX4A 1DO5A 1BGXH 3DIDA 1BW8A 2GAZA 2JK5B 2V3FA 4QHNB 2C4FT 3ZTCC 4Z3EA 1CGXA 1A2YA 2XQYK 4FXKB 1LEKA 2VAJA 1FGNL 2LU4A 4X80L 4GUPA 4C83A 4P8QA 3I6GB 3IN2A 2NY7H 4Y2DA 4LGSB 2FWOA 3EHBD 2XWDA 2KT6A 4UTCA 2H45A 3QSKB 3LKNA 2F7IA 4WWKA 1QSEA 1ZT4B 3LHAA 3S96B 3U0TB 4LF3A 4L5FE 2F8XC 3VNZA 3TBVB 3E8VA 3QQDA 3BHBB 4GAAA 3D2UB 1NBZB 4L3CA 4G70B 5KSBB 3D8MA 2PR4L 2HVJA 5JW4M 4OQTH 4YO0A 3QULB 5GRYA 3MCLH 1SJHB 2QQNH 2OMXA 3UPAA 4ZX5A 1IGML 3RPIA 2ADIA 2N0KA 5JNYA 4XXDB 4QYOB 1IZKA 3QIWD 2R0KH 3L6FA 4WFED 4KZDH 4C4KO 3T65A 4LMQI 1EMTH 4NWTL 5HI3C 3KPRE 4BZ1A 5C09B 3VXMA 1UFUA 1T1XB 3L5HA 4RFOL 1CN4A 2HKFH 5E1IA 2YD4A 3E2HC 2YAMA 5DSCB 1OAXL 4IBVA 4JL1A 4Z7AA 1HSAB 1UZ6F 2B59A 4NIYE 4X8JA 5IB2A 4DN4H 3VRJA 2Y5QA 3B2XA 3IAGC 3SBQA 1E6JL 2YXMA 5A6IA 1BVNP 2OX5B 3N85L 4MAYA 5I5JA 3R0NA 4JE4B 1R34A 3KW8A 5D6DC 4XCCL 3K6SA 4N0UE 2N4IA 2WCSA 3ZDYE 2EIMB 2ICWI 5FIEA 4M1CC 3OKYA 3GSWB 2DW5A 2E27H 1S7SB 2YEZA 3OMIB 4O2EB 4PJ7A 3V6ZB 2X4TA 4PAZA 5I30H 3WUWB 1IBYA 2F74B 3SGEI 2CSPA 3F65A 3B8YA 4GRLC 1QEXA 3H3PH 3SDXA 4HZ1A 1XGRB 4TVUA 5IJVA 4X4MA 1COBA 2I85A 3L4TA 1UJ3A 2GCYA 3CFKA 5JMOC 1BF8A 4AYEC 4NS0A 1MVYA 2NY2D 5AOZA 3NACH 5F96L 1QNIA 4ONGH 5GS0C 5CP7B 2A9MH 1H6UA 4MD5B 4PP1D 4D9LL 1JZDC 3PNWA 4R84A 4Y5YB 2ZT9C 3HN8A 4LLVA 3W5MA 1U4EA 1KCRL 3SO5A 2M8XA 2RD0A 1G4RA 3RUGB 4DTGL 4P5KB 2ZP0T 3DWTA 4IQHA 5T1LB 3TTSA 3OD3A 1H15A 3VTMA 4NYLA 2JKSA 3LXUX 3MJ7A 2OBGA 2QLYA 1AXSA 3CC1A 3P73B 4YWGL 1DCLA 4WSGA 1MI5A 2R59A 3WTTA 1E50A 1SYSB 1JNNL 4TVPL 1UXWB 4OZIE 1NAKL 4PRIB 1MFBL 5EA0H 1S7WA 3RL2A 3PABA 2H0FA 1YNKL 1TENA 4FHBD 2NY3B 1F0LA 2ENYA 3HMXA 3CJJA 4JNXA 3PRZA 3A4FA 5JHDE 4LLDB 3P3SA 3VB9A 4JN1L 3B7RL 4FTDA 4YDKH 4F2MB 1MFAL 1FH5L 3OGCA 1RU9H 1ZHLB 3RL1B 2QFPA 2H0EA 3LS5L 4YDMA 1AZRA 4G3YH 5FGRA 2JQAA 3RGVD 4XPFH 1AQHA 3ARSA 5IBLC 1YPZB 1SXNA 2FB4L 5IMMB 2IH1B 4LHQB 1Q9OA 2R8SH 1NBVL 1G7LA 2RCSL 3QFJE 3SQOH 5KVFH 4J2XA 4OGAC 4IJ3C 1MCOL 4WUKL 3PWNB 1MHHA 3P4OB 3ESNA 3UAJC 2RFXA 5KBNC 1QX1A 1KJVB 3C6LD 4B50A 1S7UB 4Y5YC 3EJPA 2HT3C 1ZWIA 5ISZD 5C0CE 2G3MA 3G6AB 4G6AC 1RQ5A 5I71B 4K5MA 2JJTC 1CDCA 5C0GA 4G8EB 1EDQA 2DEYX 4RDQF 4R8WH 4Z3GA 1QR1A 3BKCH 4OD2A 1ZRUA 2OULB 2V8LA 1K8DA 3E1F1 3UO1L 3KBHE 1YZZA 5BVPL 2NCEA 5HDWA 5E8EB 1YEFH 4OCLC 3ULVD 4YBLC 3BEWA 1BFOA 2V7NB 4TVSa 4A68A 1MCJA 1FRGL 5CJQH 4XGZA 3ARPA 2VABB 4XAKD 2EDHA 5BOPA 1HHKA 1YN6A 1UWGL 4EOWH 5EHFA 4PJXB 1U3NA 3K2KA 4TSAH 3U48A 4K55A 5I82A 4WAFA 5L8JB 2R69H 3NP4A 2QVFB 1SHSA 5GJTH 2J8UB 1N7MH 2BS9A 3T2NL 4JFSA 1KB5L 3IK2A 5DQDH 3ZY7A 2AMGA 4ZNEA 2CHDA 4ODBD 1MY7A 4GO9A 1T7YA 5ECJE 3RU8L 2CR6A 4U1NA 1O6VA 1DQDL 1XMWA 1E27B 1LD9B 3MV8A 5AUMB 1JHLH 1HAWA 4Z3TA 2C9PA 1Y7VA 4LEEA 1WHPA 1DUYA 3QZNA 5D6DA 3V0EA 4D0CA 4I4WB 1K9TA 3LIUA 1CICB 5KSAC 5GZNC 1FSKC 1I3UA 3C6EA 3P11H 1JBJA 1SLUA 1UZGA 1S9KC 3GS0A 1CDIA 3EW3B 5I71C 4OSUL 4XVSL 1GC1H 2WWMD 1C7TA 1PJ9A 4W9FC 4NN5B 4D3CH 1AR1B 5ADOH 1ZT4A 5TQ2L 3S96A 1NIAA 3U0TA 3VO0A 2CJSA 4GRLA 3APMA 3HE7D 3I85A 3IGFA 4W6WB 3WAKA 5DO2D 4AGOA 3TBVA 4AUYA 4Z7WE 1RUML 3D2UA 1NBZA 3FU7B 5F7FA 1B6DA 2ADYA 4I1PA 1YCSA 4R97B 3GTNA 2WZ6A 1W72B 1QOKA 5CIPH 4WHDA 3IDIB 1I3RB 1OAUH 1WBYB 2ESVD 2NNAB 3CN2A 3NJLA 3WEOA 4ALAH 5ACZB 2AQ2A 4N25A 1WBXA 1X5IA 1QPPA 4IU2A 1IC5H 5LCVL 4BCZA 2OK0H 2GBUA 1DJXA 3KM2A 4FNRA 5ERWB 5C0BA 4QYOA 4IRZH 5LGHL 2X4RB 4KRPB 4OI7A 5C09A 3HUJE 1LO4H 6FABL 2N7BA 2V5MA 1MIMH 5DSCA 4OGYL 5F8QC 3O2VH 4DVRH 4BUQA 5C86A 3PPSA 1CE1H 3BAIA 1MG3C 2F8VA 2ZAHA 4MA7H 3U4KA 4JK0D 4XNUL 4QR7A 4PGDB 1W8NA 2F61A 2IV9A 2PW2A 4J23A 4UOW1 1LEIB 4IRSD 5CSBA 2OX5A 3QDJD 3TNMB 4GQRA 5C0AA 4DP1X 5J3HD 3FPYA 4PJ9D 4WY7H 1QI4A 4C47A 2QZ5A 5E8PB 2MQ3A 3HLAA 3VXUA 1SXBA 2APFA 5D93B 2DZEA 2QPFA 1OTTC 2AANA 1W6WA 3GO1L 1MN4A 1S7SA 4O2EA 3V6ZA 5BUAA 3G5YB 3RDTC 4K2UL 3UPRA 4KQ3L 2F74A 2NQ3A 5DHVB 2X6AA 3GI9H 3RKPA 3DX1A 3DVGB 1BECA 4N2DA 4H88L 2CAKA 1XGRA 3FCTA 4PMEA 4UT7H 1Y0LB 1NBQA 1GRWA 2ATPB 3CIQA 4R97C 1S5IH 5AVZB 5TJWK 2I24N 1SY6A 4JJHA 5CCKH 1UCTA 2AQTA 2HWZL 4G11A 5B7EA 5FO7B 1VRSA 2G0LA 1MCWW 3UAJA 1KFAL 1J48A 3BMVA 4XNMB 1OAQL 5JIHA 4E5XG 4OIIH 2C7UB 4JANA 5CP7A 4CGUB 4JREB 1CT8B 1YMHB 3B7YA 4JY5H 4Y5YA 1F00I 1T03L 2A0LC 4PJEB 2W0FB 5EU6D 5CS7A 1DJZA 2CA4A 2J1XA 5IGXL 5EOTA 2DWXA 2JJTA 3RUGA 4WENB 1WDAA 4XX1E 1LWRA 3S37X 2DQUH 5I0DA 4AE1A 3VE0B 3PGFL 3IJ7A 2K6WA 2K78A 5E9DB 1DZBA 3LSOA 4ZW7A 4BFBD 1AQDB 1AGFB 3DVNB 4EE2A 5KVFE 1SYSA 3NCJL 1Z9SB 3E9TA 3EF4A 4PRIA 3UBXG 4FQCL 3RFZC 5IB4B 3QJXA 3QYNA 2IAAC 4EDWL 1N9PA 3TZVD 2VDRB 3LEVH 4EIGB 2PCPB 2OZNA 5AYQA 2OI9B 5ISZE 1MAML 2DQ6A 1YHPA 5D6CA 1E3FA 2UWEB 4APQD 3B2VL 3QCUL 5BS0B 1XGYH 1JZ2A 1XWVA 1LO0L 1IMHC 4FMKA 4PJDA 3RL1A 1S9WA 4H8WC 3PS6A 4QPEA 1M05A 1LP9A 4L1DA 3TONA 3ZYJA 2NTFB 4Z8FL 1TJHH 5IMMA 2F54B 5GS2H 2IH1A 1PEWA 1CVRA 1NBCA 5PCYA 3TYGL 4L9LB 3V0WL 1XGPA 1ZSDB 3ULVE 3I9IA 1F02I 3GKZA 3WIIL 1YEEL 2LLLA 2ZSVB 3P4OA 1A7OL 4ODHL 2IBGA 2HFTA 1OM9A 3PAUA 3HFMH 2CO7B 5FYJD 4TM9A 1S7UA 4JREC 4OFVA 2QDWA 5FYJH 5KSAA 3B7UX 1VFAA 3L3DB 4UT9A 4XAKE 2ZG1A 5GZNA 4P5RA 3BGMB 3BAJA 2OFQA 1I9IH 2YD9A 4XNYH 2NX5D 1KBVA 3VSVA 3GUTB 4TRPL 1KPRA 4Y4KC 4OZGF 2BNUB 1KV7A 2XG4B 2DM3A 4G8EA 1EVTC 4S1SH 1CLYL 4NZUH 5IVXF 3WFCH 3VSTA 3HG0A 5CR8A 2YR3A 1IAIL 1JFHA 4UQIM 2E74C 1KOAA 1UUSA 2J57A 1JZEA 3L7EB 4ZAKD 3IJSA 2X0WA 3IAPA 3PWPB 3TURA 4RCAA 4AIEA 1INDH 1FIEA 2GHZA 4XAWL 3O3AB 2IFFL 1RJCA 2OL3H 2YSTA 4MJ2A 1VZGA 4JO4L 4AK1A 3HE6C 3UPCA 3O0LA 2R29H 4AJVA 3HC3L 4XOBA 2NYZA 3MKGA 2Q8AL 2GSMB 4FKKA 5DURD 5ESAB 5HHNB 2YD6A 3G7TA 4QHKI 3WLBB 5F6HJ 1S7RB 1G6RA 4NP9A 2YXWA 3T0AA 4CADA 2VDLH 2DLFL 3ZL4L 4Y89A 4M4PA 5T3ZL 1IAOB 1N19A 4RAUB 4X6FB 3ZHLA 5J9PA 4NLHA 1IO4C 3GXTA 4ZFGH 4M93B 2FNWA 4HC1L 4EUPB 1E27A 2UY6A 1I7UA 3O3UN 4L3ED 1WZAA 2CXKA 2XWXA 4LEOB 3I02B 3BDBA 1MRDL 5DS1A 4E9VA 3RURA 4PJCB 4BXVA 2YXVA 3FUIA 2ADFH 4GH7B 3K6OA 2V37A 2WYZA 2Y7SA 3BP7B 4TLKA 1I9RL 1WE5A 1UH4A 2X7LA 4KITB 2WXMA 1PY0A 1YVLA 5LNEA 2DQMA 5EO0A 3RDTA 4X9BA 4F7EB 4XRCB 1SJXA 4LEXH 3UTSE 5A2JH 2BXZA 4GXFA 1Z5LA 2AAAA 1U8HB 4KK5D 1NEPA 5FHBH 5BZDA 5C9JB 3V9CA 2A74C 3KL3A 1MJUL 1XB8A 3BPNC 4CVXB 1LE5A 4O58L 1K72A 2D0HA 1K8IA 2B4CL 4XO3A 2NNAA 5DEGB 3QDJE 5ACZA 3O2DL 3QG7L 3FQTB 2VXQH 4UDUB 3TA3D 3KYMB 5HYSA 2AQRA 2WOBA 4LVOB 3CU1A 4HPYH 1EZUA 2VDMB 4ZFFB 4KVNL 5BO0D 1FG9C 1K5NB 3INUH 1CDUA 1AYRA 5CJ8A 3ETBJ 2B08A 2E3VA 4HEPG 5DMIH 4XCFH 4QY8A 3OVUB 1QI3A 1UCBL 2AK4D 3JXAA 4Z7VF 5MEND 3CVIH 3MRNB 3HC4L 5K1VA 3GSUB 1JWUB 1JUFA 1XGTB 2BSCA 2DLIA 1LEIA 3TA4D 4ZQKA 4U3CA 1XCTB 4H8HA 1URZA 3NZ8B 2NCMA 4ZMVA 4XXWC 3RFZA 5E8PA 3NSJA 1IKNC 1SBBA 2WSPA 3ARWA 1J8KA 1DBML 5B3JE 2MNUA 4XWGL 3M46A 1A6AB 1IGIL 4MAUL 4NI6A 2C3VB 4BFOA 1BYPA 1NMBL 4U6VH 4YXHH 2LVEA 3W11D 4JO2H 4WU7A 2CO2A 4M6OL 5DHVA 2TAAA 3GMOB 3HI5H 1AJ7H 3DVGA 5C0IB 1OK0A 4GXUM 5F1SA 4X9FA 4CDHA 3MRLA 5IBTH 3O4LB 1D9KD 2ZQKA 3F62A 4FCHA 1G7PB 3VQMA 1AGDB 1X5HA 5DRNA 1GYVA 4GAJL 4PRHA 3QG6A 3WL9A 3HI6H 4HIXL 4XNMA 4FG2A 1KUMA 1TZAA 2C7UA 4CC0A 5F1NB 1PLGL 2DBJA 1DBAH 2E0PA 2IANB 4I18B 1MRFL 2D0FA 2Y36H 1RIUH 4FKEA 4PJEA 2W0FA 4IKLA 4MZ3A 5GGSA 1MZZA 4FFZL 3MI6A 1JZ7A 4Y4KA 3UJTH 4F80A 3SPHA 2AQ1A 3KLLA 4JM4H 2BSBA 4K9EL 4E9XA 3US0A 3BWUF 1V55B 1GJIA 1YLBB 5B1KA 5D2LF 1WAAE 2H1PH 1Z3RA 3FCUB 4MQXD 1GTNA 5D5ME 3IPEA 1DSFL 1AGFA 1DVSA 4K3HA 4N3TA 1KCUH 1AAJA 2XQBH 1Z9SA 3EAKA 1AGEA 2WQSA 4YEFA 4A37A 4G83A 2CLVB 3SBPA 3K5SA 2XZAL 3HE6A 3NCBB 5FYJE 2IC2A 3U4EB 3HVNA 4BK8A 3P3RA 3WTYA 2EDEA 3GMMA 3BUBA 1NC4B 4QO1B 4X7SH 2NX5E 3CN4A 2V5YA 3KGSA 5I1HH 4KUCF 2H32B 5JXAH 4W68A 4P2RB 1XAKA 1RZJH 2V7HB 3ILPB 2UZXA 4PM1A 1Z0MA 1NANH 2NTFA 3GLAA 1UD5A 3QORD 1INEL 1OPGL 1M2VB 4HLZH 5KVDL 4ODSL 3X1NA 2BHUA 2FEDC 1JZFA 4X5XB 5GSRA 5IHUH 4X6DE 4YDIL 4HP5A 4LFHG 2WUBL 2CO7A 4ESKA 3FQRB 4ACTA 5CSZB 3MLRH 3EGXB 3VD5A 4I18C 1PZSA 1TETL 3G04A 4LCUA 3BGMA 3BPOC 1XVSA 2CDEA 1XH3A 2XG4A 4TN9A 2E9JA 3WE1A 3SDCD 1JRHH 1WISA 1RULL 3MBWA 4PJFB 4XMKH 1GGTA 4PB0H 2A6JB 1RSYA 1UM5L 2A74A 2APWA 5FR3A 5DMYA 4G82A 2QQLL 4PI0A 4TNWF 1IIIA 4V1DA 5LKNA 3K1DA 3NDYE 4L3EE 1WIOA 4ANWA 2JTYA 4K8RL 4LLMB 4ZSOB 2AJUH 5IEHB 5LG1A 2C34A 1W72L 5T5NF 1IKOP 4WFFD 4YDJA 3TH4T 5B38G 1CK0L 5ESAA 4XMLL 5HHNA 4KPHL 5A2AA 3PHOB 3IVKB 3FUMA 3MBEC 5H37H 2WY3B 4PLKD 4CN1A 1JJUA 2DKSA 2FUQA 5ECGA 2E6PA 3B3BA 2HLAA 5AZEL 4DP6X 4D9RD 1AIFB 2JB6A 4IBUA 1HN1A 1YJDL 3CN0A 4U6YB 4YMPA 2OLDA 4YEEA 5AZUA 1OT2A 2E8YA 3K3QA 4LLWB 1CGVA 3NABH 2UX7A 5EC2B 1OQXA 3CC5B 2MOGA 1NIEA 1EERB 1QACA 3GPSA 3KHQA 3MLSL 4W4OC 5TGBB 4LEOA 3BP5B 1G9MH 2FJSA 4F37K 3V0IA 1EGJA 1QQDA 4JW3A 4XXWA 4EPSA 1WZ1H 4PJCA 1VCAA 3MAWA 1IKNA 5ALCL 1OWRM 1N8ZA 2ZOLB 2NR6C 2PPCA 2WO2B 3BP7A 1PYWB 1Y6MR 1ZHKB 4F27A 5ID1A 4BA0A 3WKPA 3BVVA 4AIZB 4BIKA 4LLYB 1FH2A 1QTPA 5I1EH 3KLQA 4JRXD 3MX0B 3QEQA 2AK4E 3NCXA 4LOEA 4O9HL 3VRIB 3U0WL 3OAUL 5C9JA 3LNIA 4OQ1A 2XHNA 2Q7AA 4CVXA 2HXAA 3QPXH 1H8OA 3F58H 3QJFA 5JPMB 4LHUD 5JHAA 1S7TB 2FJGA 2HX8A 1RZ8B 3KYMA 3Q6GH 3L3OB 2FL5B 3IRZA 3INOA 3PG2A 5DC4B 4YXLH 3GEFA 1AZNA 4ZFFA 5K5YA 2XWBB 3BESR 4NNXB 2Y7QA 3U25A 1LILA 1TYJA 1EUTA 3D39D 1WWBX 4N0FA 1RK7A 1HU8A 3NZSA 3HRZC 4J3WA 4BQ9A 4NDMA 4PJGB 3FMGH 4TQPA 2ZAGA 4FFWD 1HNGA 2QLVB 4G2AA 4PJIF 4NFBA 3TWCL 4DCQB 3CXFA 4JDVA 2SODB 1JWUA 5F9JA 1JGLH 1HE8A 3C08H 1OM3L 5AAMC 5HGGS 2J88L 4XP4L 3VFWA 3ULSA 5DLLA 3V4PB 3NIFB 1ZLSL 1DBJL 3I75B 3WJMB 1NCWL 2VRQA 3BEVA 4ICXA 4UI2A 3OM3B 1NOLA 4NPYB 5AVTB 4HMDA 2AXGB 4G8GB 4WWID 1EXUB 2K4WA 2PCFA 2W94A 1RK1B 2VDRL 4NZJA 4OIAA 3U30B 1UWEH 4E0RB 1PKQB 2X9ZA 4QHMB 3IJYB 5HYFA 1WK0A 5IFHL 4PGBB 3UEQA 1Q0XH 4UIMA 4R4BB 5JW3L 4AMWA 2IOIA 5D4JA 1DQTA 1SQ2N 1ZJBA 2J6WA 3AS3A 3K0WA 2H1LM 3ZO9A 3O6FB 3LPFA 4IOSA 3QXVA 1R75A 2R2BB 2R0ZH 2L7QA 1A7RL 4YDNA 4P4KB 5CKGA 2X4PB 3P9LA 4FXGB 4F8OA 4KKBD 4NZFA 4FD0A 4NQED 5JMRA 4DPRA 5EC1B 3G5XB 5I18L 1I4FB 2COQA 5EPMB 5F3HA 5EZLA 3QDMA 3GZOA 1NAMB 5JQ6H 1ZKAA 7FABL 2IANA 4I18A 5SWZB 4KZEL 1PAZA 4GIOA 1FPTL 4B9JA 5BV7C 3MODL 1MCPH 1J0ZA 2VO5A 3M8OH 4JM2C 3KZ8A 1BBDL 4HWBL 4DP9X 2B0SL 4AXWA 1T22B 4WNSA 4UT6H 3ZRCC 4EKXA 5GPRA 1K85A 2NXZD 1CS6A 4YGVB 3GDCA 5DCCA 3O6MH 4OZHE 1ZV9A 2D31A 2YUXA 5CBEB 3OL2A 1P6FA 3RWCA 3SD5A 3V4VH 3HKFA 3SYOA 3ZDZE 1P69B 3CVHB 4L4TD 4AVKA 2KUTA 1MREL 4N28A 3Q06A 2VDKB 1EFXD 4POZC 4Y1AD 4BFEA 1KELL 2OMTA 4OLEA 3KCPB 3T2OA 3VI4B 3HJ0A 2WQRA 3ZHNA 3U4EA 1QLFB 4AM0A 5I8OL 3GHEH 5FFOA 3W0WB 3QUKB 4QO1A 2A9DA 5L9DH 1MIEL 5GGQH 1F8TH 2HTLC 2Q2LA 3MBEA 4OAWA 4I77L 2UZIL 2V7HA 3KYAA 4MCZA 3CHSA 4R6UA 3MLZH 4P0DA 4AG4L 4G9FB 2YQBA 5LAPA 2CGRL 4MDRA 1PZAA 1XB3A 25C8H 4RIRB 2IQAA 4P4KC 4FXGC 5DUJA 1KCVL 2C8NA 3HPJB 4Q2ZB 2MCPL 1G9NL 2WWOA 4WI7A 3PE9A 4W4OA 4OLVH 1VJSA 1OIOA 1RZ7L 2NNRA 4JPKL 4N2OA 1S9VB 1RUQH 4WFFE 2NR6A 2V2XB 4UV7H 4XVOA 4M3KB 4AK2A 5FECB 3CX5J 1N0LA 3TYFA 1ZXKA 3WBDA 1BAFH 1INQA 4ZYKB 4CMMA 4ETYA 3KG5A 4K94H 2ERJB 4LSRL 4GW5A 5CEZL 2QMJA 3D08A 3IGAB 1KTDB 3GYRA 2RQEA 3QS2A 1BZDA 4K15A 3IJEB 5EBMB 5H94A 5J06A 4KKLD 2AQNA 3QQ9C 4P23B 1PMYA 1SXZA 1FVEA 3GRBA 2N1TE 2EDFA 2EDDA 4FE9A 1AGBA 4NIKB 4OLUH 3T0BA 1RAMA 4LLMA 2EZ0C 3BIKB 4ZSOA 5IEHA 2VCOA 2WTOA 2KC0A 3EH1A 4AL8C 4AE0A 5JA9A 4OI8A 2VL5B 3DIFB 3LN5B 1DUZA 3CBRA 2JE8A 3PHOA 5ITFB 5K59E 2J21A 3L7FB 4BQ8A 6PAZA 3WSQL 2FGWH 1UATA 4AQZA 2XV2A 1XT5A 3QFGA 4YSCA 4JRXE 3HRZA 3GIVB 4QGTA 4U6YA 4O02L 5DMGC 5J5EA 2VLMD 1C5CL 2C3WA 2QR0B 2VSKB 4L37B 1OCOB 1P5VB 4YHOH 5GGRA 2NDFA 3FTUA 5AAMA 3LCYA 5TGBA 3QAZC 3BP5A 3KPSB 4UAHA 3QQ4B 1UACH 1ZVHA 2J5WA 1Q9KB 2R56L 1KFGA 3I9AA 1KTJA 2XWTB 1W0WB 4JUSA 4YGAB 1HDMB 2OZ4A 1PYWA 1MAKA 1XD1A 1ZY9A 2YC1B 2ATKB 3DI2B 1MLBB 4G9DA 2XFXB 2DQJL 5D1QB 3NVQA 4NQXB 1V7ML 1W16A 3KLHD 4X6CA 1GVIA 3BKML 4C4BA 3OTTA 4KNUA 5DZVA 2AJZA 4H8PA 3MJ9A 2D2CC 3V9EA 4N2AA 4WU5B 1XTMA 3GBNH 1IBBA 3GHBL 4LSTH 4EZMA 5ETUB 5L2KD 1T5WB 1F4YH 4DEPB 1QYGH 3M88A 4E68A 1EK3A 1M1XB 1IC0A 1RZGB 2VLJA 1Z9MA 5TDPA 2FX9H 1JVOA 2FL5A 1S7VA 3DHJA 4X9HA 1WFMA 1X3DA 4U7SA 2XWBA 4JM2A 4V2CB 4YH6A 4NNXA 2A99A 1G0YR 2ZCZA 4YBQD 1B4JL 1NLDL 1UT2A 3FU8A 1GZPA 4QRSA 1TT6A 1U91B 2I07B 4WEEA 3TFKC 3L95A 3PGDA 4UM8B 3SE3C 2BZCA 5C0EB 4PJGA 4Y1SA 2FYVA 5CFHA 4HA1A 1E5CA 3D25B 3EFDH 4HKXB 2GJZB 3BVTA 1KY6A 3FTYA 2ZJSH 2XZCL 4MX7B 1IKFH 1NINA 4NQEE 4FYSA 4PBXA 4X7CC 2F1EA 3VNYA 3WJMA 2I60H 4C56D 4DGIL 5KYWA 2G5BA 2NY5H 4PHZA 1R24B 3D48R 4Z7UF 4PJBF 2R0WH 2VXSH 4G8GA 4XODA 4KX8A 3WTXA 3SPJA 1QHOA 2IAMD 1PKQA 4QHMA 3C5ZD 3IJYA 1MCRA 5D1QC 5L4JA 3TESA 2Z8SA 5FEBA 1OZTG 1OSPH 2O6EA 5SX5K 3FUKA 1NMAH 3S48A 1LK3H 1FGVL 1J0YA 4FLQA 4H0GA 4LCCB 1YDPB 4D9QD 1A1NA 2R2BA 5SWSD 5I8KH 1MEXL 3ZKMC 4AMKL 3DGGB 4P4KA 1TLKA 3HBGA 4FXGA 4JFXA 3FQNB 4DEPC 1JGDA 4L4TE 4PJ5A 2GG1A 4F7MB 5KG9A 5EC1A 4Y1AE 1I4FA 5EPMA 4HWNA 5CJOL 1NAMA 3OAWA 2FT7A 5JW4N 4XMVA 1AS8A 5SWZA 3UTTA 4WIQA 2EC9U 4X9YA 2HKHH 3NJVA 1KMGA 3SQBB 1MFUA 3VFOB 3RA7L 1M42A 4PRPB 5C7ZA 1HVXA 3MCKA 2EQDA 3KEDA 4LRIC 3Q2LA 3WEAA 3MU3A 5GXBB 3L4ZA 2WVUA 1I31A 1UQSB 1ZEAH 2ZXGA 3FUEA