5EEYA

Radiation damage to the trap-rna complex: dose (dwd) 11.6 mgy
Total Genus 11
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
11
sequence length
69
structure length
69
Chain Sequence
NSDFVVIKALEDGVNVIGLTRGADTRFHHSEKLDKGEVLIAQFTEHTSAIKVRGKAYIQTRHGVIESEG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Rna binding protein
molecule keywords Transcription attenuation protein MtrB
publication title RNA protects a nucleoprotein complex against radiation damage.
pubmed doi rcsb
source organism Geobacillus stearothermophilus
total genus 11
structure length 69
sequence length 69
chains with identical sequence B, C, D, E, F, G, H, I, J, K, L, M, N, O, P, Q, R, S, T, U, V
ec nomenclature
pdb deposition date 2015-10-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02081 TrpBP Tryptophan RNA-binding attenuator protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.50 Mainly Beta Sandwich Immunoglobulin-like TRAP-like 5eeyA00
5EEVA 3ZTEA 2ZCZA 2ZD0A 1WAPA 3ZZQA 1UTDA 2ZP9A 5EEXA 5EF2A 3ZZSA 1QAWA 2ZP8A 3ZZLA 1GTNA 5EF1A 4B27A 5EF0A 2EXTA 5EEUA 3AQDA 1C9SA 5EEWA 1GTFA 5EEYA 2EXSA 5EEZA 5EF3A
chains in the Genus database with same CATH superfamily
5D70L 2A0LC 2N3JA 3N3EA 4KO6A 3OJVC 4ESKA 3MV11 3RWGB 2Q9OA 4KV5F 1MNUH 1NL0L 5CJXC 5HJ3B 3WAKA 4C4UA 4YHMH 4N0YL 1ZEAH 1AQ8A 5B21A 4LKCA 4DVRH 2G75B 3A6BL 3BUDA 5ISZB 2XUWA 4GLRH 5JXED 4HWEH 2D0HA 1QEWB 2ZSWB 1K5WA 4DP0X 3SDAC 4OW6A 4DOHE 4KUZH 4A68A 4URTB 2CHXA 4QGTA 3HZKA 4DFHA 2HB0A 4ZAKA 2FT7A 3MJGX 2WB7A 1FJ1A 3GLZA 4CGUB 2BVQB 4PJGE 4PHXA 3PABA 4HX1A 3O2DL 2ZXCA 4A55A 2B14A 2NR6C 1XSKA 4AKPA 2GJZA 5C3TA 5B38B 2XOTA 2QPEB 3BWSA 2WIIA 1KYOK 5ID0A 5JIDA 4ZAKB 2YD4A 3EUUA 4KTYA 2K7PA 2VO8A 4U6VH 4XMKL 3KWXA 4ZG1A 1IM9A 2VXQH 3PABB 4HX1B 2WB1A 4MDIA 4X8CA 5C07D 1Z32X 4HPYH 3D2UB 1JXFA 2XQYA 1IGJB 1WWWX 4OF8A 4OBSA 2A6IA 4FQQA 1U58A 3DVFA 1KEGH 35C8H 3LPOA 3JT2A 4MDIB 4YIQA 3C60C 3WNOA 4MZIA 1NM9A 4LSPL 3T2QA 1HHHA 2BNQA 3CN3A 5E24E 3O8XC 4PWFA 2JFCA 1AC0A 4ONGL 3CG8A 3H2WA 4PCTA 3VDAA 3VRJA 3N1QC 4FLRA 1CICA 1QSFE 1P4BH 2XG5A 4GKZA 1EFXD 5I2IB 3FN0L 1IAII 3LD8C 3V4UH 3VU2A 2BNQB 2EIBA 3CZLA 4R96A 5DUMH 3ARGA 5E08H 2RAMA 2X6CA 1AOHA 3I6LD 3RJDA 3VRJB 3EIFA 2HYMA 2XXCB 3FUMA 4I0CC 5I26A 3FCSA 3HBPA 2PW1A 3IFOA 3U7WL 4GUCA 1QRKA 2Y7QA 3HBZA 4PB9L 4WUUA 2QMKA 4HS3A 5DO8A 2Y7OA 4HGWB 4R96B 1GGBL 1HIML 4YSEA 3ARGB 1B4JH 1CTMA 1E4WL 1T83A 4MZRA 4ZXBD 3DHUA 2FCBA 3IE9A 5KVFE 2QVIA 4OFYD 5KVFL 1GVIA 2CG9X 4JFHE 1C5BL 4HHAA 4JDTH 3U46A 3ZYJA 3OKOA 1C12A 2Y7QB 3P9WB 4QDGA 1PDKA 4HCIA 2OMUA 2OQJA 2GTZA 5FA3A 4FZ8H 3CFKA 3BIKB 5EPMB 1AD0A 1J10A 1C16A 5D4JA 2EDDA 2QHLA 3MRPA 4M6NH 1C12B 4ANVA 1PDKB 2JKJA 2P7TB 3S36X 2ZUTA 4MNQA 3T0EB 3AMKA 3GBMH 3E8UL 2OQJB 3QS2A 3C6SA 3U6RA 4TLUA 1E4XL 4U0QB 1AYOA 3VG9C 2VLRA 4S10A 3MRPB 1O0VA 4ABUA 5LGJB 4DGUA 4J28A 1KBGL 5GJTH 4RAUA 2QKIB 4FTDA 4MNQB 5TK4A 3C6SB 5J13B 4G7SB 1N0XL 2O5ZH 1FZMA 2JTYA 2ZUYA 3MLWH 3GJEB 2BOBA 2VLRB 1D2PA 3ZDZB 3C9NA 1E2WA 3HG1B 5ESQB 4NCC2 1DCEA 1SDDA 1I53A 2FTAA 5CP3A 5D7HA 5ISZD 1S9XA 3OGCB 1J0YA 2YMXL 3P3TA 4W93A 5E03A 3TIDA 1O7DE 2QPFA 2MCG1 1MSPA 3F6IA 1OCCB 4HUWB 2CO3A 4H13C 2VITA 4NT6A 5DXWA 5INCA 3UGUA 1PMYA 2WYHA 3MJ8A 2OTPA 4IBVA 5C2UB 2FWLB 2F68X 4YVNA 1SDDB 3BCDA 4EN2A 3F12A 4OF6A 3RNKA 3MXVH 4Z7OB 3S3DB 3MUY1 1GGYA 4OB5H 3TIDB 2JCWA 5E6IB 1R6VA 4CBZA 1AKJA 2VITB 5INCB 4BQCA 1NMCC 3ZGHA 1MELA 1SUJA 3AAZB 1JPST 3PV6B 4BIKA 4ZAKD 5IVXE 2XQYG 1O5DT 3F12B 2B1HL 4KK6D 1QFWI 2EYTA 3BESR 5FYKU 4A7QA 2ADYA 3TC9A 1SN0A 4PRNA 1UC6A 5JW3H 2R0ZL 1J5OH 1AKJB 3BEVA 5EC2B 1B3IA 3I50H 3LKOB 2XYCA 1E6OL 3FU7B 3N1PC 1L3NA 1YEGH 3FUIA 3MLVH 3NIGF 2XN2A 2ARJB 4Z7UA 1IM9D 3FZUC 4WSKA 4PRNB 2JCCB 2ZPKH 1RJLA 4TVPE 5J7CC 4TVPL 4PGZA 4NM4L 5FYLH 2ZSVA 4HJ0D 2IDSA 4NI6A 3OB0H 2QQNL 5MP6H 2ERJC 3IB4A 2CRMA 2JI3A 4GKNB 4WW2B 2ZWZA 1S78C 4W6WB 4LCWB 5AKVA 3GUTA 4FFWC 4IKIA 5AOIA 4Z3GA 1JZDC 3GTVA 5GS0H 3L1OH 3GYRA 1IMHC 2BP5M 1EBAA 1KIRA 3IAGC 2ZSVB 1FVDB 4FJYA 4JFSA 4D9QE 5E23A 2BNQD 4YSPA 5KUMA 4OZIA 3RY5A 4XC3H 5JPMA 3WXVH 2HXAA 3O6ML 3U25A 5J9PA 1HWHB 1MKFA 3P2DA 3QW9A 4WEMB 4GG6A 1E30A 15C8L 3BHBA 5TQ0L 1KIRB 3V0DA 1VERA 4OT1L 1WITA 1Q9KA 2E46A 3ARGD 2BZ7A 3GDCA 2J8HA 4IHOB 1J05B 4ANKA 3CZJA 3RY6C 3QRLA 5J9PB 1JPFB 2HKFH 1FP5A 1RQ5A 1J0ZA 5IK3A 2JVUA 3BHBB 3RFRA 2CPUA 5EOQL 3ROLB 4WUUD 5T3XH 4F2ME 1P7HL 4Z8FH 4A2LA 1Q9KB 3DUSA 3HHMA 4QTIL 4I9WE 1HEZA 1TKWA 4KKBC 3IRCA 1KLFA 4TQEH 2VWEC 2ROYA 2YD1A 4XWOD 3AXIA 1K5NA 5BVPH 3GEWB 3T0ED 4ZFFA 3GSRB 2WQAA 2WCGA 2N01B 1CXLA 1HEZB 1SOSA 4J27A 3D85A 1CJYA 1U9KA 4QMEA 1G9EA 3WNNA 2DWEA 5D7SL 4DQAA 2O6PA 4TNGA 2YEQA 5LNGA 3BDYL 1SQMA 4MNQD 4EI6B 1QSEA 2FX9H 3STZB 1A9VA 1IKOP 1CLYL 5IVXF 1F86A 1EQWA 1PZAA 2AJUH 4J12A 4Y5XA 5C97A 3DWTA 4FULA 3BKCH 2VLRD 4IIZA 4WWPA 1G1CA 2XWDA 2YD2A 1EJ8A 1QNZL 2OCFD 3HG1D 2P9RA 1YN6A 4AYSA 4OGZA 3ZO0A 1S5HA 3ZKXB 5IUSA 3IGLA 1XO8A 2EDLA 4M56A 5E4EC 3FO0H 4PS4L 3IETA 3ABZA 2VL4A 1G7IA 4Z7IA 2FUQA 3SJVA 4W9GC 5TDNB 1NCTA 2A1WH 4PJDE 4GKSB 2NSXA 2ZOUA 1O6SA 1P4IL 3ABMB 3HAEH 5C8JB 5J1SC 2XY2A 3CVHH 3L7EB 1S5HB 5ITFB 4JFEB 2IWGA 1CFQB 4FHBD 3VI3F 2YN5A 3DX0A 1J12A 2TAAA 1BIIA 2A9AA 3IETB 3LH9A 4H7VA 5E6ID 4AM0A 5F72S 5AVQB 3VFRB 4H88H 3SJVB 2ZXWB 2XA8H 3JWOH 1NMBH 3UO1L 4JG9A 4ZMYA 3I9PA 3MRHB 3W39A 1KFAL 3SE3A 4AMKL 3IU4H 5H35B 3FMGL 1I1RA 3LZPA 3RUGA 1DQML 3QR0A 4AM0B 3KBHE 1JYXA 5CZRA 1JNHA 1AKJD 3UTZA 4WENB 2HTLD 3O6FC 4AYID 2FLBT 4PPTA 3II3A 5FIEA 3K8MA 2A5UA 3RUGB 3T4AB 5ADOH 4YC2B 2YPLE 3GRGA 1JNHB 5KOVC 1IVLA 1RJYB 2J5LC 2PUQT 2VLKB 3JV6A 3ZMRA 4PVBA 1LE5A 4CDGC 4JB9H 1IAOA 4P2QA 4AMWA 3MCG1 3VD3A 5I71C 4Z3TA 5K1VA 5TQ2L 1FF5A 2PCFA 1ZLWH 4P3DB 2Z7YA 3E3QC 3JV6B 4M00A 1P5VA 2DW5A 1FG2A 5LBGA 1VGKA 1YUKB 2O5XH 5HDOA 3VXTA 1ZHLA 4P2QB 4RISH 5F6HJ 5G4OA 5I0ZA 2JELH 1EPFA 4JM2B 2WMPA 1YEKH 2WHVA 1OF0A 4J3WA 5CCJA 1IKNA 1TT6A 1P5VB 3IBEA 4ZYKB 2R1WB 1H5BA 3ECBB 5IR1B 1FG2B 3PIQA 3LIUA 3IMWA 2CLRA 2X10A 2XY1A 2O4EA 5FLVA 3K7UA 4QRAA 4S1DD 1FL3B 2Z7ZA 4YHIB 4WGWB 3QEHB 4JNXA 1SY6L 3PIQB 4PGCB 1S7QA 1ZXQA 4N90E 5ELIA 1WPCA 3IMTA 4MQTB 4I18C 1KACB 2FLMA 2X88A 4X4ME 1HL4A 4K8RC 4N8VB 4L0YA 3ULUC 1NFDB 1IL1A 1TETL 3DARA 4GEIA 4JFQA 5IQ7L 4N2DA 5E2WH 3SDXE 3S9DB 3TBSA 4KUCF 3FFDB 1JGLH 2CE6A 2YEVB 3JV0A 3MGTA 1QTYT 5DO2D 3WJJC 1Z9OA 3THMH 5GGTH 2I25N 2CUHA 4LOFA 4XWGL 1L7TL 2P26A 2R1YB 1CPUA 1E6JH 2WXPA 2YGPA 2YFOA 4LEOA 1RUPL 3TBSB 4JJHA 2X1OA 1EXGA 2CBOA 1CFSA 3ZSSA 5T1MA 3RY4A 1W8EA 2AITA 4OGYL 1YNTF 5F96H 3LZRA 2BVEA 2YUVA 1G9ML 1K3IA 2CCWA 4ZFZB 6PCYA 3N43F 4LCUA 1UTDA 5D2LE 3X3FL 3ZDYB 3TO4B 3A4EA 4KROC 1F13A 2BP8A 4QJ3B 4DP9X 3X12A 2F5AL 1IEHA 4NNXB 5T1MB 3VWJB 3MFGB 3GEFA 1SPDA 2P80A 3MRJA 3JWNH 2R4SL 2P5EB 1PG7H 1IFRA 4J3XA 2PTTA 4KJQD 4X5XA 1S46A 2VSCA 4DO6A 2XKNB 4O00A 4XT1C 1F18A 3X12B 5I1LA 5KSBF 1BFTA 1BJ1J 2CNZA 4H1LH 3SJVD 3MRJB 4AYMC 1FAIH 2AKRA 2FJGA 2WVSA 4QHPA 4PTUB 1NIBA 4FQ1H 4XE0A 4CAGA 2PTTB 4G72B 1GZHC 2CR0A 5DC0A 4X42A 2OK0H 1FUNA 3K3QA 1P9MA 1WTGT 4WW1B 5E8NB 3CXDH 1M2VB 2NX5E 4HKXB 4HH9A 3AS2A 8FABB 5L0QC 2FDBP 1MH5A 1Z2KA 2EIZB 3OF6A 4GXFA 5K9QG 3EJJX 4LVOB 3VO0A 2FNBA 4MA7L 2FB4L 1MHPL 5B8CC 4CGTA 2CPCA 1DDTA 4AGLA 4C4KO 4GSDL 5F97E 3LS4L 1KGCE 3LN9A 1GY1A 1ZS2A 5K1NA 2VLKD 3DPBB 2F8VA 4MCYA 4OM0L 4GAJL 1X3DA 3KPQA 4DNLA 1DQJB 2ZE0A 3SE6A 4PV8A 2EDKA 3MBWB 3HAEB 5KYXA 5LBSH 5SWZE 4BZ1A 3Q8CA 3EOBA 3O3AB 5B1CA 3IVKB 4MCYB 3S98A 4P05A 4OFVA 3N50A 5FA4B 1WZMA 4P2QD 4R5TA 4FD0A 2G0KA 2ZG1A 4JM2D 4PV8B 1WCBA 3L1GA 3SDXF 3EGDA 5D7KD 5KYXB 3N91A 4GNKB 5F3HA 3EOBB 4N87A 4DKDC 2KS0A 3NIFF 1IAIM 5FB8A 5C0RH 1RJCA 2NY2B 2IDCA 4Y2OA 3R8BB 1U4EA 3WNLA 3GZOA 3HE7A 2OR7A 5JHLA 1UUSA 3QEGL 3EGDB 5B7EA 2UWEA 4FXGA 1MXDA 4WDIB 3Q2LA 5L4IA 1ADQL 2E9GA 4HP5A 3QO1A 4A7UA 2JQAA 5FYLD 3HE7B 1KIPA 3UGXA 9PCYA 1UCTA 2X4UB 1QOKA 2UWEB 4YH6A 4FXGB 5CWSB 3HE6B 4YX2L 4ELME 3RIFF 3CDCA 4CW1A 3QO1B 2EJ1A 3HFMH 5DZ9A 4WI2A 4EPSA 3QIBB 5B3JE 5DD1H 4H0IA 2DMCA 3UJJL 1KZQA 1LGVA 1WVZA 3B2PA 2HP4A 3B7TA 3ZE1F 2Z93A 5AB2A 5HGGS 4L8SB 3QUML 3QO0B 1KB9J 3QXUA 4DPRA 4MKTA 1R3JA 1M2OA 2UZIH 4KVNL 1MZYA 3TJPA 1NC2A 3O4OC 3O0LA 2YD3A 3NJNA 3OZ9H 3N1MC 5A2AA 4ONOA 3IN2A 4K23L 3DIVA 4G5AA 4DESA 4K71C 1RUQH 2DQJH 3TO4D 3ZL1A 3LB6C 1T5KA 2Q8BH 5HYQA 1PW3A 2YSSA 4GXUN 3VWJD 2AQRA 3N41B 5E8OA 3HB3C 5C70A 4GINA 2VAJA 4NJ9H 4X9IA 1C5CH 4AQEB 2V2TA 1DSFH 2W5PA 3GMPA 4QJ5B 3RIFK 5A6LA 1NUFA 1DQLH 3GPSA 4HJJL 1T1XA 2QADB 4DP2X 3HZVB 1RZIA 5FLUA 4H4NA 4X4YA 2K0RA 1PX3A 1ZHBB 4HWZA 3UZEC 3L2LA 3GMPB 4PRDA 3BZFA 1SQ2N 2B39A 4W9CC 2LW3A 4DO4A 1AGCA 5G5DB 3HMXH 3BQUA 3BKMH 5E2UH 1T1XB 2ZAIA 1RZIB 4P5MA 2WNGA 3S97C 1UZGA 1OVZA 1T03H 3TONA 4FQIL 1JDCA 4HWZB 5K9QI 3ECQA 4HSCX 4JZJA 3BPNB 3BZFB 1JTTA 4GUPB 5LN4A 5KSVA 2QSCL 2K6ZA 5EU4A 3SQOL 2V17L 3BQUB 4TUKL 5H4YA 3WIHH 4UILL 4P5MB 4BQ9A 3MCLL 3T3ME 4Z3EA 4OZHF 5I6XC 4QAMB 4JZJB 1OTSC 4A2EA 4K3JH 4NN6B 4U49A 5E6YA 5EU4B 4UIKL 2VTFA 5K39A 5JHDB 3FFCA 1NC4A 3MDJA 3QQ9D 3WJMB 3QIWC 1WH0A 2EC9T 1PAMA 5IOKA 5KYWB 1ML0A 1QW8A 4AC2A 1HTYA 4H1LB 1YNLH 3D8MA 4L4VB 4YS4A 4UT7L 4DTGL 1ND0B 1TJXA 3FPXA 4K7FA 4LVNC 3IF1B 5JW5A 3NSFA 3UYPA 2R56L 2NY2D 5IFJB 3BVDB 1DVTA 5EBGA 4PLKC 2ZUUA 3US1A 1MVUB 4PH8A 4S1RL 1AS6A 5DJAA 3QCVL 5EU5A 5FCUH 4HKZA 5KVDH 4FP8H 3UDWA 5GZNC 5JW5B 1W6LA 1OXYA 3VXME 3LEXB 3DOSA 4YEEA 4FJZA 1Z3GH 4QWWC 7PAZA 4H8PA 3K46A 3K6IA 2VRAA 4XVTL 3NJFA 5LCVL 3UTSE 5J0BA 4UF7C 4DZBA 3HE7D 4L5FE 5MENA 4HKJA 4L5FL 5BXFA 4A7GF 4HKZB 2OP4L 3NEXA 4AGPA 3HE6D 4PFEA 3TP4A 3KLHD 1GAFH 1Q94A 3DOSB 3BD3A 2PYFB 3CLFH 1J86A 1I9JH 2ICCA 2E7DA 2IPKA 3O41B 3QIBD 4DZBB 3SZKC 2BO0A 4HKJB 3TFKC 5BXFB 1WFUA 4UINL 1IEAA 4AG4H 1TJHL 3SPVB 1TJIL 1IILE 3VW3H 4NGHL 1S7VA 1DANU 1FL6B 1OGAB 4JY6A 2YRPA 1AQMA 1DQQB 3PAVA 4WI7A 5EA0H 5I23A 5DD0H 3MA7A 1R33A 4OJDH 2VDRH 2XKUA 2Y1YA 3WMQA 4L4TE 4WWKC 4L8DB 3MX0B 2JQMA 3HG4A 2V5YA 4NRYB 4NUMA 3ECVA 3MV8E 4QXWA 3NFSH 4L3CA 2VIRB 1Z7JA 1UWGL 4GW1A 1VZGA 2XFXA 2EO7A 2R29H 4D7BA 1NC2D 3G5XA 4PJIB 2Z31C 4LL9A 4IBQA 1GRWA 2Y1AA 3A67H 1R9FA 2A9CA 4FXTA 3ZKMC 25C8L 3SE4C 5ANMA 2XFXB 2H2PC 4E9LA 5HHVH 2QADD 2WINB 3G5XB 3P02A 2IQAA 2OXGA 2Y25A 5E5UB 4GAYB 2CR3A 5J6HB 1RZJC 3E7JA 1LVEA 4GSXA 4BZ2A 1N8OE 4AQ8A 4KHXH 2R0WL 4PJEF 1HSAA 4HIQA 4MLSA 1KG0B 5T1KB 4XC1L 1JHTA 3VMPA 3EO1B 2FATL 2J56A 5ADPL 2LFGA 2XRAL 4XPTH 4MD0A 4I5BA 4JLRB 1F4XH 5EUOF 5E1IA 1Z6JT 3C5ZB 3KEHA 1KV3A 4HF5H 1RZ8A 3BQUD 1UWFA 1S9KC 3KGUA 1JHTB 3V6FA 1WT5C 5IB3A 5KAQG 2MHAB 4F7KA 4O58L 4EJ1C 2HVKB 3MOQA 1XGUA 4UQEA 4Y4HC 4HSAC 2Q8AL 2ILLA 4I5BB 3ZBMA 2JKTM 2FYYA 2VN3A 1RZ8B 2COVD 4JO4H 5D72H 4MJJA 5JHDD 3RPKA 1LO4L 3M1CA 1G0YR 1GIGH 1MW3A 2GEEA 4XP9H 1HS6A 4JMXA 4ORGB 3BP7A 4XCFL 2PR4H 3MJ9L 1B4LA 4PJ8A 4HPOH 5H94A 1WZKA 2FYYB 1YMHA 3Q5TA 4NUJA 4KZDH 1D7DA 1PSKH 2NW2A 1AP2B 4RRPA 1NC4D 4K94L 4POUB 6FABL 1SHMA 4D2NA 4UZSA 1NCAL 2Q7YB 3S3SA 1X9QA 3BP7B 1WJ3A 3D0AA 4PJ8B 3I2CL 5H94B 4M7LL 1ZLUH 5I76A 1FHNA 2DLTA 2P46B 3X1BA 2NW2B 4ZMPA 2FJFA 5B22A 4JQIA 4N2CA 1UASA 3DGGA 3HRZA 4DT2A 4HVBA 4Z77B 2DDQL 2ZNXA 5FFGA 4HOZA 5IQLA 3KPSE 2ZG3A 4ODXB 3DYPA 5I76B 1TZGL 3MJ7A 3T9WA 2XU9A 4MMZC 3TCLA 3CFJA 4M93C 3VH8B 1X5IA 3EJQA 3WFEH 4IRSB 1IIIA 3GSWA 3F5WB 3IE4A 1OCWH 1MEXL 1EHNA 5MEND 4LRIA 2SEBA 1NEPA 4XMVA 1QNIA 4XP5L 4WHDA 1JZ4A 1DSYA 1AE6L 2Y36H 1OM9A 4ZOBA 4XCEB 1CTOA 5C9JA 2HN7A 5DTFB 5DZOA 1KEML 3OAYH 1RKRA 4GT0A 4N2FA 4BK5A 3KLQA 2Q6WA 3GK8H 1JCVA 1NAML 1YCSA 4F9PA 5I73C 1BFOA 1ZXKA 2AEPH 3DTDA 5CD5C 3TU6A 3VX0A 3SDCA 1E5YA 5AVTB 1P1ZB 1ZSDB 2WLLA 5C9JB 2DEYX 3H2PA 3TBYA 5D7IE 5BO1L 3W2DH 1DBKH 5SX5H 4LHJB 3FF8A 4LPVA 3FH7A 5D9SA 3ZE2E 3LVEA 3VXQA 4N2BA 1PL3A 5I1EL 4UT6H 3ECWA 4U6TA 1AR2A 1H0DA 3SDCB 1IC5H 4LSSH 4A6YA 2PYEE 2WLLB 3DX4A 3SE8L 2EIJB 2X1WL 3GC3A 1INQA 3DHPA 1RZ7L 4PJHA 2IFGA 2B3RA 1F1DA 5D9SB 1LK3L 4LSDA 1VCAA 3QNYA 2GFBB 2NY4B 1H0DB 2FSEA 3UTTA 1M7UA 4HLZG 4LAQL 3WS6A 3EYSH 3AQYA 2A9BA 4JFUA 4RFNB 5KSAA 1INQB 4P2RA 2V8MA 3OR6A 3ZYIA 3R7RA 1YYML 5T1KD 1ODUA 3P40A 4KTEL 3UTTB 2MNUA 5BZXA 3MLPA 5JUEL 4XOAA 3I84A 1E8XA 2F74A 3HS8A 4M62L 4P59L 5KSAB 3QYNA 2VDRB 3BH9A 4JRWA 4WJG3 3C5ZD 4A63A 1O7VA 1OL0A 4L1SA 2BP0A 1CQKA 4G6AC 3VXUE 5I1AA 1E27A 3OL2A 3QUZA 1PKOA 4NB7A 5FYJL 3DX9B 1IE5A 1JGEA 1HEHC 3T1FB 3VNZA 2JXMA 1NGXA 3UAJA 3Q2WA 1X5MA 2EIDA 1T89A 4PJ7E 2I32A 3MKGA 2Q3AA 4MNGA 4WHYH 2BP0B 1GR7A 3HRPA 3KPNA 4RRPG 3MROA 5CJOL 1SEQH 2YIHA 1JGEB 2YA2A 1SRDA 4HUUA 3WY2A 1LXMA 1NGXB 4XBGB 4EBQH 4MMXA 4NC1C 3VI4E 2XN9A 1HCVA 3CFCH 3LPPA 1B4TA 4MNGB 1KY7A 1PJ9A 4N8CH 3KPNB 1Y0LA 1V3KA 3L2MA 4WY7L 3RKPA 1HSBA 1JSYA 4OD2A 3VH8G 3CAFA 4LU5L 3QHTC 2WBKA 4RFOL 3OHXA 4HUUB 1KTLB 1ZT7A 4PJ8D 4MMXB 3P2BA 4NWTL 5BW7C 1AHWC 1HFUA 1N2RB 2G3ZA 1NLBL 4QTFA 5DRXA 3VMNA 1Y0LB 2W65A 2Z3FA 1HSBB 2QJDA 2V4LA 3BE1L 4MJ4A 3BP6B 2XWXA 1MQKH 1QLEH 3IDMB 5D5MA 4OZIF 4OKVA 1N4XL 5J06A 3CSYA 3NH7L 1EEUA 5E8DH 5AZEL 2UV3A 3UX9B 1HNFA 3GBEA 3Q44A 4MJ2A 4WU5A 4GG6F 1FDLL 2YZ1A 1CXEA 2W65B 4MGXA 4NQVB 4L3EB 4K0OA 5BZDA 2F15A 2XTJC 3W0WA 2FBJH 4OGAD 2ZKYA 4IRSD 5D5MB 5I8CA 3GI8L 4W6YB 4F1SA 2MKLC 5LN8A 2R0LH 1V54B 1CF1A 1NLDL 1UXMA 4ZBJA 2Q10A 4WU5B 5DRNB 4MDJA 1R3LB 3QPKA 4FQLH 4PJFE 4MJ6B 1E8YA 1KBPA 4XPBH 5CGBA 3W0WB 5BZDB 6CGTA 3ROOA 5DCCA 3VXPA 4ODSH 4HJUA 3OVUB 4RMQA 2YPVA 3SPHA 5GPRA 1W16A 1ZA6A 3DIFA 1F11A 1JYNA 1PLGH 2ZKMX 4JFZL 4MDJB 1AR1C 3V9EA 3G5YB 2GSIA 3VXPB 4B50A 2WZ0A 4LSVH 5T5FA 3H0TB 5B3SB 1ZA6B 3DIFB 1WFTA 2C5DC 4HG4J 3B7YA 2EXTA 1VRSA 3IYLW 5IVZA 2NDFA 1PX4A 1EV2E 3ZL4L 4EEEA 4OZFH 3SDCD 3WIIH 4IJ3B 3OJ2C 2EDJA 2Z0BA 1XCQA 4IOIA 1HK6A 1KTKE 3H8NA 4JO3L 1T20B 3B9VA 4DAGH 3KPTA 3NIDB 3DK2A 2ZCLH 2V6HA 3S34H 2NY4D 3CDGA 4BFRA 1MHHB 4DQOL 1LE9A 4NN5B 2CSPA 3T8XA 2AK4A 4KDWA 2VMJA 12E8H 3FL7A 4HWNA 1FYTA 3VI4F 1M3JA 4HIXH 3BAJA 5K69A 3CDGB 3UTTD 2GJ6B 3HC3L 1A9EB 4JFDE 5IHUH 2P8LA 1RK1B 5GS1A 4G6KH 5KSAD 2AK4B 4ZFOA 4UT6A 1A14L 4HXAL 4P2RD 1BMGA 2GVYA 2PO6B 3FHEA 1HZHH 3QXDA 4KDTC 4YSOA 5GRUL 3ZK0A 2C7FA 2GG1A 4J8RB 1T4KB 3P3SA 3RPIB 3RA7L 1FI8C 5EB9A 3K6SA 1UB6A 3WU1A 4ZFOB 2LVEA 2A9DA 3FCGA 5I15L 3KR3H 3RFZC 3UMNA 3QG7L 3QUZD 4OCSH 5A3ID 2HPOA 3HC2A 1A6WL 4DGIL 4OLEA 1YJDC 4QYAA 1FSKB 4XZ4A 3UAJD 3S4SB 4WFGE 5D7LA 1UB6B 2CGRH 2FHBA 4X6DE 2EXYD 4S1QL 5FHAH 1CL7H 5ILTL 3QJOA 1CXHA 2CO6B 1XHHA 1SXBA 4XB8A 3DRTB 1ZPLA 1ICTA 5HYEA 4PYGA 1P7KB 4XMXA 1RUKH 1TLMA 4NZFA 1BXUA 2F7OA 4BD4A 1OARH 3LMJH 1RMFL 4XX5A 4ERSH 2XN9D 2VXTL 2BVPB 1ZLVK 1TZAA 4CU8A 3AUWB 1J8HE 5GJSH 4MB3A 3KPOB 1U8PB 5EC1A 3APDA 3IPEA 3Q1SL 4LLAA 1FZOB 2Z64C 4EOWL 1DZBA 2WN3A 1A7PL 3A6BH 2YXMA 4OIIH 4M1GH 5E2TL 5TGBA 4Z5RB 4QI3A 4ZD3L 4PG2A 4AGQA 4L3ED 4HBCL 4X5WA 5ESVB 4UZUA 4XE5B 3SYOA 3BLBA 1FWXA 4PRIA 2KI6A 5DQJA 2EXWC 2DWXA 1F00I 4S0HA 3EHBC 1YAZA 2Y5TA 3N42B 4V11A 2NMSA 3S3CB 3S3BB 3QFDA 3EYQC 4BQ6A 5I82A 4PVMA 3QUXB 4X5WB 3W0WD 1KCSL 2G3NA 4TSBH 5D6CB 3TYGL 1CFVL 4MYPA 1YA5A 5LGHL 2WBXA 1NGZA 1NKRA 1BLIA 1DEDA 5EEVA 1EMTH 3MRRA 2JSFA 2ZXAA 1KC5H 4LSUL 1DQDL 4M1DH 2VDOH 4BQBA 1ECYA 1UFGA 4LEXL 2R9HD 2VZ3A 2Q20A 2IH3A 1X4XA 2CJTA 2QVMA 4E5XA 2H47C 3KWUA 3WD5L 1QLEB 1Z9SB 4ALAL 2R23A 1IGYB 5CN1A 4LP5A 4OGXH 4D9LL 5KS9F 2HMIC 3W57A 5F9JA 3OWRA 3ULVE 4EDWH 1P5UB 1FO0H 3WDHA 1H3PL 2BVTA 2GT9B 4GMTL 2M26A 4FNPA 2IADA 1VGEL 1WZ1H 1I1AC 3U36B 2HWZH 4AIEA 5F9JB 4XN8A 1FLRL 1G5AA 5HI3C 1OOAA 3H56A 3TWCL 5GRJH 1ETZA 3H3PL 1WC7B 3KPRE 3CPUA 4L8BA 1U91B 3ZKND 3EYVA 2IOIA 1ZANH 3T71A 2ITEA 5DZAA 2PWGA 2F7QA 4LDCA 1ORQA 2F1BA 2PABA 3IFPA 5IT2L 4YE0A 4AE0A 4O02A 4KJWC 4FLQA 3L3IA 2CUIA 1BXVA 1RP9A 3U7WH 1D5RA 2I9LA 3MACL 3S4SG 3WFCH 4PB9H 3ILQC 4G42B 2AK4D 2IAMA 1EANA 2NSMA 1YMME 2PTVA 3EYVB 4EXKA 1G6VK 1FYTD 3IFPB 4HPHA 1Q9OB 1RUAL 1T04A 3OC5A 5DUBB 2F8XC 3VQ2C 5BRZE 4YAQA 1M4KA 1TQSA 4TNFA 3U7YL 2I9LB 1Q0YH 1OK8A 1JVLA 3B2VL 1MIML 1ZT1B 3TN0C 3V4VH 3BUPA 5D1ZA 4CKQA 5CLXA 1MI5B 3FO9B 4I2XE 2ZOLB 4EDXB 1MVYA 3MNVA 1X5JA 2DZEA 5IBLD 4KDVA 4QRBA 1SMAA 4BFFA 1JXGA 5FK9A 3ZHDA 3GSXB 4ZFGL 4YAQB 1XAKA 1CR9L 3WE6B 4ENEC 5FO7A 3B7SA 5IWLC 4FQCH 4QPEA 3V0EA 2EUWA 2J8OA 2BJMH 3WHE1 3MV9A 4L29B 4KK5D 2EH8H 5LG6A 3ET9F 3S36H 2R83A 1UM5H 3QJXA 3LV3A 2J4WL 5ES4B 1QI5A 1YDPB 4J3OG 4AQ1C 5FO7B 4A38A 1ED3A 3FOLB 4JL1A 2R69H 4FXKC 1A25A 4KI5E 3OLEA 4YBQC 5J89A 3FONB 1QI3A 5IHWA 1KCBA 1UA6L 3LV3B 5F88B 4UT9A 5BNXD 3KAAA 4XO3A 2F7PA 4FNLL 3CSTA 3S5LA 3EH3B 3SKJH 4NHUA 4C55A 1W8OA 1AANA 2V5RA 2X9XA 5TDPA 3C8HA 2FEDD 3UCQA 2IDFA 1DVZA 1JGUL 3LXCA 1JE6A 3NABL 3CIQA 4M8RA 3TASA 4HHGA 4J3OD 1P6WA 4RNRA 3S5LB 1I4FB 4R6UA 2FR4B 4NHUB 1R24A 1DVFA 4F7MA 2AQSA 2FT6A 1FVCB 1YECL 4ZTOL 4FEIA 1GZQA 1E5BA 4Q9QL 2W0PA 4AIXA 5D1QA 2ZUQB 3HC0A 3VJ6A 2O5NA 1B88A 3ARWA 4PRID 3ZN6A 4WTQA 1QG3A 1VPOH 2AJYH 1RIHL 3MRGA 2YAHA 2YK1L 3KYMA 1J8RA 4E5XG 4F7MB 1K72A 2Z92A 2VH5L 3QNZA 2AJZB 3D30A 4OIAA 4OF0A 4EIZC 3BZDA 4PJ5A 1M53A 3D18A 1Q9WA 2VMEA 1GZQB 3G6JB 4JPIB 2R0ZH 5D1QB 1RIUL 4NI3A 3BT0A 4R7NA 43C9A 4I0PA 3QUYB 5BZWA 2D3JA 1E6OH 4LPCA 1BOGA 1CDIA 4XMPL 3VU1A 4DUXA 1OGTA 4YL4A 5ALBL 2ISDA 4P8QA 1KJ2A 4NPYB 3D18B 1Q9WB 4N1CA 4PWHA 5JPNC 2YAFA 4AEIH 3A23A 3ARFA 1FL5B 1OT1A 1PZDA 2VL5A 5BZWB 3IMSA 2NTFA 4R90H 5IQ9A 3VTAA 5GISL 5ECJE 2WM0A 3GRBA 3Q7JA 1OGTB 1X5ZA 2Y7MA 3CN2A 4RGNE 3TLRA 5J11C 5KVGE 3NP4A 4DOHB 5IM7A 2EDQA 5KVGL 2JJSC 1PTZA 2LT9A 3UROR 4UAOB 1XGYH 3ARFB 3BIAX 3ARQA 1E9PA 3JTSA 1DJSA 1G7PB 2VL5B 4UB0H 2B4CL 2J1YA 3SY0B 5IM7B 3RTQC 5HGHA 4L9DA 4M6OH 3WO3B 1ORSB 1ZKAA 3JTSB 4TN9A 4GJTB 2XT1B 4QHKI 2CQVA 2VDOB 3D52A 2IQ9H 3PFUA 3PRZA 5F89A 4J4PD 5LXGH 4R7DA 1WICA 2WZ5A 3FULA 3K2UL 3L5JA 1QVOB 4QO1A 2YEZB 4XXCA 5CJBA 4FHKA 4JANA 3T6QC 4YDJA 1YY9D 2IAMD 4F3FA 1ZIAA 5JQ6H 2CAKA 3E6FA 1A7QH 5E0FA 2OULB 3CDZB 3QRFM 2D7MA 4ANXA 2WV3A 4ZUVA 2WTRA 3GO1H 2A9NL 1YSOA 3MRQA 4X6CA 4Z0XB 4BXVA 3V5DA 4RZCB 1QSFB 3VB9A 4F8TA 5HHOA 5DI8A 4HFUH 3GBNL 3JV4B 4FFZH 4HC1A 1WAAE 2WTRB 2F61A 3ELQA 2G4EA 4HCRH 3MRQB 4N2OA 2XZZA 4W1TA 3GXIA 3S5LG 3P1VA 4AGMA 4WNJA 4WEBL 3B9KC 1BQ5A 3FCUB 4Y16B 3DO7A 1HINL 1ZGLB 4TLKA 1CIUA 4RQQA 2BY3A 3WHXA 2XC8A 3PHQA 3AJ7A 3IMRA 3KYOA 2E8YA 4M43H 1KCRH 3QDME 4JFFE 4CMHB 3SB3A 3H9SA 3QUKB 2RGSA 4JFTA 1AMXA 4WFFD 5JOPD 3DO7B 2D9CA 2F53E 4LESA 4KXZH 5DD5L 2RALA 2Z4TA 3L16A 3PWUA 1HHGB 4JY5H 1SM3H 2WOYA 1C8QA 4K9JA 1KN2H 3PHQB 3KYOB 4U1GC 3V4VB 4UOQA 2CA3A 3TESA 2Y0SA 4LNRA 4X6EB 1ZLSL 2FEEL 3T4YB 4R3SA 5AOZA 3QPXH 2Z7WA 3K91A 1U8QA 3EH5B 4QRPB 4XPFL 3UPCA 5LWYL 2CIIA 1OQXA 2B59A 3UO1H 2R69A 4S1SH 4HDIA 3CX5J 4U1MA 1DVFD 2A74A 4ADIA 3FUNA 2AK1H 3E0GA 1U8QB 5C08A 3SYQA 1BOYA 4L4JA 5SWQB 1MFDL 3OAUL 5D1QD 1WS7A 2B59B 5FUOL 3DOHA 3QUYD 1QLFA 2DMGA 3V0IA 4U1MB 2CDEB 1OD7A 1EH9A 3AG2B 4N0UA 1YQVL 3WS3A 1UA3A 4G2AA 3VFUA 5B39A 4YEFA 5FFLA 2ZCHL 3QS3A 2LTQB 2VZ1A 3RVTC 5TE4H 1A1OB 1WRFA 2AF2A 4JKNA 4Q58C 4BSWB 4I0PD 2F6AA 2Y3AA 1DLHB 5A2JH 2C3HA 3K71B 2E9JA 3WS3B 3VFUB 1IBHA 3EJZC 1A47A 4LCVA 2V2XA 4LIQL 3CGTA 4Y19A 4Y5VC 5JDSA 3ARFD 3VFTB 3QJUB 5B1JA 3VXNB 3BO8B 1KCKA 3MRNA 3H1ZA 3DECA 1X9RA 5HP5A 2FIKA 4YE4L 3WFDL 5EFIA 2WWKO 4QHUA 4YHYB 4HWUA 2ENQA 1W0WA 4QXTA 4Y19B 2QSVA 1J18A 5JDSB 2EEBA 2VOTA 4DGYL 5IP4A 3QQNA 3AGVA 1DEEA 3L5XH 4N5ED 2AI0H 1EX0A 4NZRH 5DMJB 5DJ8B 2FE0A 5GGSY 3W3BA 3VWKC 4KRPB 2X7LA 1HCFX 2C3GA 5D1ZI 5EFIB 4QHUB 4QXTB 3VM5A 1W0WB 2CDFA 2WXJA 1TENA 1W72H 4MASA 3OLIA 5I75C 5AVYB 4X0NA 4WTXA 3UERA 4X9HA 3MLSL 3HUJA 1KYAA 4CN6A 5CEZH 4N9GA 3ESPA 2X7LB 1TZ8A 5E1AB 1J7VR 1XSOA 1S7TB 4NZ8A 1HYRC 1VF5C 1FCGA 1XZ0A 4OI7A 1HHJA 3BKYL 4OV6F 3J8F7 2VABA 1AZRA 2EO1A 2AV7A 2ZJSH 3NA9H 4LE8A 3AG1B 3RZCC 4RRPM 1K4DA 5ENWA 4WVRA 3CMOH 4MVBD 1HHJB 5I1KH 4OQTA 2XLLA 4MA8H 3LKPA 4G8IA 4ZSOA 2AV7B 5IOPA 1L7TH 3DC0A 4IRZH 1HN1A 3CPLA 5IBTL 2J6EL 5KG9A 4LQFH 4Y16D 1K4DB 1U4FA 2EVHA 2N1TE 2D03L 4N0CD 1E4KA 2NYYC 4JO8A 5D1XE 3GRWA 4ZUTB 2NQDA 5CGYC 1MY5A 4G8IB 9CGTA 1WWBX 4FFYA 4G6MH 4FNSA 5IOPB 1IC0A 3NGBB 3NESA 1UM6L 3BN9C 3X3FH 1DVSA 1SJXA 2EVJA 3WNIA 1QRNB 1F0LA 3TVMB 1KSRA 1UD8A 4JG0L 4C56A 5C0CA 4P46B 1CICC 3EO0A 2Y22A 5DEGA 3LDBC 3WE1A 1OT4A 4M7ZB 1MFBL 5JIQA 3JTBA 5MI0C 1RIVH 2VAAB 3F7QA 5HDWA 4QRPD 4XBEL 4TUOB 4HD9A 1XGTA 2IPUG 5DHEA 4C56B 2AJXH 2EVFA 3DSNA 2GAZB 3EO0B 5DEGB 3D4CA 5HGAA 3BPOC 1JHKH 2IMMA 3DGDA 1P7QA 2F8IA 5B39G 5I8OH 3FCTA 3C75A 4ZW5A 3ATBA 4FXLA 1XGTB 3ZQXA 2FYVA 1CD9B 2PWFA 2NNAA 3IXAB 5HGAB 5I0YA 3L3OC 1NCBL 3L3DA 3PNWA 1ZV2A 4JM4L 4KJYB 4MJIB 4B5ZA 1MHPH 2XX1A 1IE4A 1RZFH 2XQBL 4PRAB 3E2HB 1XGQA 3HEIB 3O3EA 4Z7VE 1KULA 2J44A 1QUNA 3BUYB 3QAZC 4UQIM 1P6AB 3RVVC 4JFPB 1A7BA 3MR9A 2GUOB 3QC6X 4PRHE 3PAZA 3FN9A 3U9UA 1K9TA 4ICXA 3LNFA 1N0LA 2WVTA 2WYIA 1T3FA 4HGKC 2FHFA 4JE4B 1FV1A 4JRYE 1XGQB 3O3EB 3A5VA 4M48L 1GC1C 4AYEC 2A83B 1KTDA 4HBQA 2A2QT 3IJYB 5AYUH 4MXQD 4PWIA 3U9UB 3W9EA 1EHLL 3T04D 3P9LA 3X1NA 1T3FB 3GXMA 3KM2A 3GSNL 1FV1B 3BYYA 4Y19D 3GFUA 3WNPA 3BRDA 3BFWA 4TXVB 4PWJA 2RD0A 3DVGA 4EIUA 1PIGA 4LVHB 2N4IA 3ILEA 1A2YB 3VMOA 1ZCRA 2GSGA 1KYDA 1QPKA 2WLNA 3P9LB 2L7QA 1D9KB 1XZWA 1J9QA 5CSZA 3FQWA 5FYKD 4L2YA 5DFTA 3DVGB 5LAPA 1SFHA 1HX0A 4PJCE 3VGEA 1KELL 2LE9A 4PJ6A 5F1OB 2YPLB 3OWEA 2FECL 5CILL 4LPXA 2XZQL 3RDTC 5J12B 1OP5K 2DQMA 5T33L 3G6DH 3FRUA 4KO7A 3VFSA 2QR0B 3AS1A 3EBAA 4BKLA 1WIPA 4WI4A 1ZVYA 2D2OA 4LCYA 3SOTA 4YHZL 5EU3A 3T1WA 2ITDA 2X38A 1PZSA 5IROC 1BLNA 2X9ZA 2DQUH 3QUMH 2O6DA 1M05A 3VFSB 1NQBA 2X6AA 1N6QL 2BERA 5FAAA 4F37F 5CINL 4LCYB 4AIZB 1HXKA 4AKOA 2APVA 4YXKL 2BWIA 5EU3B 4NUQA 3CH8A 5IREA 3MODH 4F15B 4RMBA 2D7NA 4V2BA 1CLVA 4RDQF 5MEOB 1J9RA 2MEJB 1M05B 1W72B 1S7WA 3LKSA 1OP3K 2JKXA 3GXNA 1QRND 3TVMD 4WQOA 4XNXL 3NDZE 4P46D 1TCMA 1U8LA 3II2A 4OLUH 2C1PA 1EGJH 4CC1A 3PHSA 3SDAA 3LKSB 1VADB 3RWFA 2FO4B 4Y2DB 4UMSA 4HUKB 5JPMC 4M5SA 4OGQC 3SDYH 4C56D 3QDGA 4R2GC 1U8JB 4OZ4B 5C0CD 5LQBL 5L8KB 4FKEA 3S5YA 3S3JA 2RFXA 1MFCH 2HLAA 3SDAB 3RWFB 3VSTA 3MAWA 1WZAA 4F37K 3AT9A 2DOCA 3I74A 4TTDC 3QDGB 5D2NC 1SJEB 3IPFA 4PWEA 4FS0A 3COOA 4F1ZA 2RFXB 4MJID 2HLAB 3QUHA 2B15A 4PGBA 4QRQA 4GRWB 5F21B 4YMPA 4PLJC 1I75A 3QDJA 5K59F 3NZHL 5LAXA 3ZTNH 4UILH 3RX7A 1K2DA 5D2LB 1AXTL 1IO4C 1UURA 1LP9B 3CK0L 2WVVA 1NUDA 1QAWA 5CUSL 1INDH 1OAXL 1XB3A 3C60A 3QDJB 1W9XA 2R15A 1BX2B 4PBVC 1Y6MR 1K2DB 2IBGA 2NXYC 3V5HA 1ZLEA 4M5YL 4ELKA 2WO3B 3Q0HA 2J8UE 4JL2A 4H5SA 4KY1H 2BNRA 4LRNL 5I19L 3R06B 4W9ZA 1RXLA 2VQ1B 3C60B 1HJBC 5DVMA 3UP1A 5I5JA 5IJDC 3O8XB 2PWEA 5C07E 1NWPA 2OL3L 1R17A 4OZGA 3V5HB 1UH4A 4ELKB 5C0EB 1XB6A 3TBVB 4H5SB 5DK2B 4Z7WE 2H1PL 5EOCL 1NMAL 4Q0XH 2NX5B 1G7HB 4NKMA 2QVTA 1J0HA 3LD8B 4KOCA 4YFEA 1A4BA 3S7GA 3L4ZA 3NSYA 3MRCB 3K0YA 5B4MD 1YUHA 5DQDL 4BBWA 3OG6B 1TVHA 4S2SA 2KUTA 3RHWK 5DMKB 2X1PA 2NY5C 4NNPL 1JRHL 2UY6A 2OP4H 4QAWA 3O6LL 2APBA 2EUVA 1XF2A 4GYBA 3QB7C 1YUHB 4N0FA 2CA4A 4P3CL 5C0AA 4L0PB 1YPZB 4N20A 1TVHB 1RZQA 2J1WA 5EU6A 5SWZB 3GHBH 1NIFA 3G04A 3P0YL 3Q2VA 5KBDA 1EEZA 5GZOA 1E2ZA 1FNLA 1A22B 4NQSB 3I6LE 2UY6B 1D6EA 4ZOEA 5E70A 1OT2A 3C12A 3CU7A 5HDLA 5IW6A 4YN3A 5TE6L 5EF1A 1N68A 1XF2B 1A5FL 3FO2A 4N0FB 4NQEA 1TJIH 2EDOA 4XN1A 1MLCB 3G04B 1FGVH 3M1BA 1IGCH 4JCWA 4Q6IB 3VXRB 4HJIA 1D6EB 4XB7A 5IFAH 1FNEB 5IW6B 1DANT 1SVCP 4LSRL 3FO2B 1MCQA 4PJBA 4MJ5B 3VG9B 4YHLL 7FABL 2AQQA 2A0LD 5DA0B 1ILUA 5CEZD 2WQSA 1ZVNA 3HJEA 4BYHA 3TIEB 3SYCA 4DIXA 4PJBB 1I3RA 4YXHH 2X4PA 4U3HA 1LEKA 3WL9A 4HJEA 3F84A 2LGNA 3D2TA 1S9WA 3H9ZA 4K2UH 4TSCH 4TNVK 3GS4A 4O5LL 1D5ZA 4N2GA 4X8JA 5E2VH 2QSQA 5SV4A 2FGWL 3OKMA 1H5BC 1NCHA 1LEKB 3SDAD 1SDYA 3WFBL 3LEYL 5FHBH 3JZYA 3L9RA 1JD9A 4NQUA 3AU0A 1S9WB 3AXLA 3PQYB 1FA4A 3LHAA 3I6KA 3QDGD 1J48A 1D5ZB 2R2CA 4JPWH 1RZKC 2R0KH 2GC7C 4LPUA 3CQFA 3IK2A 4OVVA 4X8JB 3V0GA 3W1ZA 4Y8AA 2XACC 3C08L 2NR6D 5ISZE 1NMCB 3TNNA 1BYPA 3L9RB 3WIFB 3GSUA 1EDYA 1J5CA 4U1LB 4M3JA 3OXSB 1QABA 3BP5A 3CCHA 2VXUH 4HT1L 1NCCH 4O58H 4R4BA 3ULSB 1IV8A 1YEIH 3MFFB 1JK9A 2NZ1A 2FX7H 2H6PA 3LYRA 3TNNB 2FZ3B 2QGEA 5IJCC 3QDJD 3GSUB 1VFBA 4AC4A 1AHMA 5IQOA 1LEGB 4HIEA 3RWDB 3BP5B 2AQ3A 3KPMB 4P0DA 3IGKA 4R84A 2XSKA 5CBEA 4B41A 3C60D 1VFBB 4UM9A 5CHNA 4OCXH 2OYPA 2B8OT 5I6LA 1X5FA 2AEQL 2PWDA 2OZ4A 1A7NL 4LASH 4OJFH 5TH2A 1XD1A 4CMMA 2BNRD 1X6NA 1F58H 2DJ4A 1BJ8A 4I8DA 4X9FA 5IB1A 4JJ5A 2Q1EA 4K9EH 1BD2B 2C9PA 4TPRL 5CHNB 5FCSH 4ZUSA 3LHPH 2P45B 3H54A 3QULB 2I9TB 1K8IB 1WFOA 3I9GH 4YDZA 4BSVA 3KGRA 2ZX8A 1BM3L 4WWNA 1B2WL 1GMIA 1FGNH 4JHVA 4XI5C 2D73A 3EDFA 2M2DA 3CFEA 1JWMA 4ZUSB 3Q43A 1E5UI 2EKJA 3AWGA 5LXVA 5DMYA 3ETSA 2DD8H 3BAEL 3NCCB 3OKEA 2H3NA 2BNQE 5F7KC 5IW1B 4U6YB 3TEXA 4E9WA 1U3JA 4E9QA 3CFEB 1JWMB 1R3KA 1IBGH 5M94B 5JIKA 4FE9A 4QCIB 3AXHA 1TTFA 4K7PY 3OJDA 5DGRA 1M1SA 4U1JA 3P4MA 3UC2A 5BVJA 1E3ZA 3VXRD 4AQAA 2YA1A 3FTSA 1ASOA 1X7QB 4HEPA 3NJIA 4UTBL 1MAKA 3CSFA 1UYWH 4NQED 3OJDB 4ODBD 4WUUE 3V2AR 2OTUA 5EOCJ 3INUH 3CUPA 1MF2H 1SXCA 1ZHKB 2J21A 3P4MB 3QC5X 1Y1UA 3D3VA 3UXFA 4AQAB 5A16A 2ZXDA 3G9VA 1E40A 3MGAA 3ZE0E 1DBJL 3SGKA 4HIIA 1YO4A 3UTSB 4EUPA 3N04A 3BDXA 4DCQA 1DQKA 3CUPB 3T0EE 4WI3A 3VD4A 3CE1A 5AVXB 5IIEB 5A16B 1BVKA 1IM3B 4G1MA 3GB7A 5CP7A 4I3SL 2NW3B 3IDXL 4E0RA 3KW7A 4EUPB 3MZGB 4ODWB 3V55A 1YEDB 4UTAL 3RAJL 4DCQB 3IDIA 1SNRA 4MNQE 2KZKA 2N7SA 3BT2H 2DLFL 3ARDB 1BVKB 2ADFH 2ADJA 3PQYD 3ARBC 1JV5A 3BLPX 3GB7B 4G1MB 2XXFA 4CDHA 2FQDA 1GHFL 2VLRE 1TUPA 4LF3A 3ZDZE 1AGEA 3HG1E 1G7QA 1NPJA 1N59A 3KPLB 3INOA 1MRFL 3FC8A 1BREA 4PJAF 2HT3C 4RMTA 1JV5B 3TWYA 4H20H 1QZ1A 5EEWA 4MS8C 2FJHB 3EG9B 1IT9H 2HKHL 2DM4A 1N59B 4ISVA 4QRFA 4RFEA 3IFLL 4TYUA 3A0OA 4N85A 3VRLE 4Z7OE 3O6FB 5L9DL 1AS7A 4LHQB 5CJOH 4C4BA 2CKBA 2EDMA 3T77A 1WF5A 3S35L 5L6YH 3FZUD 1J9SA 3EO9H 3ABLB 4ACTA 2J5LB 3P4LA 4R7LA 4RGOL 5DFWH 3B9DA 5AB0A 4IOFC 1ZLVH 2CKBB 4M61A 4IU2A 3T77B 3ISRA 4HIJA 3P30H 4NO2A 5I71B 2ED9A 4OF3A 4APXA 2H26A 1MNUL 1JV2B 1V10A 2MPAH 3VFOA 4G82A 2O93L 1MWAA 5CD3B 4YHML 1AKPA 2IBZY 1ZEAL 1HI6A 3DLQR 4KZEH 5CU5A 2W9EH 5IBUG 1BD2D 5TDOA 1T80A 2A9MH 1ACYH 2JCCE 4DVRL 4HIJB 2WLMA 3FK3A 5T1LA 1UOLA 2QPSA 4HWEL 3ZVVA 3B9AA 1MWAB 4N9OB 5HGDA 1HI6B 1KXVC 3L4TA 3DBXB 3D48R 4KUZL 5DD6A 5TDOB 3GDBA 1Y7VA 4LLDB 4FTVA 2XQYK 4QD2E 5DMGC 5E2JA 4I18A 3DROA 2O1AA 4JDVA 5T1LB 4PS8A 1A6ZA 2H32H 5KYUA 1ILSA 2G4GA 4Q9BA 5EWIH 4WRLA 5HGDB 3SKNB 1KIUA 2WNWA 5DD6B 3FHQA 4ABQA 4P9HC 3DO3A 4HEPG 1NJ9A 4U6VL 4KKBD 5DJYB 1O9ZA 4JDVB 2K8QA 4YFDB 2VXQL 2C3WA 3FQ4A 3S2AA 3WJJA 5ACZB 5KYUB 3ASNB 1KIUB 4IGBC 4NQCA 4X6CF 2RBLA 3G6AB 2XWRA 2IG2H 4QUOA 5MEPA 1TQTA 4QRTA 4A2MA 1FE8H 2BIPA 4CRPA 4EUPG 2AS5M 5F7HA 3ZDZF 3FU3A 5TJWK 35C8L 3NJJA 4ZDHB 3MBXH 4NQCB 4H26A 1MCPH 3QHFH 2WNXA 3T3PE 4I4WA 4MAYA 3AS3A 4PY8I 3TPUA 5MEPB 3U4BH 5MEQA 4B0MM 4RZKA 1XIWC 5LGYA 4AXWB 5F7BA 1NUNB 3GMNA 5J3HC 1F3JA 1I7TA 2YWZA 1EUTA 3D3VD 3U9PH 5DUPH 1P4BL 5HHPB 1IM3D 1FH2A 2Y2YA 2E76C 3V4UL 5ERWA 4KROB 3VXSA 4FA6A 4MXVE 4G71B 5E08L 4AT6B 1DUYA 5F7FA 2J1XA 1WG3A 2YLKA 3GMNB 3KWTA 1MAMH 4F5CA 2CCVA 2X1QA 4AUUA 3CLEH 4HK3N 3KCWA 3UZVA 5CBAA 1GZHA 2XXMB 3JBG7 4K5LA 3HC3H 5FYJU 5ERWB 3KH4A 4YDIH 3VXSB 2VDPB 1B4JL 1BG1A 1B0GA 4YLBA 4LL1A 3EGSB 3FUJA 2CRIA 2PCYA 2PP8A 1CDHA 3BDBA 4JDTL 2VRQA 3PJSA 4IKNA 1PAZA 2EAEA 5CGTA 4HUNB 5D7JB 4NZTH 4FZ8L 5IHZA 3ZE2B 2B4CC 2I07A 5KJ7E 3DVIA 4MMYB 1ANUA 1J87A 1NDMA 5L0QB 4KOBA 4DP5X 3O6FD 1KYUA 4UUJB 4M6NL 4U31A 1NBVH 1V27A 4WW2F 2AMUA 1PD0A 3R19A 2ALWA 4NQDB 4UU9A 3SJVE 5B8CB 3GBML 1AGBB 1D7BA 3HNSH 4W81A 2I07B 3N0AA 3FXIC 3TH4T 2APFA 2G2RB 1NDMB 4Z7NB 5FXCH 3VAEA 2JK5B 2AV1A 3ECUA 3PWNB 5JHMA 5KWYC 4GQ9H 2IGFH 5GJTL 3MLYH 4PU2A 4UU9B 3OD3A 4WFED 5DC9B 1DE4A 3QH3B 2HJLA 3MLWL 1TOXA 3IRZA 4LMQE 2AV1B 3RUGE 4NC0B 2VN4A 2V5MA 4HWBH 4PGEA 4Z3HA 4PLNC 4JO2H 2VLKE 2X6UA 4L9LC 1DE4B 5L2KB 1K4CA 4ZO7A 4X8GA 4Z3IA 3TV3H 1JIBA 1M7XA 1RUMH 4XNMA 2LU5A 2I5YH 1DFXA 2MJWA 3C8DA 4QXGH 5CS7A 4HBCH 4PJ7B 4L1HA 3EOTH 4W4NA 3MXVL 1CBVH 2QKSA 1EEQA 5T1LD 4JFOB 1VB9A 4HU2A 4P2QE 3ELAT 4XNMB 1KPRA 4XNUH 2ZT9C 3PLYA 4YOKA 1NZRA 3HUJF 4NJAH 5D7KE 5DZVA 1VZIA 2J2ZB 4K73A 3IMVA 5EZIH 1U8KB 4K8RD 4H0GA 5C7XL 4LK4A 3ULUD 3HVDA 4U6XB 4G6FB 4MXVF 4EKXA 5JW3L 1II4E 1KPRB 1J5OL 1FNAA 3IDGB 1KCLA 2NPLX 1BZ7B 2VGLM 2E4FA 1YEGL 3O4LA 1LO5B 5L2JA 3MLVL 1R1CA 5AKSA 2WUCH 3QDAA 2ZPKL 3WD5H 4AI7A 4NQCD 1UUNA 3FT4A 5FYLE 3BZEA 5FYLL 4WK4B 2UY7B 3UMTA 3MJWA 5MP6L 4G8GA 1P4UA 2PN5A 3N0PB 3ULVH 1A6UH 3GXUB 1D5BA 1CXIA 3F8UB 3AADB 5EV7A 1LNUA 1HXYA 3FSWA 4CU7A 5I0XA 4GOSA 4CC4C 5GS0L 3L1OL 5INDA 3FT4B 3BZEB 4A7VA 4K71B 3WTXA 1PQZB 3L3JA 2BW4A 3UIZA 3EOAA 4KROD 2APSA 4XC3L 1UZ6F 1QBLH 2YRBA 3WXVL 2JI1A 1UXSB 3HB3B 4NFBA 1U8IA 2BY1A 4PGDB 3UZEA 1PPIA 4XNYH 3FQUA 2IXQB 3HRZC 5HDBF 2BXYA 3EOAB 3VXSD 4HOXA 3B5HA 3IGAA 3EJUA 5F93C 5K9OA 2VUKA 3MKKA 2P28B 2HKFL 1A21A 1U8IB 3ZDYE 1ERNA 2UZYA 2EICA 2CK2A 4Z18A 3W5NA 1NDGA 4EVNA 4Z8FL 2P52A 5K9OB 3SGDI 4TQEL 4NO3B 5AYQA 4HJGB 4W6XB 2UZYB 2GBAA 3V0VA 1DFBH 4LRIC 4AZ8A 5BVPL 4NQDD 1N64H 2WXRA 1NDGB 5AVUB 1Y6NR 3VUAA 3NDYE 3WTUA 3EBHA 3PJLA 3TBWA 1TYEB 4W9LC 1NSNH 3VE0A 5I6XB 3V0VB 1J0JA 2WXFA 4XN9A 2AXJA 2W0KA 4BK5C 5DQ9A 2ZUXA 1BA9A 2HT2C 1ZWIB 2BX5A 4X5LA 4Y2NA 4AUJA 2YD7A 2AJSH 3MUGA 4MQXC 3PHOB 2FX9L 3FRPB 4AGNA 1MJJA 2WKOA 3QIWB 2AJUL 4Y4FA 1G94A 3BKCL 3HPLA 3GZKA 4JRLA 2XVBA 1NUGA 4FYRA 5ICXB 4U1HB 5CCKH 3ETTA 1MJJB 3FO0L 5L2KD 4LVNB 4WKZA 2ZQKA 1EHAA 2WSDA 3WNJA 1RH8A 3U4EA 4IK7A 4DZ8A 2A1WL 1JGUH 4S0TD 3CVHL 1XTLA 2VR8A 4BM7A 2NCEA 3KHQA 3LN5B 2CLVA 2BRRH 1M7DA 3VFPB 1NFDF 4H88L 4X7TA 2XN0A 2YGVA 1XL6A 4S11A 2XA8L 2HRPH 1NMBL 3H4FA 3JWOL 4ZTOH 4PJXA 4OCWH 4Q9QH 1L9PA 5SWSA 1ESOA 1SZNA 4MHHG 1OCRB 4PW9A 4XOEA 4CN1A 1GPOH 3J27A 3IU4L 5HYJA 1SMOA 1RIHH 3BGAA 2CLVB 4G6FD 5PCYA 4EO5A 4X7TB 5J6GA 4WNSA 5HYIA 1OB0A 2OMNA 3WJLA 3PXJA 5I5MA 5SWSB 3QUZC 1R19A 8PAZA 4PGJA 4XMPH 4BINA 2XIDA 4WWKA 2OTWA 4KRNA 1JG9A 3VD7A 1NFIA 3ESUF 5J6GB 4JK0D 4I48A 4JB9L 3CZSA 2UWEE 3M86A 1I8KA 1U3NA 3O4LD 4QEGA 3DOIA 3AFLA 4JVWA 1D3CA 1R47A 2OTWB 1NFIB 3US9A 4F2EA 4N2IA 2EDNA 1TZHA 2ATKA 3ZHLA 2O5XL 3LB6D 1I8KB 4RISL 2JELL 4ZPTB 2Z31B 4JHUA 1TF4A 4V2CB 1YEKL 3OHXC 5A2IH 3M07A 3MV7B 3VGGA 2AJVH 3HB3D 3WEOA 1LO0H 2OV0A 1G0DA 2MQCA 3L3GA 3PWVA 4TQPA 4FFVC 4N2MA 3BC9A 4XVUC 2XCMC 1TZHB 2I69A 3X17A 1KXTB 1XVSA 4PCSA 2RCSH 5FW7A 1NGWA 2EDFA 2PNDA 4KVPA 1P53A 3L3GB 3L17A 5FO8A 5EBLA 2Y6TE 3FCBA 2DLEA 1ZT4B 4P9MH 2Y1VA 2OSXA 2TRHA 4GP4B 3W5MA 5EO1B 3FRPG 4G8EA 1JPTH 2ZYSA 2W38A 1NGWB 3CN0A 3BWUF 1U30A 4U1SA 5FO8B 4QHNB 4GW5A 1KTRL 4Y4HA 2ITCB 3WAJA 3KBPA 2X09A 1MCOL 1KNOA 5E2WL 5I28A 3QZMA 3W37A 3MYZA 2ED7A 2Y1ZA 3G08B 3SY6A 1JGLL 2JJUA 2EE9A 1PJWA 4G5ZH 1D7CA 3THML 5GGTL 1OTSD 2Z9TA 4GW5B 4Y4HB 5I1IH 1EA9C 4PMEA 3K0WA 3QQ3A 1E6JL 3CMGA 4KJPC 4R8WH 3QIWD 1TJMA 1JZHA 3QNFA 2MOVA 4O2FA 1A66A 4K5OA 5F96L 1VJSA 4XTRC 1CYGA 3F7LA 2HCZX 5FGCB 1YY8A 1T2QH 1U8OA 4XAKD 2AXGA 4Q97A 2CM5A 3QQ3B 4MQ7B 4QY8B 3LTVA 3ATDA 1FNSH 4NUGH 5BRZB 1KN4H 5JHDE 4UNVA 3JWNE 4PLKD 1OY3B 1CF8H 1YY8B 1PG7L 5IF0B 5I66B 3U2SB 3HHSA 2NY0C 3HCVA 1D2OA 5GZND 4PB0H 4FAAB 2FL5A 4QWWD 4B7IA 3IJ8A 1FAIL 3APFA 2OMYA 4MHHI 2PP7A 2ARWA 2OMXB 4FQ1L 3GXFA 1J8KA 2X2UA 3C8KA 4MMZB 4MBOA 3QYCA 4M93B 1MW1A 4AVJA 2VSDA 1KLGA 1OSEA 3GJFH 5GS1C 4HFWA 1M3IA 2XWBA 3FB7B 5H37H 4YFLF 5SWSD 3MRLB 3TT1H 5AAMA 2OYLA 1T0PB 2QBWA 2DLGA 3TFKD 1ACCA 3C8KB 4XMZA 4O2CB 3I75A 2XZAH 1XF1A 1UQSA 1DTUA 1G6RH 5E56A 4PIBA 3FO1A 3PG2A 5EOTA 5HHNA 5M95B 1H6TA 3EXLA 4HFWB 3IBOA 3QCUH 3O9WA 1S9YA 4ZFQA 2D0FA 3P9MA 4J3SA 1MDTA 2DIBA 3HZYA 1CD1B 5I73B 1A9BA 3MNZA 3O2DA 4FJ6A 4Y9FA 1DVXA 3I75B 3N41F 4WWKD 1I1YA 2BOCB 2MIZA 4JFXA 1UQSB 3CFNA 4N86A 2NXZC 1KIQA 5MENE 5CFAA 4ES8A 1NCUA 1S9YB 4QYOA 3BP4A 3P9MB 2BW5A 4X4XB 4L8CA 5A6MA 3HZYB 1U8MA 5HD8C 2Z31D 3MNZB 3C5JA 4D94A 3GWJA 1KMGA 5HY9A 3MV7D 3WFDH 4XO5A 2UUDH 3IJ9A 1G7MB 3LZOA 1U42A 3NJKA 4WUKH 1KIQB 3ZKMD 1MW0A 4IM8A 5ETUA 3A21A 1CYWA 4LB8A 2XG4A 2WVUA 4QYOB 3IDJB 2H2PD 4A2FA 5C0RL 3KDPB 1T0NA 1YJDH 3NUKA 4L8CB 1CGYA 3MC0A 3QJFB 3Q05A 3BSGA 5HY9B 4YUEL 4BGLA 3FPYA 2KYIA 1N5YL 1CB4A 1NOAA 2V2WB 2AQNA 2QPUA 1IGTA 3D39A 5ETUB 4TNWF 2XG4B 1WGVA 1ZVSA 1T0NB 1W6WA 3AABA 3M7OA 1OP5H 4POYA 1AZUA 1PD1A 4W70A 5AZUA 1K8DB 2E27H 2YKKA 3C5SA 4W9JC 1VKXB 5I6OA 1JUFA 5DJZA 1JGIA 2ED6A 2DQIH 2CKNA 5JORB 3D39B 3ARUA 1CLZH 1WBZA 3FHAA 1ZTXH 3VRIB 3LS5H 1ZVSB 3HFML 5HGBB 4BA8A 5IEHA 1I1FA 2WXNA 4HEMA 4OH2A 1TCRA 4OJAA 5DD1L 4Q2ZB 5LB1A 2D7QA 2P24B 1UCBH 1JUFB 3L3KB 4L1TA 5DJZB 2WNKA 2XV3A 4Y4HD 5F0JB 4YHNA 1HH9B 2K45A 1WBZB 3CX5K 2PPFA 2YXVA 4GKLA 3ZZQA 5MERB 3IJEB 3UEZA 4O9HH 3E80A 3VA2C 1TCRB 4P23C 5HHXH 3F62A 3OZ9L 3QE5A 1OTTC 3U0WH 3NYKA 3WN5C 3T08A 2Z65C 4OI8A 3NIGB 1UA7A 2GJRA 1OP3H 5DU7A 4APQA 2ATPA 1UT2A 4F92B 2FQEA 4TUJB 1RUQL 1AOZA 4HS8H 2DQJL 4TNWK 3AQDA 2YBRA 2Q8BL 3SYPA 1SHXA 1MFUA 1ZK5A 3H6AA 2Q86A 1KFGA 1V3LA 3QXVA 1WE5A 1URIA 3OR7A 1SDAB 4NJ9L 4ZO8A 1AHWB 1C5CL 2B0SH 1BBJA 1DSFL 1UG9A 4LLVA 5EUKB 4FLHA 5EO0A 5GS3A 5C6TH 1OZUA 4X0KB 2YBRB 1DQLL 4MWFA 4G9DB 2CZNA 4Z78B 3OGOE 4R26H 1E3FA 1GYVA 2QZQA 4G9FA 4ENZA 2WP3T 1H8NA 3M46A 5F1NB 5I5IA 1PZ5A 1BBJB 3MUHL 5E8EB 4LLVB 4Z3FA 1CFBA 3MBEA 3SQBB 4AX3A 3HMXL 4K3EH 3BKML 2DM2A 4MWFB 5E2UL 1CLCA 2PW2B 2AEOA 2XTJB 1R5VB 5DMIH 4G7QB 4LL4A 4G9FB 1S7SB 1UADC 1T03L 1OW0C 1J8SA 1F3DH 4FKKA 3DNKA 2YPKB 5AWNH 2A6KA 1I8MB 2IC2A 3LXBA 1SXZA 3WIHL 5JIMA 4W9HC 2CXGA 2FGZA 5FUCC 3RB5A 1XFPA 2BSTA 1BYOA 5EF2A 2G9KA 2NZ9C 5D1ZC 3UYOD 1BZ8A 1EVUA 3ML9A 4K3JL 4MZ3A 3GMRB 4LLYA 1A7RH 3EBGA 5J1AB 1F2QA 3ZQWA 4P2OA 2P47B 4PJIF 3IDYC 1TG8A 1AR1B 5CD5D 5IB5A 5DK0A 1G1OA 3TT3H 3EJYC 2EVGA 1XEUA 4NX0A 1TPXC 2R7EB 1NEZB 5IVXA 3PWPB 1UFUA 1ET8A 5D71H 3N40F 4LLYB 5C0DA 4K7PH 4M48H 3CZEA 3T5WA 1YNLL 4MCZA 4JGUA 4WU7B 3U2JA 2XZCH 3FQNB 3BPCB 4ORZC 3SPGA 3VM7A 1CC3A 3QA3B 4FNQA 2JI2A 3ZRSA 4AIOA 3GJFB 3VFMA 1RPKA 3ZL2A 1G6RA 4DEPC 4F7CA 4ZMNA 5KVDL 3LKRA 5LKNA 1JMXA 4FP8L 4NQQA 1BG9A 1YN7A 1Z3GL 1DL7H 2P5WA 3LZLA 3VACA 2J25A 2VLLB 1G6RB 3EH2A 4LKXA 1A4AA 3NZ8A 1KELH 3LKRB 3FW6A 1CQYA 2AERT 5KYYB 1PY4A 4TM9A 3F7VA 3FBKA 1GAFL 3VI3B 1C1EH 4OUUB 3D39D 3GPEA 3NFNA 5DJ0A 1KUMA 2WD0A 2CUMA 3CLFL 1I9JL 3JYCA 4G6AD 3KPPB 2Q7NA 3JSSA 3QYMA 4UOJA 1JZIA 5CR8A 3REVB 3LRKA 1EJFA 3F7VB 4AG4L 4PJHE 2Z35B 3D9AH 4QIRA 3MRBA 3VW3L 5DJ0B 5IFHH 1I8IB 4EN3C 1PIFA 2EYRB 3UTTE 1TU2B 2ADGB 3RFZB 3S5ZA 5EA0L 4Z7AA 5IG7B 3CFBA 5DD0L 4RMSA 3TBTB 4BFBD 1C7TA 2VDRL 5E7FA 4P2RE 4IK6A 3UJIH 3QWQB 3GSQA 3MRBB 3NFSL 5EDXA 4F2MA 1FZKB 3M7FB 1JF1A 1XF3A 1CU4H 4FLOA 4XHJC 2R29L 1JERA 1UXWA 1KXHA 3DV6B 3QG6A 1IAIH 1KLUA 4HJSA 4F8PA 3A67L 3A22A 3GSQB 1HDMA 2EVIA 1EZVX 1IFHH 3SBRA 1UXWB 3L6FA 5HHVL 1N6VA 4NLAA 4OCMC 4IIQC 2WXLA 2CK0H 3QG6B 3QNXB 4MNGE 5AEAA 4AYGA 3DURA 1TQUA 3WTYA 2X53A 4LGPB 3Q8AA 3TF7C 4KHXL 4WHCA 3NTCH 2OKMA 1PEWA 3WENA 2DM7A 1YYCA 2ZKXA 2XTJD 3QR2A 3NJLA 2XN9E 3ML8A 3PWLB 3X1GA 5TF0A 4G9FD 2Q2LA 3QBTB 3DJ9A 5FECB 3EHBB 2WWMC 3UBFA 4XPTL 5EEZA 1F4XL 1HXMB 5BJTB 4HF5L 4IKKA 4XXCC 3BAXA 2IH8A 1T1ZA 2UXVA 2H41A 3SGEI 1I3GH 4HKBA 1J0IA 4DKEH 2OXHB 3CVIH 4L3EE 1JGVH 1S3RA 3GMQB 2EDTA 5D5ME 4XCCL 1AR1D 4JO4L 4MSWA 1RPQA 5D72L 5HDQH 1QKZH 2DL2A 1GIGL 5JW4N 4XP9L 1GOFA 2I24N 4FADA 4QTHA 1DUZA 4NEHB 2PR4L 2XFGB 3PWPD 3NCEB 4PY7A 4U1NB 2VR5A 4HPOL 4W9FC 1JYWA 3BRFA 3W0WE 1F90H 2R2EA 1YNTA 1PSKL 1RULH 1I1AA 1B0IA 1Z9PA 4FLSA 4XXDA 1CURA 2YAPA 5FPIA 4QTHB 3HLKA 2CO2A 1DUZB 1Z66A 3VD5A 3VYNA 3ZHKA 5KSUB 1SYSB 3D25B 1I1AB 3N43B 4WGKA 4Z1PA 4WI8A 1CT8B 1WAEA 3MCKA 32C2B 3RWCA 3TJHC 1JMZA 3UBXA 2ZTBA 4BRVA 4TVSa 4LLMA 5L8LB 3FUDA 5ICZB 3OQ3B 4Z7VB 2YLHA 3MCKB 3MRFB 3NIDE 3WFEL 3WEXA 1QFWH 1XH1A 2P5WD 4AH2A 3TN0A 5DJ2A 5KSBB 1UKSA 1MUJB 3O3BA 3AREA 1OCWL 5F7YC 4P3CH 4QOKA 5DHDA 4QRSA 4BV1A 5KEZA 4R97C 1OP9A 1DDHA 1RZGB 2Y36L 4K5NA 4UQ3A 4LAJH 1GZPB 4WI0A 2RQ8A 4ZX3A 5IWLA 4J39A 3TN0B 3TEWA 2O61A 1KTCA 4FG4A 3QEUB 3VCLB 4R7VA 3EJRA 3GK8L 4QOKB 3ZO9A 5DRZA 4FI8A 5FV1L 1MCHA 2BC4A 1HOEA 2AEPL 2AK4E 2DB8A 3ULAB 2OMWA 5IV2A 5HPMA 4M02A 2E5EA 1SY6A 1FYTE 2ZAGA 5IMOA 4HULB 4WI0B 1SBSH 1PLBA 1E28B 1UZ8A 4YVUA 1E4XI 1QFOA 4JQXA 4LSRH 2AANA 1OPGL 1DBKL 1WWCA 3W2DL 5I24A 1L9TA 4KTGA 5DRZB 3DX7A 2OMWB 3FU0A 4UT6L 5HPMB 1SJMA 4LEEA 4LSSL 4AQ1B 4AJWA 2CGYA 2OYMA 3U1SL 1AQKH 3SDXA 2BWQA 3WLBA 1UZ8B 1QHPA 3D69A 1N3NA 4FXKB 3GBDA 5IMLB 3RGHA 5B1JC 3CX2A 3FB6B 5FGBC 3DX7B 3ZHFA 4TRPH 3N6YA 1EERB 2N0MA 3KG5A 3ME0B 5FDWB 1T7WA 1CXKA 5TPWH 3MN8A 5EHFA 3U6XA 3IAQA 5DWUH 3EYSL 4JHZA 3REWB 1N3NB 1U8HA 1MFNA 1EDHA 2H7WA 3DYOA 2X3AA 3NIFB 1OLZA 1GGIH 3FSOA 3STLB 1X9UA 4I1RA 2RMNA 1SVZA 2EXWD 1UACL 4CVUA 3EHBD 3O6KH 4KX7A 2WC7A 1T0MA 3O81A 4F57H 1U8HB 3EYQD 3IKCA 2EDHA 1CZ8H 2ZYIA 2JJWA 5AOMA 4QLWA 1Q72H 3W11C 2MTPA 2P3YA 1I7UB 3AW5A 4ZPVB 4HD5A 4KWUA 3ARRA 3POHA 4X50A 3TEUA 5FM5O 1T0MB 1MCNA 4LFHG 4PJ9C 2VLJA 4ZS7H 3FTUA 2QDWA 1TZIA 3IKCB 2P8PA 5JPNA 3TURA 3I02A 2I7SA 4UIMA 4IS6B 5DGQA 3CN1A 4KUCD 4JZOA 3WYRA 1FORH 1CN4A 3OKDA 4EBQL 1DBMH 3Q6GL 4Z7QF 3NIDF 4XH2A 3CFCL 1TZIB 2P8PB 4RH4A 3B2XA 4PRIE 1S7RA 4GRMB 5JPNB 4N8CL 2FH8A 2HMID 3F7KA 4WTZA 5C0NC 3WTWA 1NANI 3VNYA 4FG2A 4JZOB 4FA8A 4N1HB 2XTLA 2VISB 3RTQA 4ZK8A 1T1WA 3UBXG 1TVBA 1E4KC 5J11B 1SXSA 1G7LB 3NEEA 1I1AD 1S7RB 3EFOA 4GSRA 2QQLH 1I7ZB 3NN8A 5HI3D 4UBDC 1A4KB 1NKOA 5FEBA 1MQKL 1QLEL 3CFTA 1S7UB 3LSOB 4JZNA 1TVBB 3KLLA 1Z9LA 5E8DL 3IGUA 5DF0A 4JFYA 3F3HA 4KJWD 2YHGA 1AGDA 2WUBH 5JDJA 2ENJA 2Z8SA 2FBJL 4BDVB 1QFUH 1D6VH 1A4JB 3ILQD 1L6PA 2G60H 4JZNB 3TBBA 2R0LL 4FF9A 1HNYA 1AGDB 2GITB 3VGDA 4FQLL 3QQDB 4XPBL 1NCDH 2YOAA 4ODSL 2AVGA 1BAGA 3TN0D 4XPAH 5JR1H 4KKAC 2TSAA 3HC4H 1PLGL 1ETB1 4MKMA 4OZHA 4QOKD 3TOPA 4NQXA 1NGPH 4JN1H 1OSPH 1TQWA 1ADQA 4ENED 1TITA 2DWTA 2K78A 2VERA 1AHKA 2JB6B 1HWGB 1MCCA 5EIVA 1P84J 3AVEA 4OZHB 4J1UA 4LPWA 2ICWA 1AC6A 4YSRA 1YEFH 3K80A 3WIIL 3UG4A 1D5IH 1NBZA 2LU3A 5DLMH 5SX5K 2WKOF 3B9KB 1UWEH 3QZBA 4XCYA 3NVQA 3PDOB 4YBQD 1KGYE 4MD5B 5HI5C 2G9HA 3TJEH 4J1UB 2MKWA 3BEWA 4P57A 4YHKH 3GZPA 3MSPA 2R2BA 3S34L 1NKGA 3R1GH 1NBZB 4PQXA 1FNGB 2EO9A 2ZOKA 3QPQC 1ACXA 3DX8A 4JKPH 5I8EB 2BMKA 3UCRA 4PRBA 1W91A 1J1XH 2DQ6A 12E8L 4P57B 4CSPA 2BFVH 4C4KT 4DKFH 3R0MA 4HIXL 4BCXA 3UO8B 2R2BB 1IKFH 4U1GB 1FCCA 1XXFC 5F7NC 1OV8A 2H3KA 2ZOKB 5IHUL 4A7GA 1M6OA 4G6KL 5I6MA 1ET5A 1GC1H 3U1QA 2XQ0A 3QEQA 2B5IB 3MTXA 3OC8A 1CFMA 1FIEA 1YLBB 1TTBA 1HL9A 1HZHL 2DIJA 2OJEA 2RQEA 2EXSA 4W4OC 3DHJA 4KNQA 1J5DA 4WFFE 5GS0C 2HFEA 5JOPE 3GLAA 2I60H 4F7PB 1X5GA 1ZHNA 2EEAA 3EFDH 4I85A 2O26U 4B3VA 3QEQB 2ZUSA 2OJEB 4KGJA 1DJYA 3FU9A 4OCSL 1N26A 5CP3H 4WTZG 1JWUA 5GSVB 2D9QB 2OSLB 1X9LA 5DEFA 4ZNCD 2I85A 2NLJA 2WWOA 1ZHNB 4N8PA 4NM8H 2CGRL 2VLJD 4WO4A 3S35H 4AQZA 5FHAL 4Y5VA 1CL7L 3KJ6H 1GW6A 1VESA 4MNHA 1W0VA 3L5HA 1AXIB 4NP4H 1FC2D 1RUKL 3UBXI 3G6JE 3B6SA 1OARL 3LMJL 4ERSL 1O6VA 1Z9NA 5D1QE 4M7LT 1UD2A 1Z5YD 4Y5VB 5JOFA 1TTRA 2VZSA 4XP4H 2OR9H 3K5RA 5KYNA 1U3HA 5BQ7B 5GJSL 4RGMC 3OPZH 1RHHA 4MNHB 2JKLA 1T1YA 2EKSA 3VWKA 4KMLB 3V52H 3RTQD 1G9HA 4UDTA 4YPJA 4OIIL 4M1GL 5F7UA 4RAVA 4WIQA 3CH1A 3VFVA 4XN5A 4LPTA 4OM1H 3CFUA 2VSMB 2PCPA 4OFQA 4PJEA 5FM8A 4HUVA 1T1YB 2EKSB 3LRLA 4LKCB 2CHWA 3H2QA 3H9HA 3II1A 2WY3B 4DP1X 2UXFA 1USZA 1KB5A 3FN3A 1RFDL 3L08A 3DPDA 4RAVB 3CH1B 4E9TA 3RILA 5I75B 4LVOC 4Y88A 5EUOA 4OV5A 1OSZA 4PJEB 4HUVB 4PP2A 1A1MA 4TSBL 3IDNA 5A40E 3HZKB 5HXMA 3N5AA 1CDBA 1FJ1B 1KB5B 3BWUC 1EMTL 1HWWA 3C5XA 4NC2B 3OX8A 2QTVA 2DM3A 1KC5L 1JZEA 2A3TA 3VXMA 4M1DL 2VDOL 4OV5B 4X7SH 2PF6A 1A1MB 1U95A 2WP3O 1E9QA 2GJZB 3RZCB 3N1GC 1JP5A 2WIIB 4GO8A 5ID0B 2P42B 4AVIA 2XVLA 3OX8B 1IM9B 2J73A 4KI1A 2E59A 4OGXL 3J07A 2Y06L 1KCUH 3JWOC 3ZT5A 1U95B 2HA1A 1E9QB 3B9KD 4EDWL 1TQCB 3SIKA 1FO0L 4ZMLA 2BIQA 1T5WA 4MXWH 4HMDA 3VD0A 2A6IB 4FQQB 1U58B 1WZ1L 5AW1B 2YQ2A 2HWZL 3GSOA 4F8QA 1ADWA 4EIBA 4F27A 4AEHH 4YIQB 4YSQA 4HS6A 5GRJL 1WBYA 1N70A 1HHHB 1SF3A 2AEWA 3TTYA 1ZANL 1TEFA 4PBDA 1O75A 1LK2A 1E5ZA 1Q0XH 3CHSA 4X5RA 3KCPA 1JBJA 4M6MH 1CICB 4Y1AA 3GSOB 3LDBB 2XG5B 4GKZB 5GIRA 1R46A 4U6HA 4TULH 4HS6B 1WBYB 3WFCL 3OKLA 2DRUA 5F7DA 1FIGH 1A7OH 4NKQB 5AENA 2Z4QA 1E0OB 3M6DA 4Y1AB 3ALPA 1F4YH 3D4GA 3FCSB 5DVNA 5GIRB 2PW1B 3RL1A 3L3OA 1CLOH 3IFOB 1NGQH 1UHVA 3BPOB 1NCWH 2R8SH 4WUUB 1Q0YL 2F2HA 2FQFA 3BGFC 4HS3B 4UOZA 3OKLB 3V4VL 3QEQD 5BZZA 1VACA 3SODB 2X05A 5DWPA 2ZF9A 3ZE0B 4HW6A 4G59C 3MGOA 2V7HA 4QRPE 3U46B 2YUWA 3L3OB 4HHAB 3D4ZA 1HOCA 5BV7C 5GZOC 3OKOB 1WDAA 3GD1C 4G8AC 2OMUB 4FX5A 3RZCA 1QYGH 4FQCL 5J8OA 1GS7A 3RVTD 4QNPE 2GTZB 5FA3B 3V0HA 2BJML 5I1CH 3CFKB 3QAZB 2EH8L 1AD0B 3S36L 1UWYA 5E51A 1UM5L 1C16B 4PJGF 2V7HB 2VYRE 4A2DA 1UGNA 3V79C 4KRMB 4I89A 2J12B 3QWNA 5IB4A 3EJZD 1NGYA 3LRMA 3U6RB 1N18A 2R69L 1O5PA 3FTGA 2Q3ZA 2Y7SA 2CIKA 2IPTH 2X4RA 4HXBH 1QWHA 4DEWA 1M6UA 1F6AA 2HG5A 3SKJL 4V1DA 1TXKA 4RAUB 4FOMA 2ZOWA 3T65A 4AITA 1XCXA 4PMFA 5EZJA 3V6OC 1BECA 1FZMB 2BOLA 3HG0A 1LO3L 4X83A 1CE1H 3MJ9A 2BOBB 4URKA 3TV8A 3M8OH 3VWKD 4KZ0A 3C9NB 1QEXA 1F6AB 1OP4A 5TTRA 1BEYH 3ZMNA 1EAOA 2W94A 3LJ3A 3RDTA 1S9XB 3WDIA 5FM5M 1A3QA 2YXWA 5E1HB 3BSZH 5CZVH 1LWRA 2O72A 3F04A 4LQ1A 4NT6B 1IJNA 1FVEA 3MJ8B 5DSCA 5IHBA 2WLIA 4Y19E 3RJOA 4B9IA 1MRDH 1JPSH 1VPOL 2G5RA 2QEJA 2AJYL 3Q8FA 2D3LA 3Q8EA 2W9DH 5KOMC 5TF1H 3RNKB 3ZLQC 4GQZA 4NWUH 3T6WA 2EZ0C 3KL5A 5C7XH 2ICWI 3PP4H 5IROA 5DHVA 2FWSA 1WO2A 4IDJH 5DSCB 3RZCD 3D08A 5FYKE 2XWCA 2FSDA 1HKFA 4WAFA 2BP3A 3SO5A 2EYTB 4NENA 5ITBH 2ZX7A 2VRKA 4HUCA 4A2GA 4H0HB 4DK6A 4CC0A 5IKCA 4AEIL 1F8TH 2VDQH 4NRZA 3BEVB 4BA0A 4WJ5A 1AACA 4R90L 3VXOA 2B2XH 4AQOA 1RZKH 4QLRA 3PUUA 2J3SA 2NYYD 4Z7UB 5IKCB 5CGYD 1TVDA 1RJLB 1XGYL 3UIYA 4UB0L 3BN9D</