5EEYA

Radiation damage to the trap-rna complex: dose (dwd) 11.6 mgy
Total Genus 11
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
11
sequence length
69
structure length
69
Chain Sequence
NSDFVVIKALEDGVNVIGLTRGADTRFHHSEKLDKGEVLIAQFTEHTSAIKVRGKAYIQTRHGVIESEG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Transcription attenuation protein MtrB
publication title RNA protects a nucleoprotein complex against radiation damage.
pubmed doi rcsb
source organism Geobacillus stearothermophilus
molecule tags Rna binding protein
total genus 11
structure length 69
sequence length 69
chains with identical sequence B, C, D, E, F, G, H, I, J, K, L, M, N, O, P, Q, R, S, T, U, V
ec nomenclature
pdb deposition date 2015-10-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02081 TrpBP Tryptophan RNA-binding attenuator protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.50 Mainly Beta Sandwich Immunoglobulin-like TRAP-like 5eeyA00
5EEYA 3AQDA 2ZP8A 3ZTEA 2ZD0A 1C9SA 5EEVA 5EEXA 2ZCZA 5EF2A 5EF3A 1UTDA 2EXSA 5EEUA 1GTNA 2ZP9A 5EF1A 5EEWA 4B27A 1WAPA 3ZZSA 2EXTA 1QAWA 5EF0A 3ZZLA 1GTFA 3ZZQA 5EEZA
chains in the Genus database with same CATH superfamily
3MTXA 1WC7B 2NNCA 3WE6B 1DVFD 1FC2D 4JZJC 3PWJA 3U6RB 3AJ7A 1AYRA 3ETTA 2UUDK 4U4BA 4F8OA 2E7LA 3MACL 1MIMH 5BRQA 1Q9WA 4GJTB 4J1UA 4OFKA 5EOCH 1EEZA 2VLRB 2RMNA 1YA5A 2OL3A 3WOVA 4FL4C 2R1WB 4I0CC 1NCDH 3NG5A 5F7WC 2BRRL 4QY8B 4YIQA 3MTRA 5K9QI 2WLZA 4G9FA 35C8H 3CIQA 5EO9A 3O6ML 3TVMB 5E94B 3G6DH 3BIKA 1GHFL 4O51B 3WY4A 1MFNA 1D5BA 4HETA 1CFVH 2OK0L 1UH3A 5ICUA 4WHCA 2BP5M 1NWOA 3F7YB 1KJ2H 1UASA 3V6ZB 3DUUB 3EH4B 1ED3B 5DXWA 2R4SL 2QLYA 1D9KC 5J12C 1URZA 4ZPTA 2CGRH 1PD1A 4FQJH 3HI1A 5ID1A 2DQTH 3C6EA 3Q6GH 4JKPH 3TU6A 2R27A 4MJ5A 5KYXA 2HT4C 3V52L 3O8XC 3FT0A 3PRZA 3OKMB 1CK0H 3FTUA 4M93B 4PJGE 3VFGL 4ZMWA 4XCFL 2E7CA 2E6JA 1T0NB 4FQXB 5K39B 4HF5H 5I24A 4NQEE 2ORBL 4E5XA 1AGFB 1AQDA 1MKFA 2PUQT 5AYUL 2P8LA 3IRPX 3UDWA 1DBAL 2IBZX 4L8DB 2W92A 1GMEA 4ONHA 5FYLH 4Z7QF 1BFSA 1MJ7L 4NERA 3WO4C 2A73B 1IJ9A 1F4XH 5C0DA 4K5NA 1BQKA 4LPVA 4GSUA 4ZUWA 3VU1A 4PR5B 4PRPB 2A7BA 2NY1D 5DURB 1JWMA 1KPRA 5DGQA 3UYPB 1P7QA 4AUYA 1YEDA 1RQ5A 2AK1L 2YD1A 1K9TA 3VRJA 2J4WH 3IN0A 3K2UH 5JPNB 4IBWA 1KENH 2JQZA 3MBXL 2MQGA 3T71A 1S7SA 1U2CA 1HE8A 3HAEB 2WTRB 2OXHB 1D5XB 2XY1A 2NZ1A 3FTWA 5FKAB 5JO5B 5J6HB 1KB9J 3BPLB 1I7UB 4UQ3A 5K93A 4CSZA 1GY1A 3QUZB 1NBVH 1HNYA 4GBXD 5M95B 2EYTB 2ALAA 4JRYA 1DYZA 2MNUA 4MMZA 1KYAA 4XP6H 3O41A 5HPMB 5KWYC 4UIMB 3NIFB 1SLWA 1DFXA 3FB5B 2I5YL 2EE3A 5FO9B 5ISZB 2F1EA 2Q8AH 4UM9B 4OF8A 2W07A 5IQ9A 3I9PA 4M6ML 4PTUB 4FTVD 5D5MF 4ZMOA 3ZE2B 2ID5A 3BDYH 2CCLA 1NC4A 1RZJL 4UWQB 2W80C 4FEMA 4H4NA 1C12B 4PWGA 5IHBA 1FG9C 3PYCA 3ZW3A 3QDMB 5JIPA 1INEH 4KUZH 2NNXA 3QRFM 2AZUA 4H2AA 1AGBB 3GMQB 3QHTC 3AABA 5FB8A 4XMUA 3WUZA 2BO0A 4RWYL 3TYFA 1ILSA 3B2VL 3TA3D 2F7RA 4LP4A 5L4JA 1EFQA 3D1MC 4JFYB 4PW9A 2XG5A 2XLLA 3FAXA 2H0JA 1NBQA 3OWEA 2NR6C 1U93A 1E27A 1LWRA 4L3CA 1U3ZA 3MACH 1PPIA 3PP3H 4PJIF 2AP2A 1DTUA 4Z7QE 2PCFA 2HJKB 2DDQL 1I3VA 4HEMA 2O61A 1FV1B 2P80D 4S2SB 4U1IA 5IB4A 4J39A 1N6UA 3OX8B 2J12B 1ND0A 2F18A 2XWJA 3LRSB 2HMID 1Z3RA 5I76B 1LO4L 1A8ZA 1NZRA 2BRRH 1VFAB 1ZWIA 4Y1AB 2AXFA 2ED8A 3O6MH 2FSEA 4C4KO 2ESVE 4EQ2A 1TYJA 1GHFH 4APXA 3LXBA 3VWJD 2J8OA 2OK0H 3MRLA 3RUGA 3WFBL 3SE3C 1JFHA 4N24A 4NKQB 5IJBC 2VC2B 2R4SH 1GJIA 1U41A 2A9ML 2SEBA 3W0WA 2GSIA 5C6TH 3A3YB 3GKZA 4AIZA 3L48A 5FM5M 5DUBA 3QAZC 4J3BA 2YSSB 4FQPA 3TT3L 4YDLC 2ENPA 1R3JA 3RJQB 3TEXA 2CWRA 3V52H 3AAZB 2BSSA 5EC1B 1MCOL 3C6LA 3ULUD 5D5ME 4HEPG 3GTTA 2XHNA 3UBXI 1TJHL 3VFGH 4WI3A 5D9SB 5EEXA 2BMKB 4XCFH 2GAZA 4PRHD 1UVQB 3AB0C 2LU7A 2ORBH 2DQCL 2Z31A 3BGFC 2B77A 2OTPA 2A83A 1RPUA 2HPOA 4X6EA 2JCCF 1D7DA 2PO6D 2IALA 1DBAH 5F7DA 4K71C 1MJ7H 1N0LA 4QRPE 1I9EA 4H25B 5I6LA 5JYMA 2AEQL 3OKKA 3D3VA 2K6YA 1M71A 2FIKA 4HK3J 5EFIA 2W65B 4OZFH 2JI1A 1TQWA 4P2QD 1KBPA 1CDGA 5IG7A 4PJIE 2AK1H 2YGVA 3T09A 1G9EA 3G7TA 1KYOK 2EE9A 5D7IB 3LXAA 3MBXH 1AMXA 2NXZC 5EZJA 1OCOB 2IBGA 4JHBA 1HHGB 5CJ8A 4IU2A 3CN4A 1F4WL 2Z7WA 4FGMA 4WEMB 3VGDA 1IGTB 4X5WB 1NCCL 1U2HA 2C7UA 5F7AA 3U0PB 3EFOB 7CGTA 1NIEA 1TOXA 3VWKB 3F12A 1DBML 2HT2D 4N22A 4PRAA 3WHXA 4MJ6A 4ZO6A 3X12A 3ZGIA 3FZUC 2K7PA 4NPKA 3VA2C 3O3DB 2B4CL 3GGWA 3O0RL 3WKQA 3B7TA 1CDBA 1MW2A 4FZEL 4H1LB 2G30A 3EKCA 4Y89A 1AGEA 1QSEE 3MRMA 5FDYA 2GJJA 4NKIL 3T0EA 3QK0A 1PQZB 4R8WL 3KPPA 5C0IA 2I5YH 2JKLA 3ILQD 4B9PA 1NFDA 1HE7A 2AW2A 3QFDA 4M6MH 1OLZA 3BQUD 2IPTL 3MJ7A 4YAQA 4QHKJ 5LBSA 3SDDA 2DZEA 3DHPA 2DLIA 3D06A 4RIRB 3FTGA 4A67A 2YPKA 4XXDA 3UROR 3HC3H 4OGQC 4ZW7A 4BDVB 4PJEB 1R3IL 4MJ4A 4LKCA 3PL6B 4FG4A 4CBPA 1FSKC 3NBNA 1ZLUH 4TVPE 5KJRL 4RWYH 3B2VH 1T2QL 5KS9B 2YRBA 2G5BA 2Z92B 3F6LA 4L1SA 3ZLQC 2JCCE 2V2XB 1YEFL 2I7OA 3UZQA 5KUKA 3BKJL 5H35A 3EO1A 1FNLA 4NENB 5E8PA 4GG6F 3EDJA 2DDQH 1ZS2A 1MNNA 5C0JB 1A1OA 5LBGA 5JXEA 3TO2B 2Q20A 5E9DB 3UBXA 5HHPA 1F11A 3BP6A 3WNLA 1KB3A 1IBYA 2K7QA 5LJYH 2X2UA 3RWFA 3GM8A 2F5BL 1P69B 4N3TA 3HA0A 5DEFA 3BP7B 1WWWX 4RAHA 2Y7OA 1Z6JT 2L7UA 5LG6A 3PREA 5DJ2A 1UC6A 2ARJA 3KYMA 1OEZW 4QXVA 5J13B 4RDQF 5DCCA 4ZDHA 1XT5A 3L4ZA 3N0AA 3FQRB 2HFEA 3P11L 3ARED 4JJ5B 3WFBH 1OSYA 4FQXC 1TJIL 2H3KA 4UZGA 3BEWB 1DL7L 2VSKB 3LZPA 3B2PA 3MV8B 3PAZA 4Y19D 3H55A 5E08L 3CFJB 1DANU 2A9MH 2UWEF 3OAWA 4OT1L 3UAEA 4QRBA 2AXJA 3CD4A 1F1DA 1A6VL 3UTTE 1M7DA 3TT3H 5MENE 3O6FB 3FCUB 4KI5F 1D2OA 4M8RA 1JZJA 4B6ZA 4PD4K 3RWDB 1MCOH 4UM8A 3QJQB 1TJHH 3KXFA 1V54B 2B5IB 1IAIM 1DJIA 3EG9A 5DVMA 4HKXA 1T7XA 1UD8A 1HILA 2DQCH 4NAJA 4MA8L 3FT3B 4N6RB 5JPNC 25C8L 3UERA 1GYVA 3I6LD 1TCRA 5FO7B 2HLAA 2O6CA 4Y5VB 1OT4A 1QACA 4ZQKA 4KKCC 1JMZA 3BPLC 4FNPA 1BJ1J 4QTHA 1OTSD 4ZSOB 2AEQH 4KTEL 3QUZC 1N5YL 2YEQA 2J8UF 1N9PA 3RU8L 1KB5H 1BX2A 3QUYD 1IILE 1DUZA 3U1SH 1BMGA 1QFOA 3PP3K 3TNNB 4D2NA 3BO8A 4GG6E 1A2YA 4F7MB 4ACTA 4K73A 4NQQA 4HS8L 4A7UA 1F4WH 3NOIA 4X7EC 3FU0A 3QO1A 3T3MF 1NCCH 3N5AA 1DBMH 1A4JB 1TZIB 4YDVB 4WWID 2UX6A 2B4CH 3O0RH 3FPXA 1D6VL 2C9VA 4OZIA 3LIZH 4FZEH 4X8JB 1FLTX 4L4TE 4PJCB 4CU8A 4NKIH 2YD6A 3LPOA 3GJEA 4R8WH 4HIQA 3TL5A 3DX7A 3W11D 4WDIA 5SWSA 4D3CL 4D7BA 2X4TA 3LRHA 1IBGL 2IPTH 3DRTB 4X83A 4BUHA 4P4KD 4H8WL 2UWEE 1OGAB 3AT9A 2KLTA 2MTPA 4FJ6A 4KI5E 1R3IH 2FH8A 1WUNT 5I8OL 3IS0X 3LTVA 1NGWB 1QLEL 2C9PA 2PN5A 2AEIT 3MRGB 4FFZL 3SE4A 5CD3B 4MA1B 4OZFB 5KJRH 1AZZC 3DYPA 2OMWB 4LLVB 2AF2A 5BW7A 3KH3A 4XP5H 2QR0A 1NC2A 5J57B 3ALXA 1YEFH 1ITBB 1FHGA 1BD2B 4PBDA 3BKJH 4LF3B 5I0WA 3GI9L 1BREA 4QKTA 2BY0A 2G0LA 1RJCA 1DZBA 4UOJA 4WTZA 3WKML 3VFWA 4WNSA 1U8IA 4FYRA 3SDAB 2J8UE 2ZUQB 4J6IA 4Z7WF 1G9NL 4KUCF 4QXTA 1WWCA 2B1HH 4ZO7A 3RDJA 2WM0A 5C0BE 3TCTA 2VWEE 1W8OA 1KBKA 3IB4A 3BH9B 1ID2A 4OCXL 1W0WB 7TAAA 4LVNB 3HG1D 3T3ME 5H4ZA 5B3NA 1E5AA 1YAIA 3P11H 3MRKA 1BIIB 4NBZB 3WY2A 1KNOA 2I85A 1TJIH 1DN2A 5D4QA 4LOEA 1DL7H 1UACH 2X9XA 4GW4A 3EO9L 2W5PA 5CAYB 5E08H 3ILPA 1LO2L 1GMIA 1EGJA 5FAAA 4OT1H 1D3CA 4EI5D 4GRLB 4OUOA 4E0RA 4FFYH 4YNYA 1A6VH 5JLZA 5GS2H 3IXTB 2BWQA 3SKOB 4Y9FA 2XYBA 2BVQA 2Z8WC 5DJCA 2CHNA 4P5SA 1J5DA 3KBFA 3F83A 5A2JH 4GKZB 4JFOA 3HHSB 3FO0L 3D50A 5AOLA 3CDZA 5K9JL 1I1AB 2ITFA 4MA8H 4P8QA 5LCVA 25C8H 4J4PC 5EHFA 3SQRA 4IHOB 1NGZA 3MLRL 3FCTB 1ZLUK 4DKAA 3CFEB 3VWKC 5DGRA 3BYYA 3E6HA 4P46A 1ETZA 1U8MB 4OCMC 2DEXX 4MJIE 5BXFB 3L3KA 4KTEH 1TPXB 1N5YH 4A7VA 4JGUA 4M3JA 3RU8H 4LPUA 5E2VL 5GISL 1A6WH 3ZTCC 3WUWB 1F97A 1E50A 5CJ5A 3QQ4A 3HIZA 1T5KA 2WQWA 1HAUA 4HS8H 2VSMB 3QHFH 3MRBA 1QBMH 2WXRA 3IETA 1NCNA 4GRWH 3QFGA 4F80A 5F2FA 4URTB 5E8EA 1UT1A 2X9ZA 4GS7B 1U8OB 2B7DT 4OKVA 2Y1AA 1D6VH 4P5MB 3PWNA 3BLPX 2GKIA 3Q0HA 4G7YL 3UO8B 3PL6C 3QDHA 1ZVSA 5C0EA 1T5XB 2DW5A 5T3XD 4D3CH 2KDGA 4CW1A 1BECA 2J5LB 4KROB 2WLLB 1F41A 3X3FL 2C1OA 3QULB 3NAAL 5DI8A 3UCQA 4EEEA 4CU6A 3CVBA 4AGNA 1JK9A 4H8WH 4HGMA 3AREA 5I6MA 5C6PB 2DWSA 4JFPA 2APWA 4NO0B 2XZQL 3RWEA 1TTGA 4MNGA 3MOAL 5IB5A 4ZTPL 5AVUB 5I8OH 3ARGC 3GMPA 1FO0L 3GRWA 4CN1A 2BY2A 4FFZH 3PF2A 2JJSA 4EDXA 1R5WB 1OLLA 1M1XA 1RK1B 2VMCA 2HLFD 2WB1A 4L1TA 3VU2A 4H0GA 3FDWA 4N68A 1G7HB 1GA2A 3OQRA 2OJZL 3ILDA 2RALA 3DRQA 4ODXA 4JDEB 4Z3JA 3GI9H 4JY6B 2ICWB 3GSXB 5J13C 4TQHA 4FA7B 1VRSA 2IH8A 3F7VA 1BVLA 3QUMA 3GXPA 2XWDA 4PJ5D 3VXRD 1KTBA 3HE6B 3GRBA 4KK8D 4O02L 4TVPL 3VXUD 2PYED 1ASPA 3CVHL 2CRZA 4OI8A 1G9NH 2YRZA 5CEXA 4TULL 4OCYL 5FUZL 3CVIH 3O6FC 4OCXH 4CSPA 3H54A 3L4YA 3V7AG 1ZT1B 5TJWK 2ZG3A 3MRDA 2NY0B 2BIPA 2DH3A 3TCLA 1X5LA 2B5IC 4XMXA 2X6UA 4ABUA 1IZKA 1UXLA 2CR0A 3EO9H 1LO2H 3L7FB 5IMMB 3CVDA 2NXYD 2EIZB 5L2JA 5I8CA 2F7OA 3RAJL 4O4YL 4ADIA 1RLBA 4J28A 4Y5VC 4TL4A 4O2FB 3O4OB 3NN8B 4W4OC 2DN7A 3BKYL 4JFDA 2EE0A 2VITA 2UYLA 3P3SA 2P8MA 3W39A 1PX3A 4W9KC 4WI9A 4OF6A 3WLBA 4JRXA 3WFEL 1HHIA 4D8OA 1KCKA 3FO0H 1B2YA 2AV7B 5K9JH 1MHPL 2AJZB 1MCLA 4NKMA 3AUWB 4WHDA 5FW7A 1QTSA 1B88A 3SY0B 3V0HA 2MCAA 4WNQB 2CKBA 4PS4L 3DUSB 1I85C 2IWEA 5ESVB 2YAOA 3MLRH 1AXSA 3IJ8A 4P57A 3SZKC 1XR9B 5CLXA 2ITDB 3SPGA 2AXGA 4POZC 4X8CA 4RGNE 4I0PB 4GINA 2GITB 1NMAL 5HHOE 5LNEA 5E2VH 5GISH 3HUJB 1CLZL 1ACCA 2DMCA 2VIRA 3D0VB 3SDXF 3VI4F 1DQQA 1SJVA 1W8EA 4H0IA 4YZFF 5L8JB 3FQNA 1DSFL 3EJYC 2VYRE 2MPAL 4RESB 4HD5A 4M6OL 2QELA 2YD2A 2X05A 1KBWA 1TTRA 4F7CA 1MDAA 4KX8A 5DUJA 1P53A 2R1XB 3AQZA 4LCYB 1XGTA 1E4KA 3LB6D 1DSWA 5JA9A 4BYHA 3FCBA 4G7YH 1T5WB 4NO5A 3KBHE 5AG8A 4HHGA 4NNXA 4L23A 4PJ7F 4MA1C 3HEIB 5DO8A 3X3FH 4B97A 2ZWNA 3NAAH 1TZHA 1NCOA 3CHRA 4HOWA 5IY5B 3RZCB 1T66C 1KXVA 2EXWC 2WBXA 2GSGB 3IAGC 4ZMZA 4JY4A 4G6AD 2JKJA 1P0SE 1FL3A 2AQNA 2XZQH 4RVBA 3MOAH 2SODB 4UAOB 2FWUA 4P59L 2BP0B 2CLVB 3NMEA 2Z4TA 2WCPA 4GKOA 5D70L 4ZTPH 3J8F7 3SDAC 4MRCA 3D51A 2CBPA 5GS0C 4FCAA 5KBPA 1QR1B 2ZUQC 2FB4H 2QQNL 4TTDD 2IGFL 4E2OA 4AX3A 1R34A 2H45A 3S48A 3MUUA 2OMUB 3C60D 5ETUB 4FE9A 4ZUSB 4IJ3C 2OJZH 1Y07A 2DQDH 1WA1X 3OMIB 4LSQL 4LVNC 4KMLB 4LNRA 1SXNA 4GRWB 1E9OA 1RZJC 4CMHB 3F04A 3FQ1A 5D2NE 1E30A 2DQIL 4O02H 4PJAF 5GZND 4TVPH 3GXDA 3TZVD 4DO5A 5FW8A 3CVHH 3SDCA 3ECWA 4BHUI 5JW4R 4RRPM 1GKEA 1Z9MA 2BCMA 4JGJA 4TULH 4GRLC 4MA7L 3SDXE 3TEYA 2XDHA 4OCYH 5FUZH 3VI4E 4M1CC 2Y7MA 2D4DA 2OMZA 3MLXL 3VTAA 5EUOA 1M6OA 1PD6A 3MLWL 2J7LA 1KELL 4YZFE 2E9GA 2KQNA 2NX5D 2FWOB 3VYNA 1RZ7L 4HJ0D 4EUPH 2X89D 1QW9A 3EHBD 1AHWA 4NQCE 5F0PB 3L16A 3B7SA 4ISVA 5SV4A 5LN8A 1DQKA 1I1AC 5I6XB 4U6YB 1BZ8A 3S4SB 3FQTA 1ZHBA 5F3HB 3QFJA 1O6TA 3QEQD 2K4AA 2B39A 4O4YH 4F92B 3M17A 1D9KD 1PG7L 1QLEB 3TNMA 3O3EA 5EBWA 2VE6B 1TQUA 3M88A 4PJ7E 1IAOA 5F1IA 1NFIB 3BUPA 3OKLA 4ESKA 4UOW1 3SKJL 4A04A 2CLRA 1TPXC 3QARA 2XTSA 5CO1A 3WFEH 3JZYA 3V0VA 5BZDA 4HK0A 3V4LA 5EU6A 3QORA 3Q5OA 1NEZA 2AAVA 2FX7L 1XIWB 1MHPH 2EE6A 2VZOA 1AKPA 2H5UA 1RH8A 4MHHG 1C8PA 4LCWB 1T04A 4PS4H 2ZOKA 1EMTL 8FABB 3BVNA 2XKSA 2P4AB 3VM7A 1U8QB 1PZ5B 3I9GL 4X5QA 4MCZB 1X4YA 1XDTT 5HGAB 2ZONA 3FOMA 3DTXA 2L4OA 2FZ3B 4GS7C 4BRVA 2R29A 5D7SL 3QNFA 1CLZH 3APNA 4DCQA 3ZKSD 4P5KB 4AM0B 1DQLL 1H15A 4RSVA 4XT1C 4IBYA 3PXLA 1LK3L 3CTTA 4PJAE 5E5MA 2J5LC 3EOBB 4KROC 1JGIA 3EH5B 2MPAH 3VRLF 3HJ0A 4UANA 3PDGA 2ADFL 2H26B 4M6OH 4N0UA 3HMXL 5IBUB 4LRNL 4EI6B 4WFGD 3L7EA 3JVGC 1H3VA 4YSPA 3ZRCC 4OQ1A 3GSQA 1S7TB 1HDMA 1R3HA 4MCYB 3ZRFC 4E42B 3BZFB 1MH5B 4B27A 5I2IB 4A2HA 2NUPB 4FXGA 4MKTA 3U2IA 3OHXA 2NMSA 5JW3L 2ADJA 2E7DA 2CU9A 1L0QA 1NSNL 3GTVA 3IKCB 1QAWA 1UM6L 4QRRE 1W91A 2W9EL 1H3UA 3JV4A 5I23A 2VXVL 1LGVA 3R7QA 1M7IA 3UADA 1OAXL 4KRPB 3P4MA 4P59H 3VD9A 3HE6C 3NSFA 5D70H 3KM1A 2B4CC 4DPRA 2X1OA 3DIVA 1FFRA 2QQNH 4DK3A 3ECBB 2IGFH 4KV5F 2YARA 5AKSA 3ZKXC 3IFLH 5FIEA 1X5FA 3WEBA 2L3BA 3FOLB 1Q4NX 2DYPB 3QQDB 1Y6NR 4G7SB 4XMZA 4C55A 1ZEAL 5LGKA 4IRSB 4H8QA 4LSQH 3MGOA 4RNRA 2NY0C 4PHZA 2IFFL 3L5IA 2A6IA 4GNKB 2DQIH 3KW8A 3HG5A 3BJ91 3FFDA 1HWGB 2PCXA 4CSSA 1GH7A 3IN2A 4K5PA 1X5JA 1J9RA 2EDHA 3ATAA 1CD1B 4G7RB 5AW5B 5GIRA 4ZFOA 3EFFA 1C7SA 2ATPB 4MA7H 5F70A 4AW7A 1UJ3B 3T2OA 2UXVA 1BZ7A 5C08B 3VFVB 2FAUA 3LS5L 3MLXH 5BPPA 2VMEA 3D4YA 5D7LE 3MLWH 4JQXA 3O4OC 1AD9B 3QJSB 2FEJA 1KELH 5B1JC 4DHLA 2OMYB 1RURL 1RZ7H 3DTDA 1A5FL 3VRLE 3LN4B 3WMPA 4PBXA 4JG1L 1T4KA 3QUKA 3QWQB 5SWZA 4ZK8A 3FB7A 3NCMA 4XXCC 2ERJC 3LXUX 5DJAA 3ARFA 5DR5L 2G3ZA 4I13B 1FO0B 3BUIA 1I9IL 1PG7H 1SOSA 1QFWI 2YXWA 2OX5A 1IJNA 4JFHD 4X6CA 1F4HA 3KM2A 3HPLB 3EJJX 4G1MB 2CIKB 1FYTB 1KTRL 2YS4A 3SKJH 2DL9A 1DVZA 4I0PC 5IJVA 5IF0B 1NGXA 1YN6B 1I75A 2F2HA 1XF4B 3BD3A 4EKJA 1E0OB 2G2NA 4M7ZB 4PRIE 2FX7H 3CNKA 3X17A 4P2OB 3GRGA 3KVQA 1MG2C 4AEEA 1USZA 1EMTH 2WW8A 4O02B 4DN4L 2ZKWA 3DVGB 4F20A 3I9GH 3GINA 1N2RB 1QRND 1U8PB 1SEQL 4LSTL 4KV5E 5C0GA 5CEZD 2QJDA 3GEWB 1WHPA 4RH4A 1GJUA 4WENB 1PYWA 3W2DL 1JPGB 4AH2B 1Q90A 4GUPB 5D7SH 5DFVD 3WLWC 1Q9KA 4AW4A 2AMUA 1LD9B 2MWCA 3PXJA 2Z7YA 2ZUVA 2R7EB 1NKRA 3AT8A 1CN4A 1M4KA 4L8SB 3QXAA 4PSPA 3ABKB 4QYOB 3RG1C 43C9A 4EUPB 3CDGA 1DQLH 2ED9A 2GJZB 3OD3A 4L4VB 1M42A 3QJHA 5I8KL 1G84A 1LK3H 4JZJA 5EIIB 1C08B 3QDJD 5ELIA 2H8PB 2NXZD 1TO4A 2ADFH 5IB3B 5I30L 4RWHA 2TRHA 1X9QA 3NCXA 5F3BB 4RX4A 3RZCC 3HMXH 1MW3A 3VW3L 2L8AA 4LDOB 4OAWB 3V8OA 2BOBA 4WI8A 1QLRA 4G42A 2DMHA 1UYWL 2YD3A 3KDMB 4LRNH 3FZUD 4YSCA 4NQTA 4Y4FC 4UAOC 3MFFA 4HSQA 4NUJB 2XPYA 4DO6A 2KI6A 1IC4L 2HUEA 1OTTD 5HYSG 1ZHKA 4QHMA 2YBRB 4FQHB 4GKNB 2XWRA 2PW2A 3MYJA 1QSFB 3QQXA 4M61A 2YHGA 2VLKE 3SQOL 4XVOA 3BP4A 2FQGA 1VERA 2F8XC 5JW3H 2O1AA 4NZTH 3SPVB 1NSNH 2EDEA 3MRFA 4NAQA 1UM6H 5DMKA 3APDA 2W9EH 1IEHA 3GEFA 4UOZA 4FF9A 1VB9A 2V17L 4L2LA 5IVXB 3ULSB 1TSRA 4LCCB 2W0PA 2VXVH 5DD0L 1OAXH 2VXTL 4CMHC 3MGTA 3TJHD 5CGTA 1PL3A 4L18A 1I8IB 3TFBA 1AJ7L 1RK0B 2F68X 3UTSD 4AVKA 1E5BA 4NO2A 1IEBA 1N19A 3B7YA 3IMVA 3HZYB 1U95B 2YPLB 3MRPB 3KEDA 4WI0A 2C1PB 2OJEA 1OHQA 4JFTA 3O8XA 1E8ZA 1FNEB 1ZEAH 4HIXL 3QR1A 5HI4C 1UENA 4WJ5A 4YPJA 3WFHA 1N59B 4GXFA 3CG8A 4H8WC 2IFFH 4MZ3A 4XMVA 3TVMD 4DJMA 5CBEB 1JXFA 2QSTA 4KKLC 3CIAA 3ARTA 1MFEL 3EJZD 4OQTH 5I6XC 4UT7L 2OQJB 4MD5B 4TNFA 1GSMA 3VDBA 1A6PA 4KDVA 1AC6A 3GNML 5ANMB 4L29A 2ZWLT 1AQKL 3LS5H 3PQYB 2YO3A 3BPCB 1RURH 1FZOA 1A5FH 3APCA 3TBVA 1G6RB 2G3XA 1YEWA 2N4IA 3KGSA 3T8VA 3WENA 5IV2A 3VFOA 3O6LL 5IR1B 3CFKB 1OWWA 4JG1H 2NSQA 4JB9H 5AZ2L 5IUCA 1VCAA 1XIWC 2DM7A 4IBSA 2CCWA 1E4XL 3TBTB 4ODWA 2H6PB 4BFFA 1KIQA 4P05A 3MRRB 1AGCB 2IGTA 1EXUB 2Y1VA 5ADPL 3KBEA 3QIBB 4MVBD 1I9IH 2JSFA 1MCJA 4KH2A 5DHEA 2FO8A 2ZUYA 4A6YB 4XPTH 4D7PA 1NIFA 2BJML 3Q7JA 4PGCA 5HJGA 1UFUA 1S8DA 1PLBA 4I18B 2B3RA 4RRPG 1QRKA 2WANA 5C07A 3G5XA 2O4EA 4G6ML 3P4NA 5DURD 2BZ7A 3MZGB 1QYGL 5ICYA 5A2AA 2AANA 3G6JF 4HOXA 5MEQB 2VDML 4DN4H 3UBFA 5LB1A 1J05B 2P5WE 5D1XC 3KPLA 1FFQA 1SEQH 2K70A 3IMTA 4LSTH 4MSWB 3QYMA 2F54E 4U3XA 4P2RE 1OW0C 3W2DH 5LG1A 3MCLL 5AW0B 1QUNA 2DMGA 4N8VB 4KKNA 5L2KB 4U1LA 3U82B 4PJ9D 5CEYA 2ZUUA 4X0KA 4EMZA 1YZZA 1H6EA 2WNXA 5DC4B 3LKPA 1PKQA 5TGBB 2NR6A 3FU7A 5I30H 1B4JL 2WMPA 4JFZL 2IWGA 3VW3H 2ZXCA 4WTWA 3NJXA 3QHZL 3L9YA 4WWNA 1G7QA 1UYWH 1HI6B 5GRYA 4KY2A 2QBWA 4WQOA 4R4BA 1VLXA 2QV4A 2IXQA 4KRPC 1IC4H 2UX7A 5DRNA 2WIMA 3QDMD 2EVJA 3E8UL 1LO5B 3SQOH 3W5NA 1UXSA 4X7TA 2OMTA 3IE4A 3AGVA 3V0GA 1I4FA 4AT6A 4YDKH 2VJ0A 1GZPB 5CMAB 3DK2A 5E4OA 4IRSC 5BQDA 4HUWA 3FO2A 4N0FB 1E9PA 2H0FA 4LPCA 4PVMA 4LEOB 4HD9A 1CC3A 5DD0H 3SE3A 4HWNA 4FXKB 1C7TA 1WICA 3CVCA 1WRFA 4M4RA 4DWHA 4GUCA 4E41E 1AJ7H 2ZX5A 4GMTL 4Q89A 4NQDE 3K6SB 3DBXB 1UJ3C 3BGMA 4NBYB 4BKLB 4MNQD 3L6FA 4QCIA 5JMOC 4F7TB 4DVBA 3G6AB 2N0KA 4S1RL 2GW5A 2ZF9A 5HDBF 1IC5H 1W0YT 1BWMA 1ZA3B 3MCKA 2EH8L 2HCZX 3EF7A 1AP2B 3B7UX 4DZBB 1N3NA 1AIZA 4UT7H 3O11B 3BRDA 3L9RB 2R4RL 1OF2B 1SJHB 2YMTA 2FO4B 4NRZA 1AQKH 4OLVL 1XBDA 4F5CE 3UPRB 3FT2A 3HC0B 5T1LA 1PIGA 3WL9B 1S7RA 4W9JC 3O6LH 1G9MC 2JH2A 5DJ0B 1LE9B 4PRDB 3IJEA 4Z95L 4M7ZC 4W68A 2X4RB 1A1NB 3JWDC 1FDLL 2M8XA 5I19L 1E4XH 1HHHB 3MNZA 4P2OC 2E0PA 1RZ8B 3ARBD 2OMXA 3QCTL 4FADA 5ADPH 1OCWL 1BVOA 4YHNB 1U9KA 3D52A 1SYVA 2HFFA 4IKIA 4LLQA 2UVFA 4MDRA 4NXSA 2G4GA 5EIQA 5C0CE 4XN9A 4FULA 2BJMH 3BT2L 4JVPA 3T0DA 4R4ND 5AZUA 5CCHE 3SQBA 1OB1B 5I82A 3W9DA 2HRHA 4HKBB 4Z7WA 3DPBB 1CLVA 3FO1B 1C5BL 2ZYSA 1SJEA 4K7PL 3O45B 4L8SC 2C8NA 4KKQA 3L8QA 4XVUD 1UT2A 3S8GB 1QYGH 2EDRA 3DNKA 3WE6A 4YHPB 1H3XA 1HOCA 5AVRB 3U6RA 3VJ6B 1ROWA 1T89C 1F0LA 5A6IA 1DLHB 3ESPA 4IRZH 2YA0A 4NLHA 5JZ7C 3VWKD 3MCLH 1KYOJ 1REIA 2VLRA 3RX9A 1AHKA 3KH4A 5EOCJ 3Q06A 1CQKA 3Q8BA 2EH7L 3SEPA 5HDBE 4WUUD 2R1WA 4G7VL 2GBVA 3GO1L 4QY8A 2B20A 2CO6B 4Y9CA 4MRBA 3SKNB 2CDFB 2VKWA 1UGNA 1B4JH 5E94A 4JFZH 3MROA 4HJIA 2NCEA 4O51A 1YC7A 3QHZH 3QIUD 5CJOL 1FCCA 3RVXD 3CHOA 1JNJA 4LCCC 4RAUB 5D2LF 3F7YA 2LVEA 2NY4B 3MUGB 3L3OB 3V6ZA 3DUUA 3PHSA 2O6DA 1ED3A 4U1MA 2GT9B 4N9GB 5FYLD 4JPKL 3F58L 1XEDA 5HPOA 4Z0BL 2C3XA 3E8UH 3QQ9D 4XX1E 2VN7A 2XKUA 5C86A 4N2AA 1UD3A 5CSBA 1JFQL 4QRQB 3IDIB 3ISRA 5GHWH 5GSVA 2F74B 3AGWA 1F3JB 3OKMA 5I17B 3SJVB 1TVHB 4EKXA 1T0NA 4FQXA 5K39A 5MP6L 1SJXA 1W72B 2P5EB 2OULB 3M07A 2CCVA 4U33A 4M9PA 4UQDA 1AGFA 4GMTH 2CHXA 3T8XB 5D72L 3N42F 1BMWA 4NZFA 2WQSA 1UT9A 5A7BA 1M2OA 4L8DA 5AW9B 4M7KL 2FNWA 4LXFA 2A73A 2Z35B 3AQYA 4ZMPA 1CIDA 3B1UA 1TDQA 2WXNA 4QTFA 2APSA 4AOFA 4S1RH 1RK7A 5HYFA 3ZT7A 1MY7A 4PR5A 4PRPA 5CCKL 4XXWC 2KBGA 2EQDA 3UYPA 1C9SA 4JG5A 2EH8H 3ATFA 4RFOH 2VISB 5EU3B 3UGEA 1IBHA 3HLAB 5JPNA 2XV2A 5AVQB 1CGSL 4A2LA 2R4RH 4HHAA 2GUYA 1Y6KR 3MV8D 5ICXB 6FABL 3HAEA 4X9BA 2A6DB 2WTRA 2DMBA 2OXHA 1D5XA 3QIBC 5FKAA 5JO5A 3LKRB 2WXPA 3WDIA 5J6HA 1Z9LA 1I7UA 2CIIA 2TSBA 2V5MA 1ZHLB 3C08L 3QUZA 1F58L 3O81A 1QD0A 2EYTA 4TF4A 5DLLA 5HPMA 4I18C 4QF1B 4S10A 4UIMA 1OP9A 4Z95H 3HFML 4QHUB 4XVTL 3FB5A 1FDLH 1O7VA 4JM2D 3AWGA 4XPAH 2D7OA 5FO9A 4UM9A 5ISZA 4ZMAT 1OSPL 5I19H 3BLKA 2DI7A 3H9SB 2W88A 5D2LE 5DZLA 3QCTH 4PD4J 4PTUA 4YPGB 3N91A 4H40A 4ZX5A 5KBKA 3P2TA 1S78C 4MWFB 1YLBB 2XXGA 3WTSA 4PJHB 1TUPA 1C12A 1TLKA 3BT2H 3NZHH 2OW7A 5F7FA 2K0RA 2RFXB 4LESA 3QDMA 1KIRB 3TURA 1AZUA 3SIKA 3IS1X 1PS3A 3GMQA 4K7PH 4F1SA 2VABB 4LOVA 3ZYOA 2BCKB 3T2NL 3UJIL 3FFCE 1KFAL 2ITCB 1Q0XL 4JFYA 1N8ZB 1OK8A 4P48A 4PWFA 2JKTM 1E3FA 5DMIL 4AUJA 1H3TA 5TK2A 5DS8B 2OTWB 5J7CC 1GZQB 1SM3L 2H4EA 2HJKA 3LQMA 3BMVA 3LNDA 1FV1A 4S2SA 3IRCA 3IK2A 2JKWA 4CN6A 1NIBA 5KBDA 2EH7H 2HG5B 3OX8A 4ALAL 2ODIA 4G7VH 3LRSA 3GO1H 5I76A 5C1MB 5K1NA 1WCBB 1KN2L 1VFAA 5ECJE 2HSIA 5IQ7L 4Y1AA 5ID0B 1XGQB 2QMKA 4JGMA 2YUZA 3H3PL 2XOTA 5IJCC 3RYMA 3ILEA 3C5JB 5ALBL 3KLQA 3ZR6A 4PI2A 3ZQWA 4J3OC 5H94A 3QPXL 1J0ZA 5CJOH 3LZLA 4IK6A 5B3JF 2CO3A 4FXKC 2ZCKL 1S7XB 2Q0ZX 3Q2LA 1KGCE 3F58H 4IEFB 5JR1H 4Z0BH 3KZ8A 1KTCA 4LPWA 3WIHL 2Y23A 4JDZA 2YSSA 4G8EB 4QRTA 3V0DA 3ZHDA 5HYJB 1JFQH 2DWDB 1WA0X 4JPIB 2VDMB 2EYSB 3AAZA 5EC1A 5B1CA 1CQYA 3AC0A 2FTAA 2ZF8A 3OC5A 1UATA 2BMKA 4KK5C 4OU3A 5D9SA 2FEEL 4L8BB 2DWYA 5MP6H 1UVQA 3V4VB 1WD8A 4XO8A 2IG2L 1H19A 3EGXB 5D72H 2WBJB 4TQPA 1EO7A 4JPSA 4M7KH 1MVYA 2HRGA 4XI5D 4IKLA 4LE8A 5HD8C 2DLGA 5EEYA 1NOLA 4H25A 2ODHA 4HAGA 4JFEB 1NCIA 1EVTC 4KMTL 4QNPF 5D6CB 5CCKH 2WWOA 2W65A 3RKDC 4N90E 4ZS6C 4W1TA 3V6OC 1FGVL 5I1AB 5E2UL 3MLUL 3K4AA 3NIGF 4Y2LA 1MHHB 5C0AD 5D7IA 5EU5B 4J4PA 1CGSH 1KBBA 1XVSA 1HHGA 2YQGA 2G9HB 6FABH 1IGTA 4X5WA 3U0PA 3EFOA 5F7UA 3VWKA 1YYCA 4AK2A 5DJ8B 5M94B 3KPRA 1A3RL 3C08H 3O3DA 1IC1A 3ZQXA 1RJZB 2MOQA 1R33A 5IESL 1ONQB 4J7RA 5BVJB 4H1LA 4R2GB 4FJZA 2G75A 5FUCC 4GQQA 4R0LB 3HFMH 4MD4B 5CKAA 1HCVA 1PQZA 5IEKA 4XVTH 4N2GA 1JZ2A 4MB3A 3FBKA 1OSPH 2JKIS 5B3JE 5L9DL 1YPZB 3GLDA 3REVB 4H8VA 1D2PA 2MSPA 1CG9B 3BXNA 3NRQA 4RIRA 2R2BB 2V9RA 4PV8B 4PVLA 4BRJA 4YLCA 2AK4E 1ACYH 1CL7I 3P0GB 2EUWA 3IJHA 3N1GC 4CC4C 4BDVA 3ABGA 1FVDB 5CCGE 4B96A 4PCSA 2VLJD 3PL6A 3RVWC 4P2AA 5DD1L 5D7KE 3SKUD 4I85A 3T2NH 1GAFL 4U31A 3UJIH 3BEVB 1PD0A 3RQ3A 1KFAH 1IFRA 1WS8A 3T65B 5KS9A 1Q0XH 2Z92A 3AZUA 1M53A 5IM7A 4S0TD 2QVIA 2V2XA 3DECA 3RIFK 4GIPD 3QI9C 4ZAKB 2NDFA 3NJLA 3WNKA 4NENA 1AH1A 4PW4A 2WP3T 3H3KA 1HSAB 2HVJB 2D31B 1DBKL 3HE7C 4HMDA 3AMLA 4RFNB 1SM3H 5DJXB 4OCNC 5C0JA 4DERA 3ARGA 2DY2A 3TO2A 2NY4C 5E9DA 5TFSL 3L3OC 2G0KA 4ALAH 4QNPE 5FKPB 4QYAA 3ATEA 3JUYA 3FQ4A 3TF4A 4QGYA 1IM3D 1ZRUA 3A4FA 4NP4L 1KN2H 1T83C 4M8QB 3S7GA 1SOXA 3BP7A 1FAIL 3DUHA 3EO0A 3O3BB 4HG4K 3NIGE 2J73A 5JHDD 5J06A 1QBAA 3OM3B 3X1FA 3H3PH 1DVUA 3V7MA 4KBPA 1MZYA 5KBMA 5ALBH 3LZQA 4U1NB 3VQ1C 3SGEH 1WJ3A 3QPXH 3GMRB 1VFOA 3FQRA 4U1HB 4QOKD 5AB2A 4JJ5A 4EO5A 2WXIA 1EFXD 3BEWA 5D6DC 5BOPA 5IJDC 3I50H 5F1KC 1RHFA 4NO0D 1ETA1 1NBZB 2IFGA 5KOVC 1AZRA 4IOFC 3H85A 4QUOA 5HDQL 3WIHH 5DVOA 5C0FB 3O6FA 4HAFA 5GGRA 3S0PA 3VDAA 3EYQC 1DJZA 4IBTA 3DOHA 5DC2A 5T5FA 3BGAA 3RWDA 5KJ7E 1KBGH 1GC1C 2WAHA 1S3RA 3N04A 3J7HA 4AITA 1OV8A 2Y6TE 3KLAB 4N2OA 1AZVA 4QTIH 4KVPA 2A4CA 2ZXQA 4N6RA 2D2CC 3T1WA 2BNRE 4JRWA 4PRIB 1J8HE 3SBPA 1JJUA 4PRNB 5FO7A 4G1EA 4Y5VA 2YOCA 1E42A 3D39E 4A2FA 2HT3D 2VDRL 1OARL 3OB8A 1L9TA 4W4OA 4WHYH 2EDLA 4KKAC 4BZ1L 4ZSOA 2MKLC 4YUEL 4KMTH 3VQ2C 3OG6B 2PYFB 4L9DA 4MBRA 4ZUTB 5CSGA 1FGVH 2H3NB 1MFAL 3MLUH 4G8GD 1SFHA 5E2UH 2NY0D 3SO3B 3TNNA 3UC2A 1TJXA 4F7MA 4FLQA 1JAEA 3CFDB 1I85A 2C4FU 5D7HA 3SPJA 4PVNA 3HVDA 3ARVA 5DRWB 4XNUL 1BLNB 2ICWJ 1TZIA 1A4JA 4YDVA 4LRIC 1K4DB 1GY2A 1OVZA 1A3RH 5CR8A 5IESH 9PCYA 4X8JA 4PJCA 3OMAB 2L7EA 2O5NA 4GLRH 4GB9A 4R97B 4YHOL 1FUNA 5BV7B 3ZL4L 3QQ3B 4XPBL 5EEUA 1EPFA 1D5MB 3DHMA 5L9DH 4XAKE 1KCVL 2DBJA 5M7QA 3V0WL 4K3EH 4N2IA 5GRVL 3GTNA 5FK9B 2BM3A 1OGAA 4LOUD 4BKTC 12E8L 2LFGA 1R3KB 3ZDZB 3DV6B 5AW8B 1P7KB 4ZX6A 3V79C 5E6UB 4GSXA 5DD1H 1Y1DA 3GMNB 4UYPA 3MRGA 1NGWA 3FUEA 3ZO0A 5CD3A 4OZFA 2N1KA 1GAFH 2BS71 4JRFA 1AO7E 2OMWA 4LLVA 3T1FB 4LLWB 2Y72A 1G1OA 5GGTA 4LNVA 3UTQB 3VYPA 1J87A 1UHVA 3JYCA 5F8RC 1BD2A 4QRFA 3L1GA 3KJ6L 3QO0B 1N7ML 1CYWA 1DBKH 3BW9B 2CJ3A 1EUUA 1U4EA 5F88B 3SGEI 3QR0A 4TV3A 3SDAA 5TFSH 3HFFA 1A7OL 1CFBA 4TSCL 5GS2D 4WKZB 1QW8A 3L95B 4M9OA 3J2PA 1K5WA 4NP4H 3VI3E 3GM0A 3QZWG 1AC0A 4OZGB 3EDFA 5C3LD 3BH9A 4OLWL 4JANB 3DSFL 1W0WA 3KS0H 2OYKA 1MCWM 1Y18B 1JV2A 3EBGA 4UTBL 4PI0A 4XN2A 1FH2A 4F7KA 1BIIA 1NL0L 4WEBL 2F53E 2CKNA 3RWGB 3NJNA 5I74B 3II1A 4ZFQA 2Q7NA 3L4XA 1X9RA 2EUZA 1HYSC 4ZW3A 2Z65C 1KCUL 1EJFA 4GRLA 1J9QA 3MLPA 2WBJC 5E2WL 2CUIA 3MJWA 5HDQH 4M7LL 2XY2A 4YDZA 5GGSB 2H1PL 1CTNA 3IXTA 4NQED 4MBOA 3SKOA 3A0OA 3O0LA 5G5DB 1S3KL 5ERWB 2VR9A 1NWPA 4WI7A 4GKZA 5IVNA 3U6XS 1NPJA 2BRQA 5ACMA 1J9CT 3U0TB 3I02A 1JZ5A 2A74B 4PHXA 1QSZA 1I1AA 4LLMB 4CL7A 1SPDA 4IKJA 1NUGA 3SO5A 1YMME 2X2IA 4W4NA 1J5HA 1BJ8A 1Z9NA 4U49A 3U4EB 4AGMA 1ODUA 3QGVA 4IHOA 2WYIA 3FCTA 4I77L 4HUXB 4PG2C 3CFEA 2GJ6B 1OARH 2VDRH 3FU3A 4GOSA 1U0QA 4BZ1H 1KIUB 1U8MA 5BXFA 1EJ6A 2P5WB 3QDGE 4YUEH 1FBIL 3SGDH 2ZCHL 4V1DE 3A4AA 4OZHF 2QQQA 4R2GC 3MJGX 4MXQC 3WUWA 4NIKB 1EHXA 1MFAH 4R0LC 3DOSB 5HI4D 3CXDL 3UIYA 3QUXB 2FL5B 4HUUB 3PHAA 1F1AA 3CGTA 1D6EB 1Z66A 1P4LA 3VFMB 1J5OL 5DA0B 3DETC 4TLKA 4DGYL 1A21A 2GC7C 1YJDL 4XNUH 5KYUB 5F7EH 4PIRF 3VFNB 4KRLB 3M7OA 2CDEB 2X1QA 1U8OA 3ZDXB 1BYOA 4P5MA 3FF8A 4Z7VB 1NEPA 3QEHB 1PFOA 4YHOH 2W1NA 1DEDA 1II4E 4C56B 3WTVA 1Z9SB 3EFDL 4P0DA 4S1DD 5AEAA 1YQVL 4XPBH 3R4DA 4K7PY 2V7HB 1T5XA 2WXKA 2B15A 5ANHA 4NHCL 3KLKA 2DQHL 3D2UB 1KCVH 2WLLA 3V0WH 2EKJA 4RMVA 1BZQK 1J11A 1MDTA 2VO8A 3ASWA 2I24N 4ZFZB 2LOEA 4WWKD 12E8H 3FH7A 4ZAKC 3L3DB 5L4IA 2KZBA 4NO0A 4FQ2L 3JVGA 4GG8B 4M56A 4RFNC 5K33A 5DHYB 1TT6A 1OTUD 1BJMA 2XV3A 2XN9B 1Y0LB 3KPTA 5EA0L 5E8DL 3RVTD 2ZD0A 1YDPA 2H1XA 2MH4A 4H88H 5GGVL 1EZUA 5JQHC 1EZVY 4FFVC 1R5WA 1RK1A 2XX0A 5IB2B 3FSAA 2BNQB 4X6DF 2OJ1A 3RBGA 4C4UA 4N2CA 1KACB 5L0QB 1G7HA 3GSRB 3NJKA 3N41F 4JDEA 4XRCB 3KJ6H 4JY6A 1RIUL 4Z7OB 3GSXA 1AOHA 3PABB 1VDGA 4APQB 3MHZA 1SXCA 4EXPX 2Q7YB 4W9IC 1IGCL 3HE6A 3R06B 2P5PA 2H9GB 1A7OH 4IRJD 4TSCH 2ESVD 2XC8A 3UABA 3ZOAA 3GYRA 5EU4B 3T77B 3IMUA 1PZ2A 4X99B 4FP8L 4JE0A 3GBLA 4DT2A 2JB6B 3BP5B 1NUNB 4OLWH 4ZO9A 3DSFH 4AIOA 1J1XH 3EJPA 5K9OB 2NYYD 4UTBH 1FE8H 1CE6B 5DJDB 3WN5B 4UB0L 3GUTB 1NL0H 4WEBH 3AW5A 3G6JA 1EJ8A 4K8RL 2J6EL 5GSRB 5IMMA 3L7FA 1KCUH 3EJTA 3MRIB 2EIZA 4YBHA 1HT6A 2DIEA 2EDJA 5HYQA 5E2WH 1CB4A 2EXYC 2H1PH 5E70A 3K72A 4O2FA 4XO4A 3NN8A 2BSEA 4OLZL 5B1JA 1PZUB 2PTVA 1C8QA 1S3KH 4LIQE 1LHZA 3DIFB 4PGEB 1EAJA 1E7UA 2PETA 5EC2B 1R1CA 4OKDA 2AV7A 2AJZA 4YLQT 3BSGA 4QRPD 3SY0A 1ZLSL 4XXCA 3SO3C 4AQEB 3BZ4B 4WNQA 4ZUUA 3K1DA 5KVMC 1CXLA 3AY2A 3H2WA 3MJ8B 5EO1B 4J2XA 4I77H 1XR9A 1X9UA 1KTDB 3HBZA 3P3TA 2ITDA 1FPTL 1X7TA 4D0CA 5D1QE 4X6DE 3BAYA 4I0PA 2AV1B 2GITA 2ZCHH 3M6DA 1FVEB 4OBRA 3HUJA 1WSST 4ONGL 1VF5C 3P73B 3VXMB 1KEGL 5BV7C 3CXDH 4R97C 1YUKB 1FNSL 2QGEA 2XQYK 3WTXA 2N3JA 1X4ZA 5J3HD 4MJ2A 5KN5B 1J5OH 1UWXH 3TBBA 1YJDH 2DTSA 1QSED 4Z7UF 2WIIB 3ULUL 1TTFA 2R1XA 1T20A 3VG0L 2J88L 3BPOB 4FCHA 4NZ8A 5FO8B 4CADB 2LTQB 4JCLA 1ZGLM 3DMMB 3L4TA 1X5AA 4KRMB 1TTCA 3EFDH 4BFKA 4DP4X 2ZP9A 1YQVH 3DO7B 5IHHA 4U4IA 5E23A 4HPYL 1YNTB 1NCBL 2DQHH 2DRUA 2NT0A 2XV0A 2AABL 2CGZA 3X3GL 3RZCA 4LPTA 4J8QA 1CXKA 2GSGA 3IJYB 3IU4L 4TVPD 1EHLH 1WLHA 3NABL 4FQ2H 3TA4D 1UG9A 3TO4B 3FNKA 4Y4FA 4DO4A 2BP0A 4NFBA 2CLVA 5E8DH 5EA0H 3WY1A 1B3JA 3QIWD 1MW0A 3ZKNC 1MCQA 3KCPB 5GGVH 3ZSTA 1QR1A 4G8IB 4DAGL 1BFVL 4HWUA 4EAEA 3PUCA 3L1FA 2OMUA 5ETUA 3THMH 4ZUSA 4OLYL 4HWBL 5DEGB 3CU1A 3O4LE 1ZLWH 1RIUH 2CNZA 2MQCA 5CZXD 3TBYB 4MX7B 2O6PA 4H20L 5CP3A 4ORGB 1H3PL 1IGCH 1IM9D 1CGUA 4QHLB 3PHQB 5I74C 1PNDA 4XZ4A 1VGKB 4RDBA 1CGYA 2PWHA 4NKOB 5LVEA 2C26A 2WZ5A 2FWLB 3IDXL 2Y5TA 3NGBB 4FP8H 2D2OA 1R3LB 2BNUA 3RGBA 4K7FB 5GRXG 1VGEH 4QXUL 4D0DB 1EDHA 3AQXA 2VR4A 2WSDA 4L2YA 4DOHE 2FWOA 5DC0A 2BWDA 2BHFA 3MA9L 2YA1A 4PJ8B 2EEDA 4Z7UE 1FL5B 4UB0H 5CBAB 3UTTD 4I48B 5MEND 4K8RH 3NDZE 4PIBA 2A74C 4RDQG 3QZNA 4Y7MA 4U6YA 1U36A 3S4SA 5F3HA 4JCWA 1XCXA 4XCEB 4J12A 1P4UA 2P52A 1HVXA 3IFNH 4OLZH 4KJWD 2BS8A 1P84K 1NFIA 1QMUA 3L3JB 4TLSA 5C0RL 1IV8A 4LSRL 3QEGL 2D7PA 5FUOL 4XMPL 3GLEA 5GRVK 1NPNA 3ECVA 3QSKB 3VD2A 4QJ5B 1G87A 1XIWA 3F8UB 5TF0A 2G4EA 3QUXC 1ZLSH 4Y9BA 4XN7A 2FX9H 4LCWA 5FDWB 2C3GA 8FABA 1ZHNB 3SHSA 2H2SC 5G4OA 3IGAB 4XC1L 1U8QA 1PCXA 4OH2A 4U6VL 4MCZA 1FH5L 5KOMC 1MCPL 4G8FB 4AQ1B 5LGHL 5HGAA 1J1OL 5A2LH 1FPTH 3RNKB 1L9PA 3SZ6A 2FZ3A 3FRPG 1ECYA 4ONGH 3NJGA 5K9KB 4TVSa 1KEGH 5D7EA 1F02I 1G1CA 4P5KA 1FNSH 4AM0A 4IOSA 3IDYB 3MV7E 2LAAA 1HEHC 1T21B 3EOBA 1HL9A 3VDCA 2N7SA 1DANT 3IDUA 2NW3B 3GSOB 1KYFA 1HS6A 4L4TD 2H26A 1PY4A 4X7DC 5D1XA 4ELMF 5JIMA 1DVFB 3ARDB 1WP6A 2MNWA 2BSRB 1PBYA 1AOZA 1OW0A 4ODHL 6PCYA 3VG0H 2DQ6A 2J88H 3WTWA 4JFFE 4LU5L 5E6ZA 4G83A 4R4FL 4EI6A 5FA4B 4KK6D 2QVMA 1L3WA 1BWWA 1S7TA 4MCYA 2BSBA 4PPTA 5KSBF 4NZDA 4QO1B 4E42A 4IBVA 5CZKA 3BZFA 1MH5A 5I2IA 2JCWA 1NCBH 3DXAA 2NUPA 2WQRA 3F7LA 2FR4B 4KI5D 5EDSA 1CI5A 2NDGA 4KNSA 2Z7UA 4I2XB 5L0QC 1J10A 2AABH 3IKCA 3X3GH 5AW2B 3WJMB 3IU4H 3WKMH 4BK5C 1I8UA 2X09A 1S78D 3NABH 4HOMA 4A7SA 1UA3A 3E8VA 5D4JA 1OD7A 4M7LT 4JKWA 4PAZA 2CHDA 1MJJB 4ZOEA 3ZE1B 2FVNA 2PLTA 4K5MA 3ECBA 3PY9A 4JFUA 1NDTA 4N85A 1BFVH 1OGTB 4DAGH 4Y88A 3ULAB 4O2CB 4KK9D 1JZ6A 4BCZA 3VYOA 1K2DB 4HH8A 2HJFB 3FOLA 4OLYH 2DYPA 3QQDA 4HWBH 1EDYA 1DUYB 1N8OE 3VNYA 4A7QA 4IRSA 8CGTA 5GS1B 1NLDL 1KYUA 2VDQL 4Z78A 4H20H 3ZHFA 5C0BD 1H3PH 1K3IA 3QUGA 2A2QT 3VXNB 4PP2B 2KMWA 3LEYL 2XWXA 5EEVA 1P9MC 2YZ1A 1INQB 4ZQTA 4FG6C 1CD1A 5GZOC 1PW3A 3IDXH 3OF6D 2X4NB 2ATPA 4X6FB 4DSYA 1UJ3A 4UOW0 5CD5C 3RPIB 5C08A 3VFVA 4ZX4A 3ZU8A 1N5AB 1ULVA 3RGVB 1XGPB 4XNMB 1JE6A 1AD9A 4QXUH 1KGJA 2A0LC 2E46A 3FO9B 2OMYA 4LLYB 3ZHLA 4RAVB 1UWXK 2EE2A 4AK1A 1A7NL 1S7QB 3CZKA 5F9JB 4ELME 1WG3A 3LN4A 1TZ8A 2IAMD 3QNYA 4NQSB 5J56B 2WUCL 3VXOB 5DFAA 5I5RA 2DLEA 2NY1B 5DMGC 4JUTA 3WTUA 3MRQB 2Q9OA 1RI8A 1FO0A 4RMRA 5IK3B 5HHQB 5KSBE 4WF7A 3HPLA 4G1MA 3GS4A 3OJDB 1FYTA 5C09B 2CQVA 4LSRH 3QEGH 5FUOH 1GPOL 4XMPH 5IF0A 1YN6A 3NEXA 1XF4A 3RVVC 1JVKA 3ETBF 2XICA 4J5VA 4GBXB 5ENWB 1KTLB 4N4YB 4EDWH 4YXKL 4ZFGL 4P2OA 1IKOP 3OLGA 1OWRM 4F3FB 4MJID 2EADA 2J5WA 5IVOA 1S5HB 4O02A 1E4JA 3DVGA 4LBAA 4ZPVB 2X4QB 1A6AA 1RMFH 4U6VH 4XC1H 3SD5A 1FH5H 3W56A 1MCPH 5LGHH 4LIQL 4NOBA 1A64A 1U8PA 4FTVB 5IT2H 3GIVB 1FVCB 3VD3A 3KL3A 2ZOTA 1JPGA 3MV01 1YEIL 3BPOC 3IYLW 4GUPA 1PZDA 2IQ9L 3Q3GB 5CJXC 2LTQC 1LD9A 4BIKA 3S3SA 5LQBL 4QRSB 2R7EA 5E00A 3T6XA 1NOAA 4L8SA 1G7JB 3DMMC 4QYOA 1ZLWK 5AOJA 1MCIA 4EUPA 4KUCD 2MFNA 3PGDB 4ZS6D 5T1KB 4L4VA 1RL1A 1O6VA 3KWWB 3QWRA 4NM4L 5EIIA 3FONB 1C08A 2BSTA 2NY6D 1T89A 5BS0E 1CDUA 5IB3A 3TA3B 3HMWL 1JVOA 3D07A 2GFBB 4OAWA 4ODHH 1TQBB 5I15L 5KZCD 3CLEL 4LU5H 3G5YA 3KDMA 2V9UA 4R4FH 4ES9A 2EIDA 3QQNA 3TO4C 1GTNA 4NUJA 3JWNE 4NLAA 5I6KA 1MCEA 4B0MB 1PGRB 2YBRA 4GKNA 3QT2A 2ZPKL 1QSFA 1KJ3L 4KXAA 4OR1A 5EPMB 3OMNB 2FO1A 1JDCA 4ANUA 3SPVA 3V5HB 2X7LB 5JPMC 5IVXA 4L05A 3ULSA 2E56A 2X41A 3QPQC 4LCCA 4PBWD 2MMXA 1NBCA 4NJAL 2MCG1 3KYNB 4XP4L 4S0SD 3VWJB 1F5WA 1I8IA 1RK0A 1BPLB 5AYTA 1XZ0B 1ZPUA 1KSRA 3NGBC 1ECZA 1U95A 2YPLA 3MRPA 2C4XA 5B38B 2C1PA 4X6BB 1FNEA 1K85A 1NLDH 2OFQA 4PS7A 2VDQH 1N59A 1ZDQA 4PJ8C 4P2YA 4GSDL 5FS5A 2BFVL 5F89B 4P3DB 5E6ID 3I6SA 3LEYH 1AS7A 4PRHB 2OQJA 4MD5A 1JI1A 5ANMA 1UOVA 3MA7B 3H7BB 4N5EC 3FB8B 4FRWA 4UV4L 4W6YB 3PQYA 3VVVA 2QGBA 2X1XR 3BPCA 4CGTA 2N7AA 1T1YB 2J1WA 1G6RA 1MFVA 1A7NH 4MA3B 4XMTA 4XXWA 2RACA 4YH6A 5IR1A 1B4RA 3FHQA 3CFKA 2WUCH 5CIPA 1BVNP 2GIMA 4ZMQA 2HFGL 3JQOB 4PWEA 1MI5E 3RFRA 2IANE 4DP1X 2ATAA 3CMOL 3TBTA 2H6PA 1UXWB 3MRRA 1AGCA 3KPSE 1EXUA 2P5ED 2NLJB 4UQEA 3QIBA 3RURA 1UOWA 4BH8A 2R69H 4A6YA 4AQ1C 4PWIA 4CSTA 2VLLB 2I32A 5L8LB 2WCGA 3E38A 4PREB 3V4PA 1MUJB 3BUYB 3JTBA 4I18A 4YHML 3O2DA 4YXKH 4ZFGH 1JZ8A 3FTZA 4FXTA 4KWUA 4ZMVA 4KHXH 2E75C 3LNHA 4RGND 3IMWA 3IDYC 3S35L 5FR3A 5MEQA 4YDNA 5FOJA 3ZDYB 1N70A 1J05A 4LIQH 4NYLA 3LSOB 4MCMA 4MSWA 3BQUB 1DVFC 3S2CA 3GXNA 3P4OB 4WLCA 4LO9A 1YEIH 4GT7A 2IQ9H 2OYMA 5LQBH 4N8VA 2RCSL 3ZBMA 5L2KA 1E8YA 3FSVA 1OM3L 1G7LB 4BWWA 3HZMA 4P4RB 3TF7C 5J1TC 4NM4H 3WHE0 3PGFH 2WQUA 4NO3B 5TGBA 3VACA 3VI3B 3HMWH 1VHPA 3DHJA 4MAYB 1SLUA 1DSYA 5AAWC 1A3LL 2W95A 4LCUA 3MUY1 4DP2X 4OGYL 5I8EB 4ELKB 1HI6A 2BVEA 3WKNA 4PB0H 4AVJA 4IU3B 1I1RA 2FUTA 1NCWL 3PWPB 5TF1L 3MREB 1ZPLA 2ZPKH 5GGVY 1LO5A 1T22B 1TJMA 3PCYA 3POCA 3C5ZD 3GSNA 4AZ8B 4OGZA 4D9RE 5T3ZE 4IQHA 2EEAA 3EJRA 2F8VA 5CMAA 5GS1C 4BK8A 3PIQB 3CZUB 4N0FA 2P42B 1ACXA 4LEOA 5CGBA 3SGKC 5I1CL 4KVNL 4NJAH 1EBAA 4FXKA 4XP4H 4EZJA 4QDGA 4LSVL 1WBZB 4WWOA 3ZHNA 2LU4A 4Y19B 3TWCL 5BRZB 4MLSA 3K6SA 4FERA 5CFAA 3DBXA 1I8KB 2JE8A 4BKLA 4Q4IA 3RGVC 5KSVB 1FC1A 4G9FE 3T04D 4F7TA 2YEZB 2OV0A 4TUOB 3G6AA 3UPCA 2UZXB 3U83A 5F9AC 1P7BA 1ZA3A 1AZCA 2CH8A 2FATL 4GSDH 4PG9B 1AP2A 1BVZA 1ET8A 2BFVH 2XWEA 3HN5A 4OW6A 4DZBA 1J0IA 1UTDA 1P4IL 2NY1C 4U3SB 3MQIA 5AKTA 3TJEH 1VADB 2BIOA 3L9RA 1OF2A 3WO3B 3PU7A 1SJHA 4UTAL 2FO4A 3NSJA 1EEYB 4NQCD 4JAMB 3B2UD 3FUMA 4FI6A 3P9MB 1MRFL 5DU7A 4QKXB 4AMWA 4Q14A 3V95A 4AV4A 5HYJD 2FJUB 3IDGB 1IBZA 3V6OA 1LE9A 1NAML 5DJ0A 4FDWA 4NC1C 4PRDA 5INDB 4GBXC 3UACA 2HFGH 1JZHA 2X4RA 3FU5A 3CMOH 1HHHA 4GO8A 1RZ8A 4DGIL 3SOBL 4YHNA 1KIPB 2GBTA 5EBMB 3RZWA 2AQRA 3LEXB 1HYRC 5DTFB 1OB1A 4Y5XC 4WTQA 4HKBA 1P1ZB 4N86A 4U1JB 3DPBA 4YHMH 4KJPD 3FO1A 5JW4Q 3O45A 2QV2A 2ADYA 2VDQB 2CRMA 1GR7A 3HW7A 3D12B 3OJ2C 4EBQL 3HC2A 2QHRL 2X40A 3S35H 4K8RC 4YHPA 1LYQA 3VJ6A 3AS0A 3UIZA 2GK2A 2NNRA 4BSJA 5A2CA 1G0DA 3TA3C 4NI6A 1DLHA 4P4KB 1TQBC 2FLMA 3RUGF 4CC4A 4MDIB 4YEFA 1A9BA 5H37A 2H32H 1KGYE 2RCSH 2WO3B 4JRYE 4N2BA 2RBLA 2JLLA 2YUXA 3E80A 1OM3H 3DX8B 2PP9A 5E24E 3BZDA 1RVFL 3ELAT 2X70B 4MXQD 3D18B 1PCSA 4BE6A 2DM2A 5EU7E 3ALWA 2CO6A 2EO7A 1ZVHA 2HMIC 1V8HA 3SKNA 1OXYA 2CDFA 4YWGL 3MJ9L 3DJSA 3QI9A 3JYBA 2TRYA 3BWZA 1A3LH 1LP9B 1BP3B 1DJWA 3HE7A 2P1YA 4PN6A 4OGYH 4YSOA 2E86A 2HKHL 1H0DB 5AOMA 2ADIB 4PJBB 4RAUA 4UDTA 3MUGA 4WO4B 4GUQA 3L3OA 2A9DA 2XBTA 3VWJC 2GT9A 4QRRD 4N9GA 5TF1H 1ZD6A 4AL8C 1T83A 1SN5A 3H4HA 1I3RB 3VGBA 2RQ8A 3UEQA 1A3QA 1U3JA 2BOCB 2YAFA 3D85D 4OZHA 4QRQA 3IDIA 2CPUA 2DQGL 1F3JA 2F74A 4A38A 2WXLA 5I17A 2WQXA 3SJVA 4CUCA 1TVHA 5I1CH 1VACB 4AYEC 4KVNH 3HG1B 4XHQA 1W72A 2P5EA 5D6DA 1IL1B 3ULUC 4XNAA 4GY4A 4LSVH 3ULVF 4HEME 5GRZA 4PYGA 3OMZA 1EO5A 3T8XA 3TWCH 1SDDB 5L6YL 1RZPA 3RPBA 3P3YA 2MOVA 4EI5B 2PO6C 4PY7B 2WD0A 1URIA 4JFWA 5GJSL 4KTGA 3CHXA 1MWAB 4TQIA 5LGJB 3PG2A 1BAFL 1F4YL 4D9QD 2HA1A 2FATH 1XGYL 3T2LA 5EU3A 1UADC 1NINA 2L7QA 4AYFB 1NFDF 5D7LD 3H6JA 1P4IH 3HLAA 3RUGE 4HG4J 1F86A 4HJGB 1JGUL 2QQLL 3KHOA 1I3GL 1JK8B 4I88A 2XWCA 4ILDA 4RMSA 1SRDA 5F96L 2A6DA 5HGGS 5ICXA 3RPKA 3W0WE 4UTAH 3VD5A 3HZKB 3N44F 1ITCA 3LKRA 4XNXL 2ZNXA 1MRFH 4X8XA 4ZNCD 2HT2C 2IEPA 1MRDH 4RMUA 1KTJA 3QUHA 3GF8A 3WFDL 1BAGA 1NAMH 3OBAA 1R0AL 1X9LA 2OS7A 3LHAA 4QHUA 4QHPA 2C9UA 3RKPA 1HQRA 4DGIH 3H9SA 3IU3B 3QRBA 4XPGL 3IFPB 5HGBB 3SOBH 2X28A 1H6FA 1NCTA 2DYSB 3DX3A 3ILQC 2VAAB 4YPGA 1IRAY 4N2DA 2E7MA 3D4ZA 2MHAB 1V55B 4LRIA 4MWFA 4PRID 4PJHA 3UZVB 1MHCB 3B9VA 3BQUC 1ADQA 5LBVA 3T08A 3IPBA 2RFXA 5HGDB 1SMAA 1QASA 3D3VE 1H5BB 5ADOL 3O3UN 4QXGL 2MPVA 5AW3B 1TCMA 5I0VA 2VABA 1U8LB 2BCKA 2JXMB 4P5TA 4EBQH 3L4WA 2QHRH 4L5FE 2ITCA 1EUTA 2UVEA 1GGCL 2VDOL 4LCIL 1N8ZA 2V0AA 3ULVE 4I3RL 4QEGA 2EZ0D 2WN2A 1T6VN 2NY3D 5DS8A 2OTWA 4G7QB 2KDYA 5LN4A 1GZQA 1HIML 4R7XA 4E9XA 3EXJA 4NT6B 2HG5A 3BN3B 4LK4A 3T0EE 1KULA 1RVFH 3R7RA 2VR3A 1WCBA 1AD0B 4Q8BA 5AAPA 1NFDE 4YXHL 1XGQA 5ID0A 4YWGH 4EXKA 5CZVL 1YSOA 3MJ9H 3ZE0B 3C5JA 4H0HB 5H35B 1KLGB 5ABZA 5DQJB 4D9LL 2VLKD 1AQHA 4M5ZL 1CVSC 3II2A 5JA8B 4E36A 1S7XA 2LLGA 3VXRB 5E1QA 4DIXA 4MNHB 2DF3A 4L3EA 5HJBA 1RZKL 2VW7A 4IEFA 4QT5B 3VXUB 2PYEB 2X4PB 2X2JA 5BZZA 4G8EA 5HYJA 4LL9A 2DWDA 2OCCB 2YC1B 4Z7NB 1G5GA 2VN4A 3WI9A 4JPIA 3TN0D 2EYSA 3PNWB 4AY0A 3KWXA 3D0LB 2DQGH 1MQKL 1Z1WA 3K2IA 4HWEL 4BGLA 1AGDB 2Y7QA 4L8BA 5CHNB 4A7TA 4OIIH 2GG1A 3T0WA 2EICA 3V4VA 2QKSA 1CZ8L 1FL6B 2CSPA 1JGEB 1JS4A 3HNSL 5F3FA 1HTYA 3H0TB 1TKWB 3EJQA 3S2AA 5A1AA 4E9LA 2WBJA 5L6YH 2Y3NA 5T3ZL 4BH7A 4Z76B 2Y6SD 3ASNB 2NXYB 3Q2CA 1M7UA 2X12A 3IFOA 4BQCA 5ITFB 3WIIH 1TSHA 2MNJB 1LMKA 4I1NB 1WEJL 5GJSH 4OZIF 4JFEA 5FCUL 1DCLA 3CZSA 5D6CA 2X4SB 3E9UA 4OGAC 3E0GA 5B39G 3L2LA 1BAFH 1KJVB 1F4YH 3FQUB 2PR9A 4Y4KD 3GLZA 1OTSC 4NB7A 5I1AA 1XGYH 5IWLC 3KGUA 5JDSA 5H2BB 2OL3L 5EU5A 3TPUB 4E9WA 1B4LA 5ICZB 2QQLH 1JGUH 1CF8H 3QUYC 5A2BA 5MEOB 2G9HA 1DQML 1I3GH 4H44C 1CDYA 2IOIA 4PG2A 1TNNA 2BXZA 3EJCA 4M3KB 4XNXH 3L1EA 5DJ8A 2HRLA 1G7PB 3QW9A 4PGJA 2VW6A 4JO3L 4MQTB 1RJZA 2CBTA 1JPFB 2C34A 1ONQA 2X3AA 5BVJA 3WFDH 4R0LA 4NI3A 3KXFE 1R0AH 1DLFH 1IBFA 3AU1B 1YPZA 4XPGH 3LZRA 2ZAIA 3ZZ1A 2B2XL 3REVA 3NIDF 1OAZL 3W11C 4IIQB 1CG9A 2WWMD 4HT1L 3BPNB 3SPIA 4HOZA 2IMNA 3M46A 2R2BA 4WHYG 2Y25A 2K8QA 3OLEA 4PV8A 4P4KC 2D0FA 1T2JA 4U3HA 1FVDA 1ODAA 5ADOH 2Y3AA 3ZL1A 2EEBA 4QXGH 1XH1A 2P5WD 3G9AB 2WZPD 4KU1A 2F54D 5AOKA 4P2RD 3BEVA 4HJJL 3B3BA 3T65A 2VKXA 1GGCH 2VDOH 4LCIH 5BVPL 1ZA6B 1Z32X 3FF7A 4I3RH 4YHKL 3EXLA 5B22A 4ADJA 4ZAKA 3UBHA 5BNXD 1HSAA 2HVJA 1MVUB 2D31A 5DJXA 1P1VA 1HIMH 2RGSA 4FEIA 3GHEL 3I6GB 3RTQD 2BIHA 4OIAA 4YHYB 1UCBL 4OZIE 4K94C 4YL9A 5FKPA 3MNMA 2ZP8A 3U9UB 5C6WH 1V27A 4JPWL 3PUUA 3CXHK 4C59B 3NCJL 3EGDB 3O3BA 1KXTB 1NCHA 5FGCE 1IUZA 1ZIAA 2PCYA 5SWSE 4YXHH 5CZVH 2XKNB 5JQ6L 4UIKL 2OAAA 2GVYA 3CFBB 4NKDB 4OCSL 1U42A 1QBLL 4L3AA 2A9AA 4U1NA 3RIAF 3EYOB 3EOYG 5KBNC 3IEAA 1DQJB 3GMRA 4D9LH 3RNQB 4U1HA 2A99A 2ZOWA 4E9TA 2WQAA 1NCJA 1SNRA 4JKKA 3NESA 3RI5F 1NBZA 1RZKH 4OF0A 1XTMA 2QSQA 1U8JB 3TZVB 3C9NB 5A40E 5C0FA 3NUKA 3FMGH 5EOTB 3ECQA 5T1JA 4EI5C 4E41D 4QHNB 2XETA 1MQKH 1PAMA 3NIDE 2BP8B 4NDMB 4HWEH 3HR5A 2NX5B 2O5ZL 4NQDD 3WEOA 2NPLX 5AB1A 2M1KA 2XQYG 1KCBA 4ABWA 3UFIA 4B9FA 5CM1A 3TJPA 1CZ8H 3S9DB 5I5MA 3EHBB 4EIUA 1YYML 3HNSH 2F0CA 1NIDA 4APQD 4F24A 1FZKB 4TNGA 5AW1B 2DOCA 3JUZA 4HIJB 4PRNA 4WV1C 4ZTOL 3MYZA 5T3ZH 5IFJB 3T6ZA 1MCWW 5DO2D 1HU8A 3K6IA 4HJUA 3WNMA 2KZ1B 1WEJH 4OM0H 4J27A 5FCUH 4KRNA 4KQ3L 4TNEA 3BVVA 2PYFA 2W0FB 5AQ0A 4ZUTA 3S3JA 1NGYB 2H3NA 3WJJC 4AMKL 4WJG3 2OL3H 2VGLM 4JO4L 2V4LA 4MJHA 4TNVF 3CFDA 4GXUM 3DHUA 4BFIB 3OKNB 1DQMH 4G43B 2DV6A 2VDPL 5DRWA 4IBLT 1FQ9C 1F90L 4IHBA 4XMKL 3VFTB 4B60A 4XP1L 1K4DA 2VZ1A 3Q43A 1X5HA 1XB3A 1GGBL 4JDVB 4JO3H 3P30L 5D1ZI 3TEUA 5F6HJ 1J8SA 4PSRA 4U1SB 3VFUB 4TL5A 5SX4I 1F56A 1H5BC 1OOWA 1T3FB 4YBLB 3QQ3A 5C0CD 4IDJL 4OM1L 2Z34A 1D5MA 1Q9OB 2VW4A 3S37X 2B2XH 1QEXA 4XX1G 3TBCA 1OAZH 3OKDB 1XSOA 4ZNEA 3QXUA 4HKJA 4HT1H 5FK9A 4M1GL 2EJ1A 3HBQA 3ARXA 4HS6B 3FTSA 3T3PB 5I73B 4XN5A 2ZJSL 1R3KA 3CZGA 1T7VA 1WAAA 5KBLA 4L1BA 3DV6A 1P7KA 2F7QA 1SOQA 4A7GA 1W6LA 3F64A 4OD2B 2EDFA 4FQ1H 2Z3FA 3GMNA 3EUDA 1KCWA 1DDTA 2G5RA 5HHNB 5K1JA 3RVVD 3HZVB 5E6YA 5IJKC 3TGXA 4HJJH 3T1FA 5KANI 2N56A 4LLWA 3FQXB 5BVPH 3UTQA 1CT8B 1JXGA 4OFPA 4YHKH 4U1KB 2OMVB 3ZYJA 4BELD 2MCPL 1BCIA 4N2FA 1NCAL 3UC0L 2HLFC 2IPKB 3QO0A 5B7FA 3BW9A 1DBBL 1IX2A 3GHEH 4FKEA 4JHUA 5F88A 4ZZFA 1KC5L 1UCBH 4UT9A 1I7TB 4PVBA 3ML8A 4WKZA 4X4XA 3L95A 4L5FL 4Z77B 4JPWH 3QWOB 1B0IA 3ULVL 1H8NA 3NCJH 4OZGA 1DVTA 1T1ZB 1U58A 2NY5L 2F5AL 5JQ6H 4UIKH 3D08A 4JANA 2CNYA 4D0BA 4OCSH 4WIQA 3ZKMD 1QBLH 1Y18A 1TZOA 3BX7C 1SHMA 3KS0J 2LV4A 4KH9A 1HZHL 4R7DB 3TIDA 2EDKA 4PUBL 3RWGA 3TPKA 3JTSB 4MNGE 4QWWD 5BQ7B 4G72B 5DJZB 5JMRA 4YDJB 3F05A 4MQSB 1SEBB 4PJFB 5GGSA 4HYTB 2NXYC 5AZEL 4GFXA 4WNJA 1J18A 2HLEB 5EO0A 5LBSL 4LDEB 4Y2DD 2IV8A 4LHUG 1PY0A 2VDOB 3OPZL 1MLCB 5ERWA 2CGRL 1JMXA 1PJWA 2O5ZH 1AQ8A 3U0TA 3LN5B 2A74A 1UCTA 4B41A 4YSRA 2F7PA 2IDSA 2QPFA 3QP3A 4ZTOH 3U4EA 3EH3B 4WJKB 3VH8A 3HS8A 1MI5A 4MJJA 2GJ6A 4ABVA 3IPEA 2FT7A 1KIUA 4FFWD 4W9GC 2CA3A 1NGPL 2Y36L 4PJDB 4KQ3H 3U4BL 2XTJB 5DYFA 2FQDA 3LY6A 4AMKH 3DOSA 1NPUA 3QUXA 1UZ8B 2FL5A 2Z7ZA 4PJ8D 3RX5A 2ZG1A 4JO4H 3DURB 1F4XL 4I7ZC 4KQ0A 1D6EA 4X7FC 1EJOL 3VFMA 2YKLL 5AOIA 2VDPH 5KYUA 3P9LB 4ZW8A 5EEZA 5I26A 2YAMA 1F90H 4IIQC 2UZYB 4XMKH 1QATA 1Z0NA 3BPNC 4BFEA 2CDEA 2HJLB 3QR2A 4F7EB 2ZKMX 3BDBA 1QRNB 3P30H 4KHTL 4JFDE 3K7UA 5DF0A 4HWZB 3QEHA 4Z7VA 4IKNA 3N43B 4C56A 4JRXE 1Z9SA 4IDJH 1F13A 1WYJA 4OM1H 3LB6C 2V7HA 3ES6B 4LHUD 1NBVL 5FFOA 1L0YA 3D2UA 4NRYB 1G4RA 5KSAD 2AC0A 3LQZB 1HEZB 2CJSA 4MZRA 1A66A 5MEPB 3GBML 1KLFB 4ZFZA 2I9LB 2ZOOA 3QDJB 4M1GH 3SYPA 3KNBB 4LVOB 2ZJSH 3L3DA 4PWHA 4U6TA 3ZTDC 1I9RL 4GG8A 3FFCD 2XWTB 5DHYA 2XZZA 2XN9A 1Y0LA 1M9SA 3BDYL 4HU8A 4YHYC 4PV1C 4CKQA 3OKOB 4WK2B 3ME0B 3MDJA 4YHLL 5IB2A 2WGNB 2VQ4A 2BNQA 2WKOA 4GW5B 1JN6A 5EUOF 1G5AA 1URLA 3CDYA 3GSRA 4TTDC 1WF5A 2GK0B 3ATBA 5AVWB 3ZQ9A 1NCAH 4BK5A 3UC0H 2OR8A 3C60C 5KVEE 1BZ9A 3C5SB 5EN3A 2VN6A 1AKJD 3PABA 1DBBH 3ARDD 4UNIA 2V2WB 4KFZC 1KC5H 3R06A 4WI4A 4IMLB 2H9GA 2XWZA 5J6GB 1TTAA 3BIKB 2NT1A 3DLQR 3QDAA 4L5FH 2WQVA 3MJ6A 4YE4H 5EU4A 3IGKA 3T77A 5GZNC 3ULVH 5GRWA 5A2FA 3TZVC 4X99A 1UWEL 2FT6A 3UTSB 2OSYA 2NY5H 1JGDB 2F5AH 3BP5A 4OFYA 3WDHA 2EXTA 1S6NA 5HJ3B 3UP6A 5K9OA 1KGCD 2P47B 5LDSA 1CE6A 1HZHH 3Q1SL 4CVZB 5DJDA 2X9YA 3GUTA 3S96A 1ZE3C 4PUBH 1HKLL 2ZWKA 2VRAA 1BXVA 1P9MA 3FCSB 4HJ0C 4ZTEA 4ZW6A 3EHBC 5TDPB 4QAMB 4OGXL 3CH1B 3MRIA 5GZOA 2QT6A 2PR4L 3F01A 2XV6B 1E9QB 5E2TL 1KCLA 5AZEH 4GI8A 2VZ3A 4OJDH 1QTYT 4FZ8L 5LBSH 2P8LB 4JL2A 3OPZH 4PGEA 5C6TL 5HVGB 3OR6B 1ERNA 5HYSB 2DAVA 2CM5A 3L3GB 4NQUA 3RILA 4Z18A 3VO0A 2HFTA 3WV0A 1WZLA 4HCGA 1O75A 4AQEA 1AANA 3BZ4A 1B0RB 3QS3A 3PJSB 1JWMB 1DFBL 4Y4HD 3GK8L 5EO1A 3B9KD 4OJEH 4F8LA 4N90D 5DC9B 4BA0A 1O9ZA 3BWUC 4NHUB 1KTDA 2YK1L 5KVFE 1NMCB 1I1FB 3BIBX 2X2HA 5EUOE 1LWHA 2AV1A 1NGPH 2Y36H 3OKEB 2YIHA 3HKFA 3U4BH 1FVEA 3RGVD 3KD4A 1BBJB 1I8AA 3P73A 1JHLL 3VXMA 3NJVA 1B9ZA 3NZUA 4Q9QL 4YBLC 1VAHA 1YYLL 3HLKA 1GYUA 1JPTL 2AERT 3OB0H 4FHBD 5E8OB 1EJOH 4WY7L 2YKLH 5KN5A 4N2EA 3TH4T 3K5RA 4ANWA 3GSWA 3QFJE 1P5VB 2WIIA 1ORSB 2VO5A 4FI8A 4Z7IA 1ZDSA 3IXAB 1DVSA 7FABL 5I73C 5IQ9B 1R19A 4KHTH 4ZJ9A 4G59C 2XU9A 1SF3A 4HPHA 5CJXA 5FO8A 4GUOA 4DKEL 2ZT9C 4XCYB 3O2VL 1HH9B 5C09D 3DMMA 3DO7A 4LAQL 5EU6E 1FZJB 1EGJL 4K9JA 1YNTA 1BOYA 2AK4D 2YXMA 2IIJA 4PJ9B 2H47C 5JORB 3GBMH 1HXKA 3V0FA 4K3GA 1L9MA 1QVOB 1I82A 4LGPB 1A0QL 3IJYA 5IHUL 4Z1PA 5JDJA 1I9RH 3F5WB 3N85H 4YC2C 1KXHA 1EHAA 1KCRL 2XG5B 3TO4A 5LXVA 1ICTA 1ZOXA 1NJ9B 4NCDA 3QC5X 4HXBL 1LM8V 4B9CA 4G8IA 4YHLH 5LCVL 3K5SA 1VEMA 3TV3L 4H2CA 4Y9EA 5B38G 3HC3L 2KHAA 3ZVVA 5T1KD 5DEGA 3FU6A 3S35X 4K9EC 4K8RD 5JPMA 1JPSH 1JV5B 2VDPB 4N0UE 2J2ZB 3TBYA 1JYWA 4MX7A 3K71B 3H2QA 3L5XL 4ORGA 1X4XA 3EBAA 4QHLA 3PHQA 1CDHA 4AEHL 1VGKA 2VR8A 3OSKA 4NKOA 4ANVA 1UB5B 2BC4B 2XCMC 1J48A 4X6CF 1UWEH 4AJYV 1R3LA 4K7FA 4WAFA 5EBLB 5C2BL 4F2MB 4XHJD 1DZ0A 3EYVB 2BZCA 4Y2OB 2OZ4A 4MNQB 4CMMB 1QBBA 5T1MA 4PJ8A 3Q1SH 4HCFA 3ZIMA 4NUGL 2I27N 4B9KC 1FL5A 1IVLA 5CBAA 2WN3A 4I48A 1HKLH 1SY6A 3WNJA 1UKQA 4ZRGA 4DF9A 4HUCA 1AXIB 4OGXH 3HVNA 1PF3A 3VTMA 4XCEA 2PR4H 1CXEA 1OY3B 3S98A 3JWOC 1W2KT 4IDLA 4KZCA 5E2TH 5KVGE 1W0VB 2V2TB 2KZWA 5DK3A 2DKUA 3L3JA 4FZ8H 3N2JA 3ZR5A 1HZLA 2BNRD 3BAWA 1J8HD 1M1SA 1OM9A 3WDJA 3NPSB 1KUMA 1HL4A 2BXYA 2XTJC 2WYHA 4Q2ZB 2WVUA 3D39D 4BE5A 3UJJL 3U2SB 3AS3A 4OUUB 3BVXA 4TMPA 3GRWL 3NP4A 5FDWA 2J21A 3AG1B 3DX6B 1DFBH 1ZHNA 3GK8H 4PW3A 5AW7B 3SDYL 1N26A 1CGWA 3BAJA 2HX8A 3IGAA 4AV5A 2DTML 3SCMD 3ARBB 4G8FA 4WK4B 4AQ1A 1X44A 2YK1H 2E5EA 3NTCL 5EZJB 1UGKA 3RNKA 2XPGB 1JG9A 4IU2B 4JFSA 1I8LA 4X5PA 4JVUA 3QUML 5K9KA 1JHLH 3F85A 4N2LA 2K8MA 4UT6A 4Q9QH 5DFVC 2DQMA 5JYLA 2Q86B 1NICA 1YYLH 2KERA 5SWZE 1CLCA 1JPTH 3V0JA 4L48A 2DJMA 4YK4B 3PFUA 4WY7H 1T21A 2NY2D 1KB5L 4AKPA 4NWTL 3GSOA 2NW3A 4MD0B 3B5HA 1DVFA 7PAZA 3U1SL 3U7AA 7FABH 2BSRA 3D25A 4I5BB 4X6CE 2EC9U 1WBXB 1I8MB 2K6WA 3B7RL 4XAKD 4DKEH 4FABL 3I2CL 5FA4A 1KJ2B 3O2VH 4PV9B 2HKFL 4BSVB 5C9JB 2FLRT 5I5IA 5JXAH 1BDYA 5FGBC 4QO1A 4LAQH 3VNZA 2CD0A 4MAUL 1EGJH 1QO3B 1WQVT 2FR4A 4WUUB 3BAEL 1OTTC 1UQSB 1A7BA 2KKQA 3LIZL