5EEYA

Radiation damage to the trap-rna complex: dose (dwd) 11.6 mgy
Total Genus 11
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
11
sequence length
69
structure length
69
Chain Sequence
NSDFVVIKALEDGVNVIGLTRGADTRFHHSEKLDKGEVLIAQFTEHTSAIKVRGKAYIQTRHGVIESEG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title RNA protects a nucleoprotein complex against radiation damage.
pubmed doi rcsb
source organism Geobacillus stearothermophilus
molecule tags Rna binding protein
molecule keywords Transcription attenuation protein MtrB
total genus 11
structure length 69
sequence length 69
chains with identical sequence B, C, D, E, F, G, H, I, J, K, L, M, N, O, P, Q, R, S, T, U, V
ec nomenclature
pdb deposition date 2015-10-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02081 TrpBP Tryptophan RNA-binding attenuator protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.50 Mainly Beta Sandwich Immunoglobulin-like TRAP-like 5eeyA00
5EF1A 1GTFA 2EXSA 2ZP8A 5EEXA 5EF2A 2ZCZA 2ZP9A 3ZZSA 3AQDA 5EEYA 1UTDA 2ZD0A 1WAPA 3ZTEA 5EEVA 1QAWA 5EEUA 5EEZA 1C9SA 3ZZLA 5EF0A 1GTNA 3ZZQA 4B27A 5EEWA 5EF3A 2EXTA
chains in the Genus database with same CATH superfamily
2B39A 2OCFD 5DHDA 1WBZB 3FHQA 3UTPD 2Y1VA 1QG3A 1FVCB 5ICZB 1TEGA 2WXNA 4DOHB 1OP9A 2XZCH 3GSXB 4LRNL 1XF5B 4X7TB 4XVUC 3TZVD 1JZ6A 4MFHA 1WD9A 3BRFA 2BNRA 4R26H 3RQ3A 4BRVA 1BVKB 4RH4A 4CBPA 3ZYZA 4OGAD 4ZS6C 1N8ZA 5EBGA 4JZOA 1KGXA 2QKIA 3NA9L 4ODWA 4A7QA 1FNGB 3LKNA 5I0DA 2ICEC 3PFQA 3QJZA 3U48A 1W6LA 1BZDA 4JQIL 5D2LF 3LEVH 2D8KA 3IKCB 5D7LB 1NIFA 2ZSWB 4H20H 4TNWF 5HHMB 2EKSA 3N1QC 5HDQL 1MREH 2HFEA 2LVCA 5JHBA 2BZ7A 2UY7A 3EO0A 5E23A 3FFCE 4M5YH 3RP1A 2HT2D 1UXSA 3S5LB 4F3FA 3QDME 1YYML 3IFOA 3SY0A 4M61A 1RZIB 2P5PA 4L48A 3BVWA 4OKDA 4IDJL 4UIMB 1ZAGA 1YPZA 1VEMA 4JY4B 3UG3A 3QNXA 2QLYA 4KNSA 1UD4A 2V9TA 3H2QA 3OSVA 3ZDZE 3KGRA 1F6AA 3C6SB 3DETC 3F7VB 1RZJH 5C8JB 4U6TA 5GISL 2DIEA 1D5XA 4NI6A 1IM3A 5FECB 2KZKA 4QRTB 3L4VA 1N12A 3EIFA 1QRNA 4ERSH 2NUPB 3M86A 4PWEA 5DD0H 1Q9LB 3BAWA 3VW3H 3OGCA 2BNQA 1QAWA 4WGWB 1SDDB 2XACC 4MMXA 5HYJB 1F1AA 1WFOA 3RI5F 5KVGH 3E6FA 4B27A 1ZHBA 2EE2A 3NIDB 2ZXBA 5IQ7L 4W9DC 3RVTC 2DLIA 5TDNB 3PWJB 1E9OA 4M8RA 4LO9A 4NFBA 4Q2ZB 4E9QA 1QLEH 2FEEI 2FL5B 1R3IL 5I82A 4ETYA 2CHNA 2VH5L 5BZDA 3BFOA 4WW2F 3CSGA 3KDMB 3G6JE 1V10A 1U8IB 1G6RA 2EZ0D 5KSVA 1WFIA 2GEQA 2KMWA 3H3KA 3EOTL 1W15A 3EGDB 4QI3A 4F33A 3NJLA 4JDVA 3PRZA 4TSAH 3J27A 1OE3A 1PZ5A 1QOKA 3I9GL 2XXCB 4HLZG 4K7PY 4OI9A 5FEBA 2XWTB 1IGFH 3QO1A 1ZA6A 4PD4J 1M6OB 4UIMA 4QT5B 4IOIB 3SDAB 3N1PC 1CD8A 1T21A 3UTZB 1USQA 1S9YB 3F01A 4J4PD 5DD5L 3VD4A 3PAYA 4PRPE 4JPWH 4MA8H 5CEZH 1MCFA 3LIZL 4BJLA 4PJCE 2PPAA 1X9QA 5CN2A 1QBMH 3RX9A 3C5ZC 2JMRA 2GBUA 3DO4A 4JRWA 1BG1A 1G5AA 5GZND 3G6JF 3RL2A 3T2LA 4YFEA 2ZXCA 2O6CA 3G08A 4H4NA 3U4AA 4KVPA 1QEWA 3QUYC 1OXYA 2X0UA 4L5FE 3BO8A 3A67L 4LZKA 5H37A 2WXOA 3C6LA 3BT2L 5I75B 4ONOA 2EDWA 3L3HB 3RFRA 5BS0E 5DMKA 2CJUL 3RWJA 4LHUA 4PV8A 2O5XL 4IS6B 4UZUA 1PX4A 1CFQA 3LHPH 4ZSOA 1SYVB 4HEPA 4IEFB 1EXGA 4HUMB 2BDNL 1N10A 3L2MA 2CZNA 2F7IA 5D1QD 3OWRA 2SEBA 2EEAA 5LGYA 4PWJA 4OD1H 3D0AA 1JZ5A 4L5FH 3MRLA 5IWLA 1HX0A 1U8HA 3T2NL 3VU2A 4RGOH 1XIWA 1PSKL 2JKRM 1OGSA 2HWZL 4XBEL 4UOW0 2ZUXA 5D1QC 5C09E 4LLDB 2AEPL 1Z5HA 3QBTB 1TENA 4IBQA 3AMKA 2YQ3A 4HJUA 1KCRH 4ZO7A 1IM9B 2AJ3B 2DLHA 1JZ2A 3FQWB 4R26L 3H7BB 4UB0H 4QRPD 1FHGA 4UB0L 3IJ9A 2A77L 3NJXA 1KJ3H 1PKQE 2Y6TE 4G7YH 1B0WA 2WB1A 3BN3B 3PV6B 5F6HJ 3OKDB 4IRZL 3RX7A 1OAKH 3B2VL 4Y7MA 5C6TH 3FOMB 2ATPA 4GSQA 4MXVF 4ZO6A 4POYA 3N0PB 4Y4KC 1H6TA 4NZRH 4G6MH 4D9QE 1CXEA 2GABA 1FNLA 4WFGD 4R7NB 3S7GA 5KSBE 4AIXA 4QD2E 4M9OA 1DN0B 1G9NH 2ZICA 4I0PB 4Y7OC 3GGWA 1QLRA 1NCHA 3PV7A 3VXTA 4FQHA 4Z7WE 3ZJAA 1P53A 4ZMNA 4U6YB 2GY5A 2DIJA 5T5NG 2EIDA 2YSSA 3I2CL 4H8VA 1M7DA 4TQHA 2JJTA 1C5DB 5DCCA 2WQRA 4AEIH 2A9NH 1XGRA 5LDSA 2BLFA 5CU5A 3F62A 3K4ZA 3PP4H 3C2AH 3U0TB 4ZS7H 3HZVA 4BM7A 1NDMA 3MFFB 4JE4B 4HG4J 2GJPA 2WYZA 1X7SA 4L8DA 1GOFA 5DR5H 4JG1L 4KTGA 3GD1C 1NCJA 3UG4A 1CDUA 4GIPD 1U3NA 2DLEA 4LOVA 1ECZA 2LV4A 3U9WA 3VQ1C 4JO4L 3NH7L 1UWEL 1A6TB 4NQQA 4W9JC 1C5CL 2ZT9C 1TITA 4Y8AA 5DC0A 2JSFA 1FL3B 1YMHA 1NH6A 2H8PA 3QUHA 3SKJL 2PXYC 1MEXL 5IHZA 5GRJL 3LPOA 4Q9QL 1CGWA 3K4AA 2ZKHL 1BOYA 4XCFL 1PZ2A 4HPYH 5D96B 5AVXB 4LASH 5TF1L 4NC1E 3GBML 5FF6A 4JKNA 3OB0H 4LLQA 3MCKB 4A7SA 4D8OA 2WLNA 2VXUH 4MAYB 3EJQA 4OM0H 1KYAA 3IN2A 4OCWH 1EHXA 1KC5L 1NFDF 1UZGA 4OCXH 3N9GH 5J12B 1TO5A 1DN2A 4I0KA 3TV3H 3RFZC 1HILB 3ASWA 4LNVA 3UG5A 2XOTA 2OK0H 3LEXA 4E2OA 3G08B 2G60H 4AQEA 3NJIA 1QEWB 3FC8A 4EMZA 1J1PL 4LSPH 1AXTL 1YNLH 3NFSH 1UJTA 2OMYB 3JWDC 2YRPA 3DI2B 3KCPA 1BGXL 5C0AB 1T2QL 4ALAC 3FW6A 1CI3M 3MNWA 4Y16A 1AGDA 1XH3A 3G5ZB 2HH0L 2XTSA 3QUZC 3U79A 4NBYB 4JFFE 4OV5B 2Z31D 2UZXA 1RU9L 4AYDC 4FQ1H 1RMFL 3MRJB 1A6PA 4G42A 1BVZA 4KTEL 4RQQB 2WAHA 1KCVH 5TGBB 3SOBH 1GOGA 3ARED 3ARUA 4DVBA 1XEDA 3O6MH 3QISA 4DQOL 3DARA 4ZJ9A 2P5WA 1O7DC 4JO1H 4FQXA 2BW5A 4U1HA 1KF9B 1C12A 1FJ1A 3MBEB 4QHLB 2VISB 4LSSL 2WQVA 5CD3A 3VXQB 3LKSA 3PFUA 1ADQL 1R4XA 2ZCHL 3UABA 5B38B 1NEZA 1JGDA 2YPKB 3TS8A 1QVOA 2WC7A 5LGJA 1C1EL 5DZ9A 3CNKA 2HN7A 5GGRA 1OM3L 3E1ZA 1I7TB 4X9YA 3FQWA 4RIRB 2XVBA 1WD8A 3ECWA 3GBNH 1Y6MR 3DJZA 4NNXB 3L3DB 3SQBB 4N2HA 4GP5B 5CP7A 4G1EB 1WHOA 3RGHA 3TP4A 2A1WH 1JGUH 1P4LB 4IRZA 1HL5A 3CFNA 1R6VA 4XCEA 3ARSA 5ALBH 4ZMOA 1SF5A 3EYOB 4I89A 4Z3FA 2QVFB 4GW5B 2P1YA 2EDHA 4G11A 1EWHA 2I9LB 1U3YA 3NZSA 5CJOL 3PABA 3QCUH 3TFBA 1FAIL 1RZ8A 3KBPA 4LL4A 4PJGB 3DGCR 3L3GB 5EA0L 3IMWA 3EOBA 4XVTH 5GJTH 3QZWA 1S9XA 1ZTXL 3IDIB 5CWSB 4HSCX 4JO5A 1UWGH 5E6IA 5EUOB 4J4PA 3FSZA 4PRPB 2C3GA 1H19A 4UT6A 2KDGA 1HOCB 5DJ0A 3GM8A 3KGTA 5DFAA 3CC5A 3N41B 2W59A 2A0LD 5FYKE 3V5KB 5DHYA 2BVOB 1XGRB 3OXRA 4QXTA 5E8NA 5BS0D 4ICWA 4CC4C 1T1YA 4K5OA 4U4IA 5IV2B 1SF3A 1L5GA 5GGQL 4Y9CA 3KNBA 3K72B 3CIAA 4M7ZB 1H6EA 5DURB 2JIXA 4Q0XH 2IWFA 5IW1B 1CFSA 3F65A 1IEAB 5IB5B 1CLYL 5IESL 2CNYA 5F7FA 2A6JB 5HI4C 4HJ1A 2FBJL 5GRUL 2OSLB 2WLLA 4M3HA 1T7ZA 1GZPA 3QDJE 4H1LG 4DOHE 1E0OB 1FL3A 2MCG1 2B9AA 5KVGE 4OM1L 2BNQD 3AADB 4QF1A 3AY2A 2W9LA 4NO2B 4QUOA 4KKAD 1G84A 1UC6A 4PBDA 1UQSA 4NFDA 4QRPE 3TNNA 4PJHE 4F3FB 1A8ZA 1MAML 4DP6X 4J7RA 1NA8A 1SDAB 1IM3D 3NZHH 3RURA 4Q9QH 3QUZA 5I76B 1FDLL 4EN3A 1NKRA 1UZ8B 1IARB 3LMJH 2K45A 2VJ0A 2YPLD 4XBPA 1LE9B 3RWHB 2QLVB 4H13C 4HIJB 3CH8A 2RAMA 3KPLB 4JZJC 2HAZA 3LS4H 1U3HC 3SGJA 4HK0A 4BUHA 3PHQB 1E5CA 1U8KB 2YMTA 4JRLA 3IDXH 2A74B 3VXMD 3WNKA 3HUJF 4MA3B 4MJIE 3QSKB 4PJEB 4WTZG 1BX2B 4R8WL 3NFNB 1MJUH 2RA1A 1YC7A 2OYLA 1PBYA 1FI8C 1OB0A 3L3IB 1QLEB 2OTWA 4P9ML 3IXTB 5TQ0L 1DQDH 1EJ6A 5IB2B 1YECH 4LSRH 1KB5A 4ZOCA 3H0TA 2C3WA 2JXMB 4MQ7A 4ORGB 4RZCB 3SKMB 4PUBL 2IG2L 2XI9A 3TO4A 1DQJA 1P9MC 2OMXB 2EH8H 3VFRA 2NYKA 1TFPA 1HSBA 3EAKA 5ID1B 4AV4A 5GZOC 5D4QA 1TJHH 4XNAA 3S96B 1KCVL 1XCTA 3SOBL 1FPTL 2FD6L 3D2UD 2CK2A 4G71B 4L3FA 2IDFA 4FLOA 4YDIL 1RJZB 1MPAL 2FX7L 2R2EB 1IBHA 4OQTH 4XMLL 1Q1JH 3UTTD 1HQRA 1BQUA 2ORBL 3WUWG 5BRZA 2MHAB 2VDPL 3VRJB 2GSIA 1EUTA 2YGNA 5FA4B 4O58H 2VT0A 1S7VA 3HMXH 4MD4A 2AEIT 4PJ8C 1YMME 5BRPA 4RRPA 4DGYL 3L3DA 3HJEA 3ISRA 5M7QA 1S2EA 3LB6D 3K6NA 1GW6A 4J3VA 3QEQB 4G72B 4OR1A 3QXDB 1QX1A 1SXCA 3EBGA 4ZMAT 4Q6IC 1P7QD 2X05A 3H9SD 3HRZA 5LBGA 2EDTA 5TQ2L 4TV3A 3TCXA 5ID0A 1OL0A 4KKRA 4N9GA 4J2QA 1KJ2A 3ZL4L 1A9EA 4PREB 4ZXBC 5KVEE 4FTVE 4MWFB 3HG1A 2IADA 4IU3A 3RVXC 1CL7H 2B14A 4ELKA 2R2CA 2O61A 1S7TA 3NAAL 2EDFA 1CLOL 1UENA 3KW8A 2D0FA 1UA6L 5C7ZA 4P2OC 1O7DE 3VI3F 4Y2DA 1TOXA 4KJYA 1LMIA 4P46B 1JK8A 4BE6A 5DS8A 3HRPA 2FNBA 2QPUA 4LAQH 1YHPA 1YEEL 3SDDA 4IK7A 1X44A 3S88H 2XCMC 2QGDA 3AY4C 5DA4A 4FADA 1T6VN 3BWAA 3S88L 2YK1L 2FWSA 3ZIMA 3CSFA 2GTZB 4PRNB 1PPIA 3WAKA 1U8HB 4IMKC 3B9EA 1CO1A 4HIIA 4S1SH 1BYNA 4U6HA 1GGYA 1NCBL 1BLIA 2XZQH 4LEEA 5HTSA 4ZTEA 2F8XC 4FQJH 4H44C 4LKXA 5HGDA 1AD9B 3QZOA 4O5LH 3MVSA 3DSFH 4HWZB 5F1SA 1CK0H 1T6BX 2NY2B 4FFYA 4DP9X 4UQAA 4M7JH 3VVVA 1FRGH 2WVSA 2Y72A 1GY2A 2ESVE 3KBFA 4N8UA 3IJ8A 4L9LB 4NUMA 4DKEL 3PREA 3OAZH 1HXYB 1IJ9A 5ADOH 1VERA 5EU6B 2ZWZA 1TR7A 2F5BH 2CH8A 3MV9A 2IFFL 3KYAA 4I3RH 2EKJA 2E7LC 1HZHH 3CBKB 1IUZA 1LGVA 3KR3H 2AV1A 2YZ1A 3NIFF 1TPXC 4G8EA 4LLVB 5JNYA 1N68A 1SN0A 5DU7A 3QXUA 4B9ZA 5FO9B 4Z0XA 1ZT1B 1OOAA 2W07A 2W0PA 3LPFA 2EO1A 3VXTB 2C4FT 5C3TA 3BUYA 4HGKC 1A3LL 2P46B 1KBGL 3GWJA 4OKVA 1VZGA 4XNZB 1MNNA 5DRZB 3G6AB 3Q7JA 4AE1A 1QBLH 3LOWA 1YNTF 2Z93A 1WZKA 3UGEA 5HYQA 4TRPL 2J1WA 2BHUA 4ODBD 4RSVA 4MAYD 2UVFA 4OZ4B 4X42A 3WUZA 2CPUA 4OJFH 1E65A 3UX9B 4YHNB 5J4MA 4ZXBD 2CMRH 3GSRA 2WLKA 4GO8A 2E7DA 2Z4TA 2CUMA 1T4KB 4HYTB 1BWMA 4UV4L 4BZ1H 3HCVA 3UAJC 4KHXL 4WUUE 4CU6A 4OLVL 3ABMB 4EDWL 3ESVF 4OVVA 4N3UA 1FHNA 2TSBA 4PGDB 3SE4A 4W4OA 3LZOA 4OZHA 1PKOA 4GRLC 1IBZA 2G0LA 4YXHH 2WY3B 4Q58C 4Q9CA 5EZOL 2FT8A 1T20B 4NZUH 1FFPA 5CBAA 5EZOH 2BP8A 4KMTL 4LDLB 1QI5A 5E4AA 3BHBA 4JNXA 1A6WL 4KJWC 4HHAA 3TPUB 1DBML 3VXUD 3G5WA 1QLFB 5ABDE 2ZJSH 4L1TA 4NQXB 1CDGA 5D7IA 2QQKH 4ONGH 3F5WA 2Z91A 1MCOL 5F71A 4F33B 2YWYA 1TZHB 3PWLA 4XRCB 4YDKL 5HJDA 1BFVL 2ERJC 4P2OA 5IFAL 1YY8A 3WNMA 5K1JA 2BXYA 1PD0A 1TJGH 3HC4H 1E3XA 2A9ML 2Y24A 2V7HA 5IW6A 5E6YA 4Q56A 3BH4A 2YAMA 3QWOB 3QA3A 2XY1A 2ZYHA 4HZAA 3MLSH 4U1KA 4ZX6A 3PYCA 5I1AA 2HKFH 3TIEB 3OZKA 4OIFA 1MCDA 1A4JB 5DJCA 4CJ0A 3VDBA 4Z8FH 3V0AC 5FGCE 3ETBJ 3MZTA 3DV6B 3M46A 2PCFB 4ODUB 1QI4A 4TTDC 3FTSA 3R0NA 4C8XA 3O3BB 2CU9A 2ZKMX 2ADFH 4A55A 2D2CC 5TDOB 4BZYA 1YG9A 4YSPA 1EJOH 4JQXA 4K3JL 4TMPA 2OP4L 3ZE2B 4L2YA 5AALA 1SMDA 3SO3B 2LFEA 4APXB 5J11C 1UA6H 1KYUA 2MH4A 3LXUX 1QATA 4BD4A 3BIKB 4OF0A 2R69A 8FABB 3IDYB 2ZCKL 3V4PH 5IGXL 3R1GL 2KPNA 2JQZA 1KJMB 2DRUA 4NLHA 3HZYB 3QE5A 4L5FL 4ZUVB 5LAPA 3C87A 4DCQA 5AAMC 4TM9A 3KHOA 2ERJB 3TONA 2VDNL 3CHSA 2X1XR 4NSKB 2FNWA 1J8HB 5BO1L 3L1OH 4A7TA 1NC4D 2VAAA 4L4VD 4JFZH 4AYGA 1SMOA 3LN5A 1FNEA 3QUML 3L5WB 3PGDA 2AHIA 3U6XA 2HP4A 3LJ3A 3P73B 1MCCA 4G1EA 4BQ6A 1LHZA 4N4YB 3QIUD 4FQLL 5E5MA 3Q6GH 4AJVA 4PV9A 4UU9B 1U6AL 1AQDA 2IAMC 3D50A 3EW3B 1N59B 3ZHNA 2PYEA 5T3XE 4DKEH 1K6QL 4KXZI 1MW1A 2I9LA 3MBXH 1IC0A 3TXAA 3WIIL 4I48A 3N85L 2FWUA 1OP3K 2OAAA 3GFUA 3AGVA 2A99A 2DQFA 2XIDA 3UBFA 3TEUA 4FQCL 1A6VL 2F7RA 2A0LC 3V9FA 2NUTB 1A3ZA 3KYNA 3IDYC 3EO9H 4KUCF 2IJ0C 4LVNC 4YZFE 2F7QA 4P2QD 1ZA3A 4XO3A 4NO5B 3KWWA 1AANA 3KPTA 1BEYH 2QMKA 2VW4A 1Q0EA 1JTTA 5BV7H 2L3BA 5MP6L 3JV5A 2BOLA 4BQ9A 2JCCA 3ULUD 4R7LA 4XVJL 5KSAD 1NAMA 4Z7NB 2GJ6B 2HUEA 2GSGB 1FZMA 5LNEA 3NCFB 1ICTA 4QRRA 3GSOB 4EI5C 1KGJA 4ERSL 4FDWA 1MZZA 3FB5B 1ASQA 3ARPA 3GIVB 3NA4A 4JFEB 3DXAE 4M3KB 3TN0A 4WI4A 25C8H 3NBNA 4YZFF 1Y7VA 3LN5B 3Q2LA 2R15A 4PYGA 4XBGB 5FYJD 3RPBA 2BIIA 4NUPA 3RZWA 3A4FA 4JFYB 4WTXA 4P5TA 1ZTMA 4HH9B 5F6IB 5JUEH 1Z9SB 2ENQA 3S34L 3DOSA 5CIPB 1XD0A 1S8DA 1HZLA 6TAAA 1UQSB 2K3HA 3TO4C 4KMTH 1OAXL 4LOFA 3STZA 4N2KA 3F5WB 4HXBH 2IOOA 3K6FA 1A1MA 1M3JA 1XH1A 2C3XA 1NBCA 4EQ3A 1AR1C 1HWHB 5B7FA 5K9QI 4PB9H 1DCEA 5EZPA 4CBZA 9CGTA 2Q3XA 1IAKB 3FB8A 5H4ZA 1N2RB 1QSVA 4HKJA 4LAJH 5IIEA 4LLQB 3FQTA 3DMMA 2VMFA 3GXTA 3LPPA 1T0MA 1I7RB 2YSSB 3IMVA 3QHZH 2OJEB 5ESAB 3HMWL 2WQSA 6CGTA 1JUFA 1U8NA 3C8HA 5L2KA 2NR6C 4OJAA 2N0MA 3JV4B 4P9HL 1DP0A 4ZSOE 4KKLC 3PAVA 3BWSA 1KXQA 2HX9A 4WEBL 2NCMA 3HE6B 4F7EB 1UM4L 1KB5B 5FDYA 4ZMVA 3S37H 1A0QL 5CGBA 3WD5H 3RPIB 1K4DA 2WHVA 1OT1A 2W9EL 2BOBA 1W80A 2AFNA 5HHMD 3GINA 1RPUA 4YPJA 1X7TA 2UWEE 4EXKA 4YK4B 2NY3D 2R1YB 2IPKA 5TE6H 5I73C 4BFBD 4P5KA 3CFQA 4AXWB 3GHEL 4OCSH 1BVLB 1VPOL 4X80H 5DJ2A 3MLYL 3IPBA 4OD2B 1NC4B 2J12B 5CGTA 3VXSD 2CUIA 2ENSA 2MHAA 4ANKA 2R2HB 5DRNB 2QTEA 3GB7B 4RFOH 5DUBB 1KN2L 4M8QA 3CSYA 1LDPL 2OQJB 4JDTH 1OANA 2E76C 1P4BL 3S5ZA 3CLFH 3IMBA 4LGRB 1XL4A 3STLA 3QCVL 3GBLA 1RUAL 5BW7A 4A68A 1JV2B 1MELA 2DL9A 3CQFA 4ODXA 4Z7WA 5FYLE 3UDWA 4J5VA 4X0NA 4XZUA 3D51A 1S7SB 5DK3A 2CRYA 1ACYL 5D7KE 1XL6A 2XUWA 2G60L 3U36B 3QFDB 1XSIA 3H1ZA 3BKCL 3HUJB 1OW0A 5DK2A 4Q6KA 1HJCA 3BH9A 3N85H 4PRAA 3ILPB 4WKXA 5F88B 3G5ZA 1JTOA 4WEUD 5I30H 3P69A 3BH8A 4FNLH 3A6OA 1ND0A 2YQBA 2P28B 1AOHA 4FFWC 5EZJA 3FRPA 5B38G 3RFZB 2CO4A 2IBZY 4HETA 4DQAA 5FKPA 1ZEAL 3GT6A 4NPYB 4L4TB 2RGSA 1WT5A 2OXHB 3HHSA 3QDHA 4N25A 1KN4H 1M1XA 3ILDA 4BSVA 1K9TA 1FFOB 3IWVA 4QXTB 5IY5B 1LEGA 1NAML 2CGRH 4HUCA 2BJML 4TVPH 1FGNL 4N1EA 4UM9D 5DXWA 4P04A 3D85B 4MX7A 4M93B 4PY8J 1ES0A 2DI8A 1OOWA 4XVJH 5T1DH 4LGSB 4X7EC 4IBUA 4LMQE 1KGUA 1M9WA 3NIGF 3FL7A 4U1GC 4EPSA 1ZKAA 3E9TA 3V8OA 3NRQA 2XQBL 2OMUB 5LXVA 4QGTA 5GGVY 4DTGH 2WTRA 3LH9A 4PGBA 3ZE2E 1CD0A 1KBWA 5EEYA 2R23B 1OTSC 5H94B 4EJ1C 1VEPA 1ITCA 2JI3A 4QXVA 5DZJA 3V79C 4IKNA 5DLLA 2SODB 1SBBA 1FQ9C 4RETB 4G7SB 5HI5C 3WL9A 1CYGA 2A1WL 1I8LC 4Q9BA 4XPBL 1OM9A 1J9SA 1AQKL 2R7EA 1KYOK 3FU5A 3WO4C 2A6IA 1ZLWK 1T7YA 4Z0BH 5IHWA 1NGWA 1J05A 2PUQT 4AVIA 1I9JH 4Y5VA 4F7TB 2AZUA 5F9OH 1XCWA 1NIDA 4HXBL 4H1LH 2VXQH 4QHNB 2R0KL 3ZZSA 2VXQL 1UURA 5I8OL 2X0VA 2YBRB 4FP8L 4HJGB 4ZNEE 1MG2C 1MCLA 1GGIH 5HJ3B 4KQ3L 2ADIB 5DRWB 3ZX1A 3CC5B 4N6QA 4AGMA 4R4FL 1E4WH 1AXSB 4W9CC 3QHZL 1F4YL 1MJUL 4M1GH 4S10A 1ZGLB 4AQ8A 3FPYA 1KFAH 4YHNA 3FH5A 2X4TB 4AEHH 4XN7A 1II4E 4E9YA 4PPTA 2WLZA 3EGSA 3QQ9C 5A43C 3APMA 3NP4A 4WO4D 3CVBA 2C3HA 5LBSL 1WZLA 2E46A 2P5WE 4FG6C 4E42A 2GIXA 4RWYL 1HL4A 3ATDA 4MMXC 2FJHB 4OF8A 4LSPL 4Y4HA 4AGLA 1DBBL 1HEHC 2F53B 5KSUB 3F12A 3NJGA 1MUJA 1ORQA 2LTQB 3KGSA 4WENB 1G9HA 1O5PA 1H9DA 2WBJD 3GS0A 3GZKA 2G2NA 4EN3C 4DZBB 3DO7B 4LCUA 4JGJA 4N2AA 1ZLUH 1BQHB 1BD2E 3LRHA 1AG6A 1FNGA 4GO9A 4JM2B 5DEZA 3FQ1A 2RQ8A 2EEFA 1H0DA 3NABH 3BE1H 3MXWL 2BZCA 3QAZC 3DK2A 2XN9B 1HKLL 5DHVB 1P7KB 2EH7H 5JW4Q 2JJVA 1NGYB 2ED8A 3FUFA 4P23B 3H9HA 2XFGB 2DJ4A 2WNGA 3MRIA 4AKPA 1NMCC 1NBYB 4X50A 2DQTL 3IFOB 4C59B 1BQKA 2QSTA 1PSKH 4EZKA 5GRWA 4X9FA 5JOFB 1U92A 3GXNA 4PSPA 2FGZA 3LD8C 4N5UA 1D5MB 1JFQL 4BDVA 3GSQA 3K6SB 4RFOL 1AY1L 1JDCA 1G7JA 1OSZA 3GMOA 4DZ8B 3PL6D 1X5FA 4C47A 3L3OA 5DVPA 3U0WL 5E56A 2DJSA 2KLTA 3VSTA 2EABA 2BNUB 2QBWA 4NC0B 5D7JA 2VAJA 1UH4A 5D8JL 4Y1AE 4B53A 4WLCA 3UPRB 1KIQA 3KDPB 4HCGA 4HMEA 4ZQKB 4LIQL 1MZYA 2QHRL 2WTPA 1Q9LA 4HWBL 4YR6B 1DFBL 5B1JC 4R5TA 5K59F 3HFFA 5E2UL 4XMPL 1X9LA 4HS3B 1PCXA 1A4CA 3HJ0A 4KOCA 5L6YL 4QJ5B 2EUXA 4Y2DB 3RA7L 3T08A 5KBDA 1JXJA 3LKOB 2Z1PA 5BMFH 2EYTB 1JPGA 4CC0A 3RZCB 2X4NA 1JRHH 4KK6C 4WHYG 2EH8L 4PHXA 4BSVB 2IDCA 3TVMC 4PH8A 2GTWB 5CEYA 4YL4A 1NCAL 3PUUA 4FN0A 5E2VL 2HFGH 4GSDL 4Z7QB 1C7TA 4Z7UA 5E2TL 1K2DA 2ZXAA 1Z3GH 4PJFA 5IB3B 4KZEL 4FS0A 1VA9A 3O3AA 4PJ7B 2XT1B 4KRNA 4NQCA 1S7VB 2DBLH 1MW2A 5IVOA 3DIVA 1M6OA 3FT3A 3UPAA 2AC0A 1KXTB 1CF8L 2IV9A 3MBED 1EEQA 3MRLB 1Q0YL 4Z7VB 4ZUWB 2ICCA 5SWSE 1JOIA 3Q13A 2I60H 4KVNH 4MVBC 1WH0A 3KPMA 1JNJA 4Z7VF 3DX9A 3U6RA 2Y0SA 3PS6A 3ZQ9A 1JGLL 3IDMB 2YN5A 3SSGA 4DPBX 4HC1H 3TBVB 1VFOA 1DVXA 2NTFB 3DWTA 4HC1L 4FA8A 1LE5A 1T66D 4PBVC 3CHQA 3RKDC 1RURH 1ITBB 4HWNA 4JHBA 3MRQB 3MLWL 2O61B 3ZQWA 3U1QA 5BV7B 1P7BA 1MJ8L 4OF5A 4MMZA 3P11L 4L37A 4C83B 3BJLA 1JF1B 3GBDA 4RAUA 3KYNB 3O9WC 5D1XA 2DLFH 5DJ8A 1SVBA 5CWSA 1EFXA 5DRWA 4L2LA 1N0LB 4MLIA 2IDSA 4NM8L 5CJBA 3VGFA 4KY2A 4M56A 3MSPA 2ZP9A 4ANXA 4HALA 3FT0A 4X4MA 3ZYOA 1T1YB 4FLHA 2Z7UA 3NIFE 2BK8A 2WP3T 2R1WA 5EEVA 4JPIA 5ITBL 3FSAA 1Z0MA 5E08L 1MLBB 2X4SB 4FI7A 1Z9LA 3X1GA 5KW9H 1AGFB 1OAUL 2AJVH 4OIIL 5E99L 4QEGA 3X14B 1HINH 2J21A 3UTPE 5LWYL 5CCHE 1N6QL 2RFXA 1JSYA 2EXSA 2VRQA 3BCFA 3MBWA 2HG5B 4J3BA 2X40A 1ZPUA 4NCDA 4XP5H 5I74C 4L9LA 4XWOC 4ZT1A 5C08E 2D9QB 5AAMA 4HKXA 1X3DA 1KPUA 3RX5A 4Y9EA 1X5AA 1D9KA 3ES6B 3HE7D 1YMMD 3Q8AA 4K8RD 4V1DA 2AI0L 3NVQA 2DDQH 5JW4R 2H3NA 1OTUC 3HNVH 1OF2A 1CDYA 35C8H 3WEAA 1ZT7A 3HNVL 4JPSA 1EH9A 4G9DB 4PLKC 3A22A 2YXFA 3I02A 4TUOB 5DJZB 4AEFA 4AY0A 3ARZA 3QJOA 2A3TA 5CP3A 4X6CB 1HHKB 4DP2X 2BIMA 4BQBA 3M6DA 5KJ7E 4JUTA 4F27A 3GMOB 4X6CF 3ALWA 2EACA 4CGUB 3JT0A 5KSAB 3PNWB 5DDHB 1CG9A 5LAXB 4YXKL 4O2CB 4HK0B 3K8LA 5C71A 3GHPA 2QVKA 4H8UA 3ZTEA 3FT2A 5FYJH 4LVHC 3FCGA 3MJ9A 4PCTA 4QKXB 2ZXWB 1JPSH 1KELL 2FATH 2WVVA 3UBGA 5JPMB 4XODA 1JHTB 3WXWH 1R34A 4J3OD 1QWNA 3THMH 3K46A 1V3MA 1MLBA 3MKKA 3HZMA 4P4RB 4HVBA 3EBIA 4XPGH 4C56A 4KK5C 5JOEA 3UZVA 4GBXC 2DW5A 4CRPA 2O5NA 4ZPTB 2OTUA 3UBXB 5F1IA 5IFJB 1KV3A 2CJSA 4GXVH 4KZDL 5AKSA 3QFJE 4BUGA 4A2DA 4RAVA 3C8DA 2HRGA 2LW3A 3QH3B 2AXHA 4ZSOB 2G9HA 1R3IH 5F1NB 4G8GA 4MRCA 3BFWA 4YC2C 3RGVB 1UD6A 1QWUA 2IXQB 4J27A 4GRWB 3IKCA 2IH1B 4BWUA 4LCCB 3QQ4A 1DDHB 3F58H 4KI1A 4XNQA 5CINH 1OSPH 1QSED 4XX1E 5ECGA 4CGTA 1U8OB 2L7JA 4QLWA 1XIWB 2IBZX 4U1IB 3UIYA 3NCMA 3RVWC 4GYBA 4ONGL 4JHWH 3RY5A 4ANVA 2ZOOA 3N1FC 1CLVA 1QKZH 2DZEA 2WYHA 1KCUH 2EIZA 1ZLDA 3B9AA 5FF6B 5ABAA 3VJ6B 4AVHA 3ZPDA 1NEZB 3ARDD 3FCTA 3HLAA 3O3EB 3QNYB 4NN5B 3RGVD 4LVHB 3QUXD 1VCBC 1ZANH 4F15C 4NJ9L 4G3YL 4UU9A 4TNVF 5FLVA 3RBGA 3RWDA 1I1AD 2GCYA 2ICWJ 4WRLA 3WHXA 2VO5A 3RDTD 4BFEA 1UWXK 3NSXA 1CGTA 4RGMB 2CO6A 4JG9A 1RK7A 4XNUL 5JOPE 3I6KA 3IFLL 4HJSA 1HH6A 3DROB 1FFTB 1ZVYA 2MPAL 2N59A 4A2HA 3TBCA 3QQ3B 4L3EB 1BM3L 4XPHH 1MJ8H 3VFTA 1BM3H 3MJ7A 4XPHL 3UBXA 4MJID 1MOEA 2BP0A 3CCHA 5JXEC 4XOAA 3UJJL 3BAJA 3TURA 1P7QB 1G0YR 2EYRB 2VXTL 1GSKA 5KOVC 1I9RH 5F0JB 4OFDA 4I9XA 3EDKA 1E2ZA 4JKLA 4PRPA 3V4VL 5IB1B 2O1AA 2P80D 2P8PB 4AUJA 3GSWA 5J1AA 3EXJA 1E6OH 5T8IA 4O02B 4HS8L 3TT3H 4F5CE 1I53A 2V7NB 1PVHA 4L8BB 4JY5H 1VESA 3F83A 4DAGH 1BBJA 2YPVH 2D31B 3US0A 1ILUA 3M8OL 2RFXB 2RALA 1JTPA 5K9QG 1I1RA 1R5WA 3HR5B 5KVDH 1U8QA 4PG9A 3ZDWA 3ASNB 4YHOH 1FGVH 2IDQA 4AM0A 5EEUA 4GH7B 4YHOL 3TWYA 2IG2H 2WN3A 4JM2D 1ORSA 2DJUA 2BSBA 3RWEB 1S7RA 1NM4A 1JZGA 4K23L 4EVNB 1JP5A 4H1LB 5ANMA 5IHZB 4AIZB 3CZUB 4GG8B 4TSBH 1MFBH 5SV4A 4N2MA 4P2CG 3MLVH 1DBJH 3J7HA 3QZWG 3RWCA 1L7IH 3CX2A 5FM4A 2X3CA 2X2UA 2CKBB 4HPOL 1HHHB 1KNOA 5H35A 2J3SA 5KVEL 5C0DB 5IJDC 1XF4A 4RFNC 5I5IA 1R47A 3VMNA 3AU1A 1TTFA 3RI5K 3DETD 3HS0A 5EF0A 1G5GA 3TTYA 3G5VA 5IVXE 1PNDA 1NCIA 4GKSA 2ADGB 1GMIA 2Z3FA 3NACL 3OSKA 4M5YL 2EILB 2OMWB 2CBQA 3JV4A 1AP2A 1RUKL 3U7WL 4UQ3A 2BNQB 1DZBA 3C60A 4OW6A 5E94B 2HKAA 2NOYA 2ARJA 4OD3H 3VYPA 3B4NA 3LZFL 5HHVL 1SXBA 5DR5L 1AQMA 1MFCL 3UZVB 5E1GA 3H8NA 2P7TB 1IE5A 2EXYD 1GCYA 4RX4A 3RPIA 2BSCA 2VLKA 2VDRH 3VD3A 3CMOL 3B9KA 1YUKB 3K2IA 3SCMA 4A1RA 5F8QC 2YPVA 4YE4H 2NXZD 4GXVL 4B9IA 3V6OE 2XG5B 2B59B 1A6AB 4WKZB 1IGML 1HXKA 3VRIA 2H1PH 3KPRA 5E8DL 2N1TE 4LK4A 4S1DD 5EIIA 3VU1A 2GITB 2ZKXA 4Y88A 3OKLB 2VLJD 1AZUA 3I6GA 4XRCA 1GS8A 4XWGH 3RY4A 3L5IA 2VQ4A 3NEXA 4ZAKD 1XQ4A 3HPJB 4HKBA 3NZUA 2E5EA 4JPWL 4EI5A 3T0EA 4L0ZA 5D70L 1FF5A 1TQVA 3MQIA 3BDXA 3BCDA 1A2YA 3CDZA 4Y19B 4AL8C 4FFVC 1KYDA 1QP1A 3TX4A 2XA8L 3E38A 5CAYB 3LKQA 1LD9A 4PLOB 5T5FL 4KKAC 1KACB 2IQAB 4FXKA 4P5TC 2YFNA 5T3XH 1H15B 2BP5M 2CR6A 4MQ7B 3JUZA 5EUOA 3HS9A 2H2SC 3GTNA 3LKOA 5BCAA 5IMKA 3KL0A 2NQDA 2QDVA 2EXTA 5CBEA 1GYWA 2CAKA 5PCYA 2W9EH 1KCKA 3UZEC 3S3BB 5EU7C 4ENEC 1J7VR 4PEEA 1CVRA 4JANA 3HMXA 4TL5A 3DPBB 5A2IH 3HG5A 3KNBB 2VLJB 3LS5H 2DTML 4NNYB 3LQAL 5DD1H 5FUCC 4YXLH 4J3OH 4X4YB 1NBVH 4MVBD 2A4ZA 3MTXA 2FQEA 5A40E 2VSDA 2IANA 4RGOL 3CPLA 1VKXB 1B3IA 4UQEA 1G7MA 3Q2NA 4PW4A 3UTTB 2Z31B 3F7LA 3ARFA 2H0FA 1CICB 2AW2A 2VQ1A 4OLXL 3CH1A 3G6DH 2H26A 4OZGE 3Q9PA 4QTHB 1AE6H 4NZTH 5AW7B 2HJLB 3IU4H 1IGIH 3GMPA 1S5IL 4HIXH 1T1XB 5C92A 1A6UH 3HRZB 3V0HA 3WNLA 1G7LA 3JV0A 1NFAA 5C9JB 2Z65C 4H8WL 5JIMA 3D33A 3WOVA 4XZ4A 1T22B 1FH2A 3ULAB 4N20A 2L7UA 1G7IA 3OWEA 2IADB 4IU3B 3ZR5A 4GRWF 1GL4B 2APXA 3GKWL 1E28B 3QWRD 3UBHA 5C6PB 2A9BA 3OVUB 2RJMA 3QIBB 2VABA 1QPPA 5F7WC 1RZJC 2AK4A 3GSVB 3I50H 1CFNB 5CILL 1PJ9A 2BHZA 1IZJA 4NNPL 3GUTB 4JMXA 4FLSA 5DUJA 1IKNA 1FO0L 1Q4NX 2VXSH 3GSUA 5T33H 1BLNA 4Y19E 3TLRA 4MA8L 5IJVB 2JKNA 1IC1A 3V5HA 1B4JL 1ZWIA 3QEUA 5EOCJ 5AOZA 4KUZH 4YLBA 2WNXA 2EEDA 4LCWD 4NQUA 4R2GD 1IX2A 4X4XA 4DGVH 2CLZB 1PY0A 2YKKA 4U2YA 4WAFA 3NJFA 3NSYA 1K3ZA 1PDKA 2AQTA 3QORC 4GRWE 4NRYA 2X6UA 1QD0A 3UMTA 2VLMD 2NRDA 1D7DA 4KHTH 4QRQB 2IWKA 1ASOA 1D5IL 3FK3A 5FKAA 2PR4H 2Z35B 3O0RL 2NLJA 5CO1A 3LNIA 1T0NA 1U2HA 2ZNWA 3IVKB 2CRZA 1CWVA 5AVZB 2BSRB 3WY3A 1CXKA 1H6UA 1Z66A 2YD2A 4W68A 2NW2B 4UOW1 1IFRA 5AZEL 1VADB 5DVOA 3D7PA 4LFHG 3O45B 1V7MH 5D71L 3IM1A 1IMHC 2V9UA 2XSKA 4Q6IB 1E3ZA 2JJUA 3QXVA 3VXRA 2ZX5A 4YEEA 2GSIB 1XGTA 4MCYA 1E28A 3I85A 4DKFH 4YHPB 3S8GB 3CIQA 4YVNA 5IVNA 3SDCA 2OX5A 3HBZA 4LOEA 5D7LE 5BO1H 2BVQA 1HTYA 1NINA 3QIWB 2ZXDA 1ZHLA 3GO1H 4WJG3 5AVYB 1XF2A 1FVDB 1ZVNA 3VMOA 2IMNA 3ET9F 1SDYA 1KXVA 2FO8A 4OIBA 4DO5A 2ITFA 3GMNB 3L9EA 4QGYA 2HX7A 2HVKB 5TPWH 3TNMA 4G59C 4OZ4A 3Q6FA 3B2VH 1IQDA 3WJMB 1BDYA 2C26A 3BAEL 1JXKA 1DFBH 1E4KC 2BMKA 4O2EA 3TBTA 3ZZQA 3O2WL 4Z76B 5C0IA 1MKFA 2DH2A 1TYEB 4WHDA 4ZOBA 1MLCB 5ACLA 1S3KH 3LKQB 4N26A 1RHHB 3QB7C 5EU7E 1YYMH 1XSKA 4C54A 2B4CC 5E2WL 4TVPD 4HS3A 4GRWH 4WZ9A 4FFYL 4JVUA 4JB9H 2A2QT 1H3PL 4A7GA 4QY8A 5ERWA 4RAVB 5J6SA 1AZBA 3OJDB 4QHMB 3B8YA 2XZZA 1YQVL 2EQDA 1F4HA 1JV5A 4I2XA 4Y5XB 1W6WA 1JGIA 2JE8A 2GTWA 4D9RD 2XVGA 2Z7WA 4OV6F 3MLZH 4R2GC 2I7OA 2OMTA 4ZFOL 1J5OH 1K8IA 4KROD 4Z5RA 2HMIC 3QUYD 4FE9A 1AR2A 1IU1A 1VGEH 4EN3B 4NN7C 2HH0H 1CF8H 2JK5B 5GGRB 3BKML 3DMMC 4NQSA 5K1NA 1T5XB 2E3VA 2Y06H 4OT1L 2XQ0A 4OZFG 2C5DC 3VJ6A 4BFOA 2YRZA 4Z3EA 5ILTH 3QIWA 1X4YA 3IS0X 3KPMB 1T1XA 4YSSA 2PYFA 4PTUB 1MRDL 3MDJA 3QDMA 2OYKA 1M42A 2YAEA 3DIFA 5KOMC 3L7FB 3AREB 1DVFB 4UTAH 4DO6A 4YDNA 1Y07A 2WLIB 5H37G 3K91A 3QIBD 1MFNA 1HEZA 1KLFB 2B8OT 4YUEH 4LIQH 4XNYL 2G9KA 5D2NB 3SIKA 1LO2L 5GHWL 5E9DD 1QBBA 4LP4A 1LO2H 1OK8A 3T0VA 5E2UH 4OIAA 1IGFL 4QHKI 2E47A 3ZTJH 2I5YH 3T8XB 4Y9GA 3VVWA 4UQCA 3TA3A 2X4NB 4TNGA 3P0YL 3VNYA 2AGJH 2QPEB 4OGQC 4GP8B 4JCWA 2ESVD 4K8RH 4X5XB 2NUTA 5A6MA 2I85A 4JFVA 1FIEA 5I8EB 1YPZF 1F11B 2YPLB 4PJCB 1C7SA 4AW4A 5FHBH 5IEHB 1B9ZA 2DQJL 4KUZL 4NAQA 5SX5H 4HGMA 2FGWH 3KZ8A 1D3CA 3QYNA 2NZ9C 2AJUH 2BSSB 2E27L 3VWJA 2X4RB 5HYSG 1JRHI 4ZFGL 1LLAA 2K8MA 5DHMC 3S8FB 2DWEA 4QDGA 3CG8A 5AOKA 5LGHH 3QUGA 4QAWA 3MUY1 1A0QH 4DVRH 2R2BA 3LZPA 4WV1C 4JFEA 1NC2B 5LNGA 4LFHD 4P4KC 3FO9A 3MC0A 3VFSB 4YDZA 3U7YH 3KLAA 1U42A 2ATPB 1A7BA 1AC0A 1JGLH 2NYZA 1HJBC 1U0QA 2AJSH 3MNVB 1QYGL 2ZG1A 5EZIH 2ZKYA 4ZDHB 1ZLSH 4OLWH 2J5WA 2X89A 2Y7NA 4KROC 2XX1A 1IKFH 2CKBA 5IWLC 2F2HA 4XC3L 1KJVA 1UG9A 2G4GA 3FRPG 3L3JB 3NZHL 4MNHA 3BKYL 1DQIA 3VFGH 7TAAA 1L9RA 2OX5B 4FNPA 4GT7A 3O6LH 3OR7A 2WQXA 4MCMA 4B0MB 2K9FB 4J39A 3OZLA 3FAWA 3PHOB 2XU9A 4QRSA 3T0AA 1RJLB 1JDAA 3KPOA 3QO1B 4H26A 4K7PH 1FL6B 1T1WA 2DS4A 4FXTA 1NUDA 5IHUH 4P2QB 4IRZH 2RHEA 3BAXA 1XXDC 4NQVB 3WLBB 1H8NA 1NCOA 3LAFA 2ARJB 1ACYH 2J71A 3NCYS 5HGAB 5C09B 3TCTA 4KI5D 4Y8DC 1YUHA 3FZUC 4AQEB 4FERA 4LARH 2DWYA 3CVCA 3RUGE 1EXHA 1E4XI 1G7HB 4QOKA 1ZLWH 1J0KA 1EXUB 3MV7D 3P3SA 4NQCE 2OMVA 2YXVA 3QK0A 5T1LA 3QDJB 2C7FA 4JFSA 4XVUD 3VGDA 5FUOL 1NMBL 4QHPA 1I8MB 1F5WA 1D9KB 3ES6A 2Q7NA 4GMTL 3NRFA 4V33A 5SWSA 3AC0A 3I75A 3LQZA 1TJHL 2X1PA 3O6FA 1SOQA 1Q72H 1FAKT 1ML0A 4R83A 3TJEL 4L4VB 5AVRB 3O9WA 5D1XC 5IMLB 3Q9QA 3WDHA 1Z3GL 1P2CB 4HV8B 3KBHE 5HI4D 5EOCH 4IDLA 5FO9A 5FA4A 3FCBA 2X12A 3QR2A 5DS1A 3EHBC 1T21B 4N8VG 5EG6C 1XB3A 3BP4B 1QFWI 4NC2B 5I1LB 2XNAA 1A02N 3PHOA 4YGVB 2AXFA 3NUKA 1I7TA 4PJDB 3UYRH 3UXFA 5I73B 3DXAB 4MMZC 3HIZA 4P46D 4LSUH 5I1IH 4OZHE 2WCGA 1VIWA 5A7BA 3DTDA 2E9JA 3I84A 3U7AA 4BINA 4DIXA 1J10A 1C08B 2B2XH 4YSDA 2TAAA 3RNKA 1WSST 4LU5H 1RIUL 3OXSB 1H8OA 4NX0A 3WJLC 1JF5A 4AQAA 4FX5A 4N2EA 2ZG3A 1UJ3C 5JHDE 2OR9H 5GZOA 3TL5A 5F72S 2MCMA 2A7BA 1RQ5A 3MRJA 4G42B 1KTLA 3PU7A 4XHJD 2WNWA 1AR1D 5AKTA 2YXWA 4G8GB 1EEUA 2VMCA 1NIBA 5HDBB 1XGZA 3QEQD 1G43A 1MI5D 3FU0A 3RFZA 1EGJA 1CFVL 2HT4D 4UIKL 5DJXB 5IEHA 3ULVC 1XVSA 5GGSB 2Q8AH 1Z9PA 1IAII 2NR6D 4JVPA 5EU5A 3RUGB 1G6RH 2XWTA 2G3NA 4O2FB 5I1CL 2V8MA 3FU7A 4RMSA 5GS1B 1VHPA 3FN0H 4YNYB 5IM7A 1EHLL 4OAWB 3KLSA 4JAMA 1XGYL 3SQBA 2Z34A 3FO0L 5F7DA 3OZ9H 2GFBB 3QNYA 3VH8A 2QVMA 3NPZB 2A73B 5F7BA 3STLB 2EUVA 2EZ0C 2F8OA 1VZHA 3OKDA 3AQDA 4YSEA 3WNJA 4S1RH 3MV11 2X2JA 3CXHJ 5AW5B 1MHPH 5AAWA 4JQIH 2DQUH 3CFJB 2P4AB 4OVUA 1HCVA 1MREL 2WZ0A 2X6MA 4DKAA 4ZW6A 1FV1A 3CN1A 4PIRF 4AJ0A 1XF3B 1IBGL 4M6ML 1FCGA 1GHFL 5C0NC 1X5HA 2R0ZL 2VTFA 2WIIA 1THCA 4WFGE 3QEGL 4EIZC 1FC2D 2C3VB 3AM8A 3H6AA 2VO8A 4BUQA 4ZW5A 3K81A 4LEOB 2F74A 3Q44A 3AU1B 2HRLA 5EFIA 1WFJA 1W72B 3MNMA 4L4TE 3V0WL 4WO0A 5D96C 2RMNA 4R90L 4OTXH 2W91A 4QCIA 4F7PB 3OD3A 1BXUA 4AYEC 3QFJA 2J5LC 5E9DB 4DCQB 4M1CC 3BYYA 4K7PL 4UF7C 4ZUSB 3N43B 5GRVL 3H3BC 3KW7A 3V4VH 3CXDL 4MXVE 1XR9A 3WEMA 3ARBC 3T6QC 1J5DA 1OGAD 3IGFA 1T5WB 3HA0A 4YHZH 3OLEA 5TDPB 3OLIA 4X0KB 2UZPA 4IOFC 4JPKL 3MLRH 5FUZL 1EANA 3BPCB 4R9HA 1NAKL 3KPSD 1KB9J 5C07D 1LO3H 3K71A 5D72L 1MXGA 1NGQH 3FN9A 2O6PA 4JRXD 1IGMH 2FYVA 2XWBA 3UL4A 4GG6F 1CGYA 1QQDA 4P4KA 3OLGA 4LF3B 4ZX5A 5CMAA 4EI6B 2ZZUT 1JRHL 3I75B 4HHAB 4N90E 3TPUA 4F7CA 1H8SA 2FR4B 5ENWA 3QI9B 5JZ7C 4YLCA 2QPSA 7PCYA 3SYQA 3QWQB 1V8HA 5JPNC 3ULVD 2BRQA 3A4EA 1RJYA 1UZ8A 5BVPL 3NJHA 1SVCP 5C3LD 4LRIA 1E50A 1IC4H 4O5LL 2F58H 3MUZ1 4HJGA 5B38A 3LRSA 2YD1A 1UM6H 4OZFH 2QSCH 4LPTA 1RZGA 1SOXA 3KYKL 1IL1B 3SE3A 4QXGL 3QDGA 3ULUL 3F7VA 4KNQA 4WHCA 3DXAA 1M2VB 5EC1B 1KLGA 3FBQA 3PWVA 3T0EB 5I66A 3BT0A 3M17B 3U0TA 1XT5A 1E9PB 2FQGA 4GAJH 4HD5A 4X6BA 1LO5A 1PL3A 1HH9B 1UOVA 4BK8A 4OB5L 3POHA 4WTWA 4TTDD 5JXEA 3BVTA 2J6EA 5HI5D 4RFNB 1SEQL 4ZOEA 5TDOA 1F3DH 3FTXA 5HYJA 2I9TB 2X09A 3V0IA 1FIGH 2ARWA 3A5VA 5IT2H 4WY7L 5DD6A 1UM4H 2WXLA 2LGNA 4M6OL 4MXWL 5I6NA 1U4EA 1EUUA 1LYQA 1QA9A 5ID1A 1VZIA 1KTDB 2QADD 5CSGA 4HH9A 15C8L 3UAAA 4Y9FA 1WCQA 3PL6B 1FVEB 4ZUTB 5I8KL 1IQWH 4EKJA 5IKCA 2CO7B 5AW4B 3P40A 4U1HB 3LQAH 2QADC 2M1KA 3D0VA 2FAUA 2EYTA 3R4RA 4OCSL 1U8OA 5JQ6L 1NJ9A 4OZIF 3OKLA 2CMRL 2XKUA 4IBLT 4L8SC 5MHSE 1HU8A 1MRCL 2PWFA 4A7UA 3UGUA 3WS3B 3CQPA 4KRPD 1HKFA 1Q94B 3O11A 5A7EA 4PBWD 2J1XA 5I24A 4FXGC 2XXMB 1WZMA 4LCWB 3D2UB 4FG6D 2O6DA 3GRWA 5AW6B 3D18B 1JWMB 3WXVL 4WGVB 4YO0A 1SLVA 4N2CA 4FLQA 3QO0B 5SWZD 3NDYE 1M7IB 3NIDE 3W9DB 2F61A 3NGBB 4ZO9A 4F80A 2B08A 1G1OA 5FIEA 3EBHA 3RAJL 5A3ID 4DN4L 1L6PA 1U6AH 2FLBT 1ASPA 1TKWA 2YKLL 3APCA 3IETA 3JXAA 3KEHA 4FXGA 4FHJA 5E6SB 2PETA 5H2BA 1JBJA 2YEZA 1T22A 1SHMA 2V2XB 3W39B 1HXYA 4RDBA 1DJYA 1MW0A 2JKWA 2ZIDA 4OLUL 4PJAE 4E41A 3G5YA 3QUMH 5IEKA 3OX8A 1S78C 2MMXA 3L3HA 2HFTA 3L4XA 1DVFD 1WAAA 2A6DA 2R0ZH 1BFTA 3L3KA 1JPST 3N1GC 4XO4A 2UWEB 3M45A 4N2DA 1MJJA 2Z4QA 3OB0K 1TZGH 4MD0B 1UXLA 3QRGH 2Q1EA 1NICA 4GKZB 4GG6B 1DJXA 4X7CC 2B1OA 5IKCB 4JN2B 1PY9A 2Y2YA 3S2CA 2IQ9L 3C5JA 1M7DB 3FQRB 4BH7B 2FH6A 1JYWA 2A74A 2DLGA 2VR8A 3APDA 3KPRE 1ZV2A 1I4FB 1KGWA 4TLSA 5IF0B 2R0WL 1Q9WB 2LTQC 4NJAH 25C8L 3OAZK 2ADJB 5BJTB 1MY5A 3SPJA 2XPYA 3F7QA 1A25A 4IJ3B 4IIQB 2BY0A 2OFQA 1JNNH 1E2VA 4AYID 1N5YH 1ZSHA 4V2CB 3UTSA 4P2RA 3GXDA 1NANI 1A6TA 1NGZB 2P43B 1KDJA 4LQ1A 3TNNB 3ZGHA 3OG6B 1QNIA 1HSBB 1RZ8B 4DHLA 1YN6B 4Q8BA 1AH1A 3QQDB 5C0AE 1AO7A 32C2A 1URZA 2ODHA 1DVUA 2XXFA 2CA3A 3GGWB 3L1OL 4YHPA 2R0KH 3B7UX 4CDHA 3HNTH 3GUTA 3CZJA 1MAKA 4JHAL 4NRXA 4J6RH 1HQRB 2H1XA 3MMEB 1KCUL 3RIFF 4U31A 4OSUH 4R0LC 3KYKH 2CBPA 1T89C 4CW1B 2NZIA 4WWKD 3VD7A 2WLJA 5L4IA 2OJ1A 4FFZA 3TO2B 3LNEA 4I13B 4UTAA 3KJ4B 4UQ3B 3GM0A 2IAMD 2FJUB 2WD0A 3AU0A 1ONQA 3C5JB 2UUDK 2R29H 3FQRA 3VX0A 4I3RL 1DZ0A 1RY7B 3VACA 4N0YH 4HUVA 3WI9A 5TE4L 3C5XA 1T66C 5ES4B 4IIQC 5L88L 1HCFX 2WYIA 5JW3H 3HG1B 2OMVB 5T1LB 4HG4K 5KSAC 1KTDA 1I8KB 5DUPL 1BG9A 2D03L 4Y2DC 4PJXF 3VG0L 2NYYC 5EN3A 4PJFF 3TYGL 1AQ8A 3TBSA 4OZGA 1J9QA 4ZX3A 4AGQA 3GSNL 4KH9A 1D2OA 5D7HA 1E9QB 1RXLA 2CDFB 3HAEA 4U1SA 5ESQB 2IPTH 3R18A 1JL8A 1KENL 1XH0A 4PJFB 3WV0A 4GQPH 3ECQA 3SDDB 2C1OB 3AREC 2EVIA 1NGWB 1QHOA 2D7PA 2PTTB 4C55A 5C2BL 3BP7B 3VI4B 4UILL 5FM5M 2Y06L 1E6OL 2UV3A 3S3DB 4AIOA 4NAJA 1ZSDB 4FG2A 5F7NC 1LO0L 3KJ6L 5HHOD 4ICXA 5IQ7H 2MKWA 4DP5X 4DFIA 4MDRA 5ADPH 2V7HB 3FDWA 4I9WD 5HPMA 3IJHA 1Z5LB 1T4WA 4RLDA 5DMGD 1F8TH 1XSJA 2X70A 4GMSH 5I5MA 5I5RA 1CTNA 3FT1A 2LU5A 1C5BL 1J0HA 3L9YA 4KX8A 3OJ2C 4MJJA 2F1BA 3T0XA 3WEOA 2UZYA 4MNQD 4Y19A 4OQ1A 2V2XA 2BERA 2F8IA 3MUGA 4XI5D 3SYCA 3W39A 4OI8A 1AQDB 1YYLL 4LCIL 1AGEB 2F53E 4FXKC 4AOFA 3MRHB 3HHRB 3SYAA 5BUPA 3HB3B 1L7IL 1N6VA 3PJLA 3KWUA 4LSQH 3EYUH 5TE7H 3IDJA 3H42H 4JY6A 3ECVA 3T3MB 3II3A 4LSQL 2AMGA 2VC2H 3WTUA 2ADYA 5FKPB 3JSSA 5ACZB 3K1KC 4QHMA 2ATKA 3N04A 3QH3A 4HFWA 5F9DC 2EADA 3VI3B 1SJVA 5IBLD 2YBGA 4TKWA 3T09A 4WHTB 3WKPA 1CR9L 4WV1B 3DUHA 2X3AA 4G6JH 4OUOA 4TUJB 4G9FD 1OCRB 1CR9H 5C8JA 4TSCH 4AZ8B 1L0YA 4PWGA 5DVLA 4ZFGH 3IXAB 1PQZB 4Y1AA 5B3JF 4YNYA 4KROB 4FL4C 2JKXA 3GSQB 1IE4A 4KC3B 5IF0A 3VXRE 3W9EB 4AW7A 4LDCA 1D5IH 1ZGLM 1Q0YH 5EU3B 2JQAA 2DAVA 1S9WA 2HTLC 4HIPA 3FRUB 3OJMB 4X7SH 4ZODA 4TPRH 5EN2A 1IAOA 2HRPH 5D7LA 3UADA 4H0IA 4AE0A 3T9WA 4W1TA 2HFEB 1YEGL 3ULUC 3GRWL 4LSTH 2P42B 4J3UA 3NFPB 3GRWH 3QG7H 3B9KC 3OMAB 5DFVD 2KBGA 3GHEH 4ZZFA 3HC2A 3WELA 4PRDB 2BW4A 1ORSB 3RWEA 1FYTD 2AKRA 4AV0A 1TO4A 2PCPB 1MI5E 2DIAA 2NY0B 4XXWA 3MI6A 4NENA 4WEMB 2JB5H 3EJZC 3LSOB 5GHWH 2J20A 4PJ9D 5B1CA 1MHHB 1DLHB 1R17A 2EP6A 3FPXA 3V6FB 5I15H 2FIKA 5I1HH 5I1DA 4BK4A 5DHYB 3VH8G 5I15L 4ONFL 5D2LE 4FQLH 4BE5A 3CE1A 3L7EA 4MZIA 3VFOB 1THAA 2I07B 3S4SA 2MQ0A 4UTCA 1KY7A 3QQ9D 3DGDA 5CKAA 2P8PA 4KNTA 2OMBA 3DJ9A 5IW6B 4B95C 3NTCL 4AZ8A 1G0XA 1O6VA 5F1KC 3JWDH 4PRIE 5HGAA 4LVEA 5EPMB 1A7RL 5AYQA 5DQJA 4AQ1B 3GKZA 1KGIA 3NFNA 2DWEB 5EF2A 5G5DA 5BXFB 1ZS2A 3C60B 4X6EB 4DKDC 3LNGA 5TE4H 1N6QH 3C08L 4FNLL 5FXCH 2M2DA 3ZLQC 2NY5H 3O4LD 4NUQA 4U3XA 4A63A 3VM5A 1AGCA 2YLKA 1R75A 4XC1L 3TO4B 2VDOL 3PPEA 4OJYA 3X11B 1I7UA 4XE5B 5JO5B 3JWNE 3GDBA 1OGAB 3MR9B 1YEIL 3MLZL 1AHKA 2QTVA 4FQIL 3FTVA 1AFVL 1EO8H 4GINA 2AJZA 2F53D 1AFVH 1MH5A 3RWGB 5JOFA 4LSVL 3VYNA 1U3JA 2VDMB 3R06B 4HGWB 3TM6A 4WU7A 5C0DA 3EXLA 5F3FA 4HPHA 3H2PA 1WIPA 1TDQA 4OT1H 2WSPA 4JZNA 1IKOP 1OVZA 2AEQH 3BZFA 3EJPA 4M8QB 4N24A 1FLTX 1WV7T 2BWIA 3WKYA 3PXJA 3CSYB 3JWOH 3PHQA 4JR9L 5HBBA 4XTRD 1UA3A 1CDBA 1IGIL 4PJBE 5L0QC 2FX8L 3MODH 5HP5A 1WCBA 5AW1B 2CSPA 3BXNB 5GSVB 2PXYB 4KJQD 4G6FB 2AK1L 1KTKE 1JWUA 4D94A 5AW3B 2VDPH 1BQ5A 2DQGL 4MZRA 2R1WB 3HFMH 2DOCA 3ZL4H 2AANA 2BC4B 5IQ9A 3F85A 4YR6A 1AYOA 1A9VA 2AAAA 5B8CB 4JW3A 1EZUA 1MNUH 1E8WA 1NEZG 3WCYA 5C0CD 3V0GA 4LIQE 4GQQA 4RA3A 2H3XC 2JCCE 4JRFA 1ZLEA 3I3BA 3VXME 2D7OA 1Y1UA 4OQTA 1DBKH 3MROB 2WQWA 2VXUL 1AG0A 4QRRE 5AVWB 3JBG7 1LK2A 1I82A 4WIQA 5FGRA 3K6IA 1BD2D 1NSNH 3OV6A 4TUJA 1DLFH 4XMXA 2V6HA 4OD2A 4IRSB 2OXHA 2CM6A 1UD8A 5E00A 1FSKC 3LXAA 4JKPH 1EHKB 1MSPA 5BNXD 3ATAA 4G5ZL 5ESVA 4R96B 1A1OA 1AZRA 1GA2A 4KZEH 1KIRA 1RVFL 2AJ3A 5DHXB 3BJ91 3OKYA 5HHPA 2APVA 2X7LB 3NSJA 2XNAB 2VDLH 1KIUB 1NCDH 4KV5F 2ZWSA 7CGTA 1DJIA 1TU2A 3W9DA 4C56E 1M71A 1ETZB 1WBXB 2MCPH 1U36A 2NNAB 3FFOA 4AL8L 4HHGA 3QUMB 1PGRB 3IGUA 3L7FA 2CR3A 4H2CA 4JG0L 2V8LA 3NFPA 3NSFA 5DK0B 4F24A 3UJIH 1T7XA 2Y7LA 1J88A 2XN2A 4BFRA 1JI1A 3MRQA 1F97A 1A3RH 1CU4L 4IQHA 5E8PA 4KQ4L 5DQDL 1R5IB 2R4SH 1MCSA 1E4JA 2UY7B 1G7LB 1L9TA 2P5EB 3A24A 2HB0A 3OMIB 2C8NA 5DTFB 1REIA 4NWTH 5L2KE 2P26A 3SYOA 1BBDL 1FZOA 3B7YA 2J44A 4KNUA 1GKOA 3GI9H 4G6KL 2QDWA 4ZYKB 1M57B 4IRSC 3BWAB 1JZ4A 3D3VA 5AW8B 4JGUA 1ZY9A 2BCKB 1WICA 5AW9B 3O2DH 3ZK0A 1QFWM 4U6VH 3BSGA 4PCKA 3DC0A 5JW4N 3J8F7 2OJZH 4QRTA 3RTQD 1TSRA 4E9SA 5DMJB 5KSBF 3EGSB 3MRPA 1S3KL 2XN1A 3BPLB 2WO3B 3DX0A 4KK6D 2WKOF 5I6PA 2W0LA 1ODUA 3OPZH 1HINL 4Z77A 4PJ6A 3DHUA 2QVIA 3HVDA 4UDUA 4UV7L 1GGCH 3F7RA 2DN7A 4Z95L 1UM5L 4IGBA 2RCSL 3GS7A 3QDJD 2R4RH 2TRYA 5DYOB 4AG4L 5J89A 5EBLA 4XP4H 1X5GA 2B1AH 3JTSA 3KVQA 4UT6H 2OBGA 2CCWA 3SY0B 4N1CA 2OPCA 1IZKA 1OSEA 4J3XA 4F2ME 4LLVA 1FCCA 1JHKL 4WW2A 3W82A 1JZDC 3IBEA 4J1UB 5J13C 2QSCL 1OARH 3FB8B 1BIIB 1EDHA 2J8UF 5A16A 4GXFA 4N2IA 2AQRA 4N6RA 4QTIH 4MAUH 5H8DA 5JHDA 5SWZE 3WFEL 4RIRA 3B7SA 4QXWA 2W88A 5FLUA 4YBLB 4PTTB 3SKOA 1IIKA 1PLGL 2XHNA 2V3DA 5FWQA 1RUMH 1GIGH 2AXWA 5T1KB 3DVFA 5I19H 1V7NH 2W0FB 2W9DL 2ZQKA 2FT7A 3D52A 5K9KA 5SX4H 1G1CA 3E6HA 3LN4A 4I18C 4N2BA 5ANME 4P4RA 1DQLL 5EO0B 2YEVB 4WUUB 4F7EA 2IGTA 3NSDA 1N5AA 1ACCA 4NLAA 3P11H 3GLDA 3MJGX 4OZIB 1B6UA 1NC2D 3KM1A 5D1ZI 5BZZA 2XTJE 5AVQB 3GMMB 1UD3A 1Z32X 4J2XA 2Q20A 3W81A 1EMTH 2XZAH 2WWMD 3FN3A 1X4ZA 2R1YA 2A5UA 3R1GH 3U4KA 4MBOA 5IVZA 1FL5A 3L1EA 2DM2A 2HX8A 3HC3L 4HIQA 1NMCB 4GLRI 3TOPA 4Q97A 3IJEB 5E8DH 5C0BE 3OXRB 1FORL 2X4PB 4BWWA 1OAQL 4NO0A 3IFPA 2DWDB 2ID5A 1G7QA 1RJZA 2ZSVA 4UOQA 1NFKA 3S6CA 2VW6A 4HT1L 1LP9A 4Z18A 3D87B 4B9KC 1XB6A 4HUWB 1ZRUA 3VG9C 1FLRH 5F93C 2Y6SD 2WZ6A 3BI9X 3F7KA 5IQMA 3QJVB 2ICWA 2YA2A 4N0UE 3GXUB 4P3DB 4QHUB 1FH5L 1SOKA 3H7BA 3QQXA 4FKHA 5JPNB 2XZCL 4LRNH 3FTWA 4M9PA 1LWRA 4MJIB 4PJEE 3KMDA 4IW4C 2Y6SC 4N8CH 3WIHL 5CGMA 3C09C 2DQUL 1XGPB 3NRPA 4ZQTA 1NL0H 4KU1A 2CK0H 2VC2B 4ODUA 3U6RB 4A2MA 3GHBH 4C4UA 2CK0L 1AZZC 3EH3B 1E5BA 4LE8A 3DKHA 1A6VH 1V5JA 5E7BA 2X87A 1FZOB 2HTKC 2P44B 2GKIA 3TN0C 2J6EH 3UAFA 3NCXA 1K6QH 4HFWB 1ADQA 1AD0B 2D4FA 2IPKB 3D25B 4R7XA 3BEVB 3D34A 4APQA 4D8PA 3B34A 3KPLA 1D6VL 1PIGA 5J1AB 3L3OC 4NO5A 1L9MA 2EC9U 3D85A 4MX7B 1CB4A 4O02A 5HYFA 2X10A 1PDKB 2E7MA 5D93B 4Y1AB 4URTB 2MPAH 2OZ4L 5DJDB 1OQOA 3MXVL 3O2DL 5GGRY 3BQUA 5EBWA 1EBPA 4E9RA 4DPRA 2CO1A 3FT3B 5FGCB 1BEYL 4LEXL 3D08A 2OTWB 4WF7A 1IO4C 2R56L 3ARVA 5DLMH 3REVB 1X9RA 4HSQA 2BM3A 3TBWB 3HPLA 1K4CB 5D72H 3ULUE 2XWRA 2BSRA 1EQWA 3IDMA 4MJ4A 4L4TD 5EUOE 4BQ8A 2K78A 2ICEA 5EBLB 1S3RA 4XBGA 5EEZA 3MRGB 2XDHA 3QDGE 1Z0NA 2H2PD 2ZNXA 2R2BB 1A7NL 5KVGL 3AACA 1B2WL 2GT9A 1KWGA 2XWZA 4UT6L 2D2OA 1LQBC 1W0WB 4WW2B 3R7RA 2NQCA 3QARA 5LGKA 2VLRA 1AO7B 1O9WA 2WXJA 4GUPA 4TOYH 1TVHA 2L7EA 4B97A 3CDFA 1BAFH 1KCSL 4X4ZA 4KTEH 2A83A 3P9WB 1KJVB 2CQVA 2CNZA 3OF6D 3P02A 1SJMA 3OBAA 5AVSB 1U8CA 5T1KD 1DBMH 3BRDA 4G7QB 5T5NF 1GYUA 4I85A 3II1A 5TK4A 1WPCA 3U30B 4CMHC 3DHMA 3KLLA 4OFPA 5DMIH 3KWTA 4BKTC 4L4VE 5HYQB 4XNXL 2MRYA 4OLZL 1BFVH 3RWFB 4OUUB 3FSVA 1M7UA 3NPSC 2DD8H 3RL2B 3SE9L 5KSUA 2ZCLH 1XF1A 3L4YA 1SJEB 1WWWX 4PJ5A 4Q9RH 3K71B 4ZW8A 1G94A 3Q43A 4BCXA 3FH7A 4S0TD 3UJJH 4PY7A 2F5AL 5I1JL 5HDBF 5L7XL 1BVNP 2AK4E 3WFCH 2VDMH 3UBXG 4JPQA 2FECL 2FBRA 3STZB 3KM2A 1FNFA 1QSFD 3Q2CA 3TJHC 4QTFA 5J3HD 3PGFH 1UB6A 4CVXA 2AEWA 1DANU 3HBPA 2X53A 3TWCL 3PGCB 4XTRC 4AH2B 1I1FA 1F18A 4FF9A 1OAQH 3CXHK 5IBUG 1F1GA 3DMMB 3BSZA 4ZUUA 4AZUA 3CVIL 5A2FA 3DGGA 4X6DB 1N7MH 3UTZA 2BNUA 5D7JB 1WAAE 1FL6A 3T2PA 2X4TA 3CAFA 4YGAB 2WV3A 2WLIA 1NMAL 5B1AB 4X6BB 5D4IA 1T03L 3PJSB 1LJMA 2D4DA 2H2PC 5HHNB 5HHXL 3NJKA 1I75A 2I32A 1E7VA 3F12B 1MXDA 4AQOA 5T3ZD 5FX3A 4OF3A 5MI0C 1A4JA 2WGXA 2KL6A 2P5ED 2XC8A 4NEHB 4L1SA 3QP3A 2K7QA 2HJKA 3NESA 1EXUA 3NSCA 4FL4B 3AQXA 1C9SA 3VAEA 1MJ7L 3FSWA 5EOTA 4UNIA 2E0PA 8PAZA 1HIML 3D4GA 4TNWK 2R9HC 4QWWD 3UAEA 2WZPA 3ZL1A 2AAVA 4N0CC 4APXA 4IRJB 1FUNA 2WUCL 1AIZA 2BP0B 3CCHB 3GXMA 1HYSC 2XQYA 4W9FC 4Y2OA 1S4IA 4JRYA 5TF0A 1DE4B 2UZIH 2VDLB 3UTSE 1YNTA 4JGNA 2EXYC 4N8VA 3S48A 5FO8B 2X4RA 2YD6A 4N3TA 5K59E 3WFHA 1ZEAH 2VZVA 4OCNC 5L9DL 2H45A 1QW8A 5T3ZH 5ICYB 3FO2B 5CP7B 3CU7A 4NN5C 4PHZA 5AYUL 5C08D 3MRNB 3WMPA 1CLZH 1JWMA 5TJWK 3FZUD 4XP9L 5MENA 3ZYJA 2OS7A 5GS1A 4IOSA 3V4PL 2KQMA 2YGPA 2OW7A 2DF3A 5JUEL 1TLMA 3DRQB 5F7AA 4HUKB 2NTFA 1G7PA 3MCG1 1LE5B 5BZWA 3HHMA 1W8NA 3WKMH 2AS5M 1AKJD 2KZBA 3S8WA 2DMCA 1R0AL 4NO2A 5DT1H 2EKSB 1FE8H 1TTGA 2L0DA 4LDEB 3M1CA 4FAAB 2GW5A 4HCFA 1QFUH 1L6ZA 5DSCA 3RTLA 1GZQA 1I3GL 2DYPA 2OL3L 3H9SE 5HYSA 4G9DA 3TFKD 5IJKC 2ZUUA 4JHAH 2AP2A 3ARGD 2VXSL 2C4FU 1E4WL 2XV3A 3QIUB 2NW3A 3W0WA 3MKGA 4EIUA 4CKQA 1DL7L 2VSCA 4L3CB 4ZFZB 2ZF9A 1X5XA 3ARTA 2D7NA 3EDJA 3FUDA 4J3TA 3ZKMC 6PCYA 3RRQA 2J1KA 3LEXB 1DBBH 2IBBA 5IMMA 3GJEA 3FO1B 4F7MA 4P5RA 5TFSL 1ODAA 3VWKD 3PWPE 1JHTA 2W38A 1QFWH 5CN1A 4D7BA 1J5IA 3UGXA 4F20A 4YEFA 4GBXA 4NKDA 3NCCB 3BISA 4WCYH 3TYFA 3WDIA 4WSGA 2WBXA 2DH3A 1N18A 1L9PA 1R3HA 4PJXA 3F6JA 1O0VA 4H0LC 1DBAL 1KLFA 2PW2A 2X9XA 1DCLA 3FMGH 4AUYA 2W60A 1CBVH 1NBVL 4TUOA 4KY1L 2VZ1A 1FFRA 3LRGA 5D1XB 4PRHB 2JJSA 3QDAA 2PCYA 3IJYB 4HIJA 4LHJB 4MTMA 4WFFD 4Z7OF 1I3UA 1A21A 5HJBA 2DWTA 1UHVA 3GBNL 2WLHA 1A1MB 4AJYV 1CYXA 2NTSP 3BZFB 3FU6A 3KXFD 1UUSA 1K8DB 1GGBH 2MPVA 2Z6FA 4JN1H 3QZMA 4QCIB 1JGUL 5AB9A 2P8LA 4RRPM 2YPLE 2NCEA 4WWOA 3TVMA 1S7WB 1P84K 3MAWA 1QNZH 1KPRB 1A14H 2P47B 1W2KT 3ERXA 1ED3A 1AGFA 3UFIA 3AQZA 1PZDA 4R4BA 5IB2A 2YA1A 4OU3A 4P59H 2J2ZB 4WI6A 5IMMB 5AZ2H 3ESPA 5IFHH 5L2JA 4E0RB 2KZ1B 3LNFA 2VQUA 4ZS6D 1AGBB 1E27B 1KIPA 3FTGB 2DLTA 4P49A 2YA0A 3QRBA 4PSRA 3MLUH 1ZLVH 1Q1PA 3IGLA 5GS1C 3QQ3A 3X17A 3B2MA 5K5YA 1OB1A 4LHUB 1Z1WA 1SN2A 1E4XL 4ODSL 4IS6A 4IOSD 1E5AA 5JIKA 1U93B 2XV6B 5MEND 1MCQA 1AHWC 1HESA 1F4XH 2IOMA 5CD5C 2CO7A 2QVTA 4LBAA 3DX7B 3WKQA 3SPGA 1GYCA 2GHZA 4M6NL 4M7KL 4ODHH 1OZUA 5IESH 4M7KH 4LSVH 2BVEA 4NGHH 2Y7OA 2ZAHA 4N85A 5CEZE 2W65A 2FBJH 3PNWA 5DDHA 5LAXA 1TTAA 4S2SB 5KUKA 4GS7C 3QCTH 2E7LA 4KO7A 3KH3A 4H2AA 3VO0A 1N59A 2R59A 1IM9A 5L4MA 3SPHA 3EUUA 12E8L 5AVTB 3V55A 1JXGA 4IBYA 4JO2H 4S1QH 5G4OA 4DJMA 2WZPD 4KQ4H 4K71C 3LVEA 3QO0A 2FB4H 1J8KA 3Q0HA 4JL2A 4DTGL 1ZLVK 1ED3B 4KHXH 4TF4A 3FFCB 1O6SB 4ADJA 1K85A 2A4EA 2XICA 3VXOB 3WS6C 5IVXA 4QXUL 1JZIA 4XCFH 4G6FD 2P5EA 1GZHA 3PWNA 2OR9L 4HWBA 4KV5E 3ZW3A 3TA3B 4MCNA 5BO0D 2YD8A 1MCHA 3ARBB 1S7QB 1ZS8A 4FNRA 4FP8H 3F7YA 3NN8B 3V4UH 4CDGC 3GO1L 3H4FA 5K9OB 1INEL 1HHHA 1KNOB 2PNDA 5D1ZD 4J8RA 3L5HA 2JCCB 3ZZ1A 5IEKB 1ETA1 4X5PA 4TUUA 2YGQA 4WI3A 3LZRA 5CEYB 2JKJA 2H32H 2NXYD 3F3HA 1UD5A 3F7PC 2Q76B 4MSWA 3D07A 2E6JA 2VXQA 1U93A 1CFBA 4QAMB 1M1XB 4W9KC 1RZPA 5LBSH 4ZFFA 4HIHB 3ULVL 3WFDL 4A6YA 5I1EL 2AJUL 1T2QH 4F1SA 1UGKA 4NHCH 2XPZA 2ZTBA 4PUBH 3LN9A 1YEKH 1P1ZA 5EBMB 4KKPA 4Z3JA 1IAIL 2J56A 2XFXB 4PS4H 1BZ7B 4YGVA 2ZWNA 5CZXC 3ROLA 1I9IL 2IV8A 5A2LH 2OYMA 4EVNA 1LILA 4PR5B 2F54E 3CVDA 1N8ZB 4DSYA 5JW5A 5EOQL 4ANUA 3O8XB 1HL8A 2BSEA 1CK0L 1OCZB 4TLTA 1FO0B 3S96A 5F0MB 4BZ2L 3G5YB 2NMSA 4WWKB 1PTZA 1CXLA 3NCBB 4I3SL 2Z91B 3E3QE 4PN6A 1EAJA 3FONA 1HDMB 4FQQB 4MJHA 1FP5A 3VFGL 3KCWA 3BE1L 3MXWH 5AW2B 4MCYB 1BLNB 5IJVA 3KLKA 2Y22A 4JO1L 1XGUA 3SODB 2OQJA 1ZV9A 1T1WB 4MDJA 2WUBH 5D5MA 4M62L 4O51B 5EZIL 1P5UC 4JDZA 5MERB 2GEEA 4JGMA 3MOAH 5FYKH 2QR0A 2R51A 3QPXH 4Z7OB 2QFPA 1HSAA 3SDXF 2F15A 4LSDA 3SQRA 3P9MB 3OF6A 4XN1A 4HWEH 1KCRL 2HVKA 3LN4B 5DZVA 2KC0A 1A3LH 4W6YB 5B39G 4JFHE 4DUWA 3V0DA 1IEBB 3CDGA 3LDBB 4PGDA 4DEPC 1QRNB 2DB8A 4U7KA 3ZBMA 2ZP0T 5J1SC 3KYOA 2Z35A 4RRPG 4CILA 2I25N 4FMVA 2YC1A 1RJCA 2KQNA 2Q8BL 3GF8A 4G6AC 4M3JA 2KUTA 2A73A 3CUPB 2R27A 1JGEA 4LL1A 4R0LB 4W9HC 4FMFA 1OV8A 2HLAA 3T04D 4MQXC 1WA0X 1JPSL 4D9LL 5JW4M 2LU3A 3JYBA 1AI1L 3MLUL 4MS6A 3U9PH 1PYWB 2BVUA 2ZAGA 2D9CA 1NBZB 3LPGA 3X11A 2GQHA 3F05A 1ROCA 1TZAA 4L4TA 2IF7A 2XTJC 4LOUD 4CKVX 1JV5B 1E5UI 3WHE1 2DKSA 3MV8A 2PP8A 2WZAA 4Y4KD 5KJRL 3MO1A 4XXDA 4FQCH 3FXIC 2XV0A 3ALXA 1D6EA 1Q94A 4TQEH 5CD3B 2C3VA 1FLRL 3VFMA 2Q10A 5JA9A 3VRJA 1KXHA 5ICXB 3MLTB 2BINA 1OE2A 1BMZA 1EBAA 2VN6A 5I6OA 3GZPA 2DQIH 1ZA6B 1H9VA 2LOEA 3SDAA 5E2TH 4GXUN 4IRJD 1QW9A 2HRPL 3IDGA 4WWPA 5GRZA 3WE6B 3MLXL 2YO3A 3DJSA 2WXMA 3FF8A 3HRZC 1D5BB 1XFPA 3QJFA 3VSVA 2HLEB 2WO2B 3N40P 3IFLH 3MJ9L 2JKIS 4U4BA 2E7CA 4KPHH 2EYSB 4Y5VB 2XWCA 1KBVA 5IROC 3GSNB 3DYPA 5CLWA 4YBLC 1JGEB 1T6WA 3FB6A 1S9XB 3S34H 2XTJB 1F1DA 2WWKT 5DS2A 2EE9A 2QL1A 2WCSA 3DPBA 4ZZKA 4RMTA 1DE4A 3ULSB 1D5XB 5E00B 3N0AA 5ESVB 2Q8AL 1HT6A 4PW3A 4ZFFB 5ITBH 4FNUA 4QYAA 5SWQB 3GSWB 3PY9A 1JYXA 4FOMA 3L6FA 4BFGA 3IK2A 4UAHA 4FHBD 1IC7H 2HJLA 2F19H 3HI5H 4Z9KB 3RZCC 2WYTA 2QKSA 4O9HL 2FSEA 3ASOB 4HU2A 3BUIA 1J0YA 4OD1L 3UZQB 2JJWA 2BX5A 2PTUA 5C9KA 5E6IC 1JK9A 3RZCD 3HN5A 3RVUC 4DZBA 3DO7A 4U0QB 3BFQG 3E3QC 3HN8A 1U8LB 1V3KA 4Q4EA 1KOAA 4WFHD 5KVDE 1MVFA 4KQ0A 3ABLB 3VTTA 5KW9L 5D2NA 5IHLB 1J8RA 4PU2A 3JVGA 3KLAB 1SEBB 1NGYA 2LFGA 5HDWA 1MCWM 3OB8A 1EO8L 4AIZA 2OZNA 1O5DT 2O26U 4X8XA 1XZ0A 5I6KA 5CBEB 3D0LB 4GI8A 1Q9OA 4K5PA 1TZ8A 1CQYA 2AQSA 1JGVL 1KYOJ 4PVNA 5KVMC 2XXGA 3FTZA 5FC9A 2BPBA 43CAA 4C4BA 2BDNH 2ZUSA 2IH3B 3QJHB 4FQHB 1XF4B 3JTTB 3ME0A 4RGNB 3SJVE 4RISL 5HI3D 1EO5A 3T2NH 3IRCA 1XF2B 5DFTA 3RDJA 1A7QH 4WFHE 3ZKQD 3ARBD 1DJHA 2W9DH 1PIFA 3BQUB 5E6RB 1KCBA 1OM3H 2X6VA 2Q2EB 1NCNA 3N1MC 4L8CB 1PFOA 4OH2A 1NIEA 4I2XE 4U3CA 3BW9B 5ABZA 5SWQA 1A64A 3HZVB 2V2TA 3NCJL 2A6KA 3O2VH 3S35L 1DO5A 5D1QE 3IXTA 2ZUQB 3D18A 5IJCC 2HT4C 5ALBL 1QQDB 2ZYRA 4P4KB 2X3BA 4UDTA 2ICEB 4BFIA 3TC9A 2Z8VC 4XOEA 4BGDA 1NWPA 4PJXB 4X6EA 1C8QA 1U2YA 2Y4SA 4QY8B 5ERWB 3DDGA 1SLWA 4F37F 1JYNA 1X5KA 4ZBJA 2AXGA 1NSNL 2JTDA 5J9PA 3D39E 4K3JH 1LEIA 5I16B 2H8PB 4JREB 1WWBX 2CBMA 1KLUB 3AG2B 3MNDA 2HKHL 1INQA 1ZCRA 5KJRH 4Z1PA 2DQDL 1OAJA 4X8GA 4JFZL 4CN4A 4KVCL 3GC3A 3K6OA 2A83B 2NY1B 4JS7A 3RTQA 3TT1H 3QDGB 4D3CL 2JELL 2X6AA 3V6FA 2FO1A 5HDBE 3RGBA 3VUAA 2YK1H 2QGCA 3QJXA 1ZWIB 2IH3A 3DNKA 4A04A 1OP5K 3LEVL 3RLSA 1TQBC 2AEOA 3D3VD 4PTTA 2Z0BA 3WLBA 1A4AA 2Q7AA 3P2DA 1UB5B 4PJDA 3U7YL 5E5MB 5TH2B 3ULVF 1TEFA 3LH2L 3A3YB 5DMIL 1VLXA 3FF7A 2ENJA 2VDQH 3FFCD 4CN6A 1MF2H 3N6YA 5I0ZA 1CD1A 4UWQB 5B7EA 2BSTB 3OGCB 3BPNB 3PDOA 4NXSA 4B9YA 5C0EB 3BKYH 4K94H 3MACH 3WUWA 2MFNA 5C0AA 1IGYB 5T5FA 1XGQA 4JO3L 5HDQH 1J0IA 2YAQA 1QLRB 4HCRH 3U30C 4JO3H 4NQDA 1G87A 4NIYE 4KJYB 2HFFB 2B7DT 2OTUB 2WANA 4FZEL 3L95A 3PAZA 1H3WM 3JVGC 5FYJL 4DETA 4XNUH 1RUPL 5A2JH 4JUSA 1OHQA 3H56A 4NP9A 4OJFL 1KJMA 2EIJB 2GI7A 4XNBA 3DX7A 3V0VB 2QV4A 3IGAB 5DI8B 1P7HL 1S9VB 1NUGA 4JFEE 4ES8A 2O5XH 1R3KA 1I8IB 4KUCD 4UMSA 4OLXH 4NNYA 4OLVH 1GYAA 2GUOB 1FNSL 2NX5D 3DURA 3PF2A 2VLRE 1N4XH 2UYLB 3HNSL 3L4UA 5H4YA 1KPVA 3EFFA 3B2UC 2NY6C 5CUSH 3RKPA 4JFDD