5EEYA

Radiation damage to the trap-rna complex: dose (dwd) 11.6 mgy
Total Genus 11
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
11
sequence length
69
structure length
69
Chain Sequence
b'NSDFVVIKALEDGVNVIGLTRGADTRFHHSEKLDKGEVLIAQFTEHTSAIKVRGKAYIQTRHGVIESEG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Transcription attenuation protein MtrB
molecule tags Rna binding protein
source organism Geobacillus stearothermophilus
publication title RNA protects a nucleoprotein complex against radiation damage.
pubmed doi rcsb
total genus 11
structure length 69
sequence length 69
chains with identical sequence B, C, D, E, F, G, H, I, J, K, L, M, N, O, P, Q, R, S, T, U, V
ec nomenclature
pdb deposition date 2015-10-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02081 TrpBP Tryptophan RNA-binding attenuator protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.50 Mainly Beta Sandwich Immunoglobulin-like TRAP-like 5eeyA00
5EEUA 1UTDA 1QAWA 3ZZQA 5EF3A 2ZD0A 2ZCZA 2ZP9A 3ZZLA 4B27A 1GTFA 1WAPA 5EEYA 3AQDA 5EF1A 5EF0A 3ZZSA 2EXTA 3ZTEA 5EEVA 5EF2A 1C9SA 2EXSA 5EEXA 5EEZA 2ZP8A 5EEWA 1GTNA
chains in the Genus database with same CATH superfamily
4APQC 4P9MH 4NJ9L 1U8MA 2X1XR 4LVEA 4D7PA 5JXEC 4JG0H 1XCTB 2APWA 2QKSA 2ZCZA 6PCYA 5DTFB 1JK8A 2VC2B 2RA1A 3UG4A 3I75B 3UO8B 4RGNE 4W9GC 3SKMB 2G5BA 1MCPL 2FRGP 4JFTA 3U4BL 2AK1L 1JK9B 2ZKHL 1IILE 3BFQG 5DZVA 4NM4H 3MRMA 4OKDA 3K71A 5D7KE 4NZUL 1PYWB 3D07A 3U4KA 4HU8A 3GSXA 3V0JA 3UTTA 2GSMB 1IEHA 2YQ3A 5LXGL 2F19L 3PGFH 5HY9A 1JMXA 3B9EA 3ARDA 4L5FH 4PRAB 4JVWA 5C0CE 4KO7A 4OR1A 4WENB 4BK8A 1YMMA 4EDXA 4Q6KA 4XP9L 3D85D 3EOTH 4LOEA 5AL0A 3R1GL 3VM5A 4UV7L 5HYJE 1FJ1B 3B2PA 1E9PB 5DS8A 3QNYB 4NQXB 3DROA 3UTQA 4F2MB 4KMLB 3C2AH 5A6IA 1PEZA 4EPSA 5KYYB 3DJTA 3K0YA 3RX8A 4OCRH 5EOTB 3HE7A 2CPCA 4IRJD 3P3TA 4P2RE 3S88L 3HG3A 3PXLA 3QEUA 4M5YL 1AQKL 4KV5E 1ITCA 1U8KB 1RUQL 1WA0X 2GIYA 2K70A 3VYNA 1S3RA 2Q8AH 4B3EA 2Q3AA 1NKGA 2BY2A 3FB6A 5E5UB 1WFUA 5F8QC 1ZA3B 2W07B 1XAUA 1TMQA 4E0RB 3IF1A 4GJTB 5CGTA 1OQXA 1QG3A 1JPGB 1X5HA 4HWUA 4M4PA 3NCEB 1ZGLB 4AJ0A 3ARPA 3OQ3B 3ZE0B 1GKOA 4BDVA 1FI8C 3MRJA 4YDLB 2P5WB 2G2NA 3H9SD 1HXYB 3LZFL 4N1CA 5HDQL 3QULB 4KDTC 3KAAA 4NQSA 4XTRC 4YSEA 5EH1A 5IVXB 5C0GB 2P8MB 3V4LA 5CJOH 5C0JB 1I9RH 2PR4L 3TYGH 2EINB 2PYEB 1S7RB 2WLJA 1E43A 1G1YA 3V6FA 5KJ7E 3QORC 4WDIA 2A6IA 4UAOC 1OAKH 5DJ6B 1AZNA 5B7FA 3PFQA 3KBEA 3S36H 3W0WD 1NMBH 4YDKH 1JGUL 4U0QB 1GRWA 4OJCA 3T1FA 2XIDA 4C57C 4FNTA 4HMCA 3ZHLA 5FYLH 1M3JA 1HFUA 2X87A 2EEDA 4OTXL 1BXAA 5DMYA 3J8F7 1M57B 1CGUA 4WNJA 4DVRH 3TWYA 3GT6A 4AQ1A 2BNRE 2KLTA 2JXMB 3UG5A 4YBHA 4X6BA 5FYKD 3QSKB 3BAKA 3PDGA 1T4KB 3DBXA 3RNKA 3FO1B 1N7ML 3U1QA 7PAZA 2HWZL 4OZGB 3IJHB 4OCSL 4S1SL 3SDXF 2R0LH 3DJRA 1D5IL 4F15C 3P9LB 1H15A 4G1EA 1KCSH 1FNAA 1CFTA 4FFTA 4AEHH 1QEWA 2UZXB 3KPQB 3BP5B 1NJ9B 2Q3ZA 2FEEI 3VGAB 3IRCA 2EDKA 4GW5A 1E30A 4L37A 2X4NA 3MV9A 1RPKA 2XX0A 2FIKA 4G42A 4PRNA 4WI2A 1CICA 2DLTA 2WNKA 5DD1L 4ES9A 1GYUA 3EUDA 4HIXH 5CN2A 5I5RA 4IBZA 3T0WA 5DK3A 4PWFA 1SHSA 3WLBB 4XX1E 1TJIH 4KUZL 5JPMB 3FRUB 4OY9A 3IWVA 3IXTA 2DZEA 2Z8RA 4S0SD 4TSCL 3QGVA 2QLVB 4I8DA 5D5MA 4ELME 2ZT9C 5D2NC 1G5AA 3P30L 1G0YR 3U83A 5C08B 3ZDZE 1EFXB 4KHXL 3FFCD 4G8FA 2AK4B 2W59A 1CYXA 3W2DH 2VKWA 3T3PF 1HEHC 3N91A 1V8HA 5D93B 3LTVA 2BXYA 3ULSB 2VXTH 2Z35A 4ELMF 2Z64C 1MQKH 4JY4B 5CJQH 1F3DJ 1INEH 3L4TA 5GJTL 3BSZA 3T0BA 1AGCA 3ABKB 2DQIH 5EZIH 1F4XH 2BSSB 3IRZA 3LCYA 1WAAA 1NWOA 3MRQB 4FFVC 4YH6A 1BWMA 5KTEL 1ZS8B 2W65B 4LPXA 2Y25A 4ENZA 5K59E 4LEOB 3DK0A 3C6LD 4KZDH 3NA9H 1DQQB 1MF2H 1G9MC 3D4ZA 2X09A 4XBEL 3RWEB 3HUJE 3LZNA 1IO4C 5EBMB 1KTLB 4H26B 1UVQA 1G7LB 3G9AB 3OAUH 4NN5C 4YPGB 5GGQL 5MEPB 3RA7H 2J1YA 2ZOTA 1YEKH 1JSYA 4U1JA 2XZZA 2Q20A 3CFCH 3BGFC 2H6OA 4L29B 5EU6E 1GOGA 3WFBL 4ZQKA 5GSVB 5CUSL 4JM4L 5AB2A 1EJOL 3FNKA 4KTEL 3SGEH 4EIGB 4TTDC 4N90E 3BWUC 3QYCA 5JO5B 2BOCB 5D1XA 1GY1A 5IREA 5JW4M 1HXYA 4JKLA 4HBCH 2YD8A 1JTTA 5EBMA 1A2YA 1I53A 3T8VA 1R4XA 5DUBA 3SDYH 3EXJA 4S0HA 3ROLB 2K9UA 2WWKO 3NGBC 1FNSH 2XWDA 2J6EA 1F90L 4WUUB 1KT2A 2VR3A 3EH3B 4JFEE 1SZNA 5C3IA 2ZWSA 4YDZA 1P4UA 4CN6A 5KBDA 4HC1A 1AQDB 1TEYA 5DF0A 4ZMQA 4PJGB 4JPVH 4IKIA 2BSTB 1FIEA 1HI6A 3N43F 1RZGA 1PLGL 4OT1H 4F7PB 3DDFA 3IMSA 4YK4B 3QDGE 4HJ0C 4V1DE 3WY4A 1KTRL 3FYEB 4X6CF 4PJIB 3LRHA 3MN8A 4FC3E 4A6YA 2V3FA 1IX2A 2PP9A 4IU2A 2QPSA 3VGEA 3C60D 5DS1A 5EZJB 4GMSH 1U8LA 5C08A 3HZMA 1BLIA 4W4OC 2VAJA 2WIIA 5DUJA 5HGBA 2MPVA 2ZNWA 1TVBA 3BT2L 4JO2H 3WLBA 3QUXC 3GBML 3BYTA 1CXIA 3GSXB 2APSA 2C7UA 2ZUXA 1NCBL 2BP8A 3DVNB 2HCZX 1BIIA 1U8MB 1CWVA 4PS8A 2IDQA 3ZDXF 3BPNC 4YS4A 2NY1D 3NJFA 5ENWA 3MLSL 5JOEA 3EG9B 4JZOA 4XP6L 4DERA 1B88A 2IANA 1LXMA 4XI5C 4JMNA 3QNXA 3HHRB 3M7FB 4ZTOL 3UTOA 3QG7H 3BAEH 4PI2A 3NP4A 1ADQH 1E8ZA 5I1IH 1C9SA 4L9LA 4K8RL 2WM0A 2BWQA 4PGDA 2VDPL 2FSEA 4FJYA 3ZMEA 3FJTA 3WJJA 1EDHA 1WDAA 3FCTA 2GC7C 2VR7A 4N8CH 4YWGH 3SKNA 1RVFL 2VKXA 3A67H 3FMGL 1MI5D 4XRCB 3MV8B 1Q9LB 3QJOA 1VGEL 4ISVA 4EQ2A 3D85A 2FYVA 1BYOA 3CZLA 2X9ZA 1MFDH 3CSBA 4XNXH 1NFDE 3TZVC 2WXFA 2XC8A 2IAND 1FIGH 2IQAA 3JTTA 3S3DB 3SPJA 4OZGF 5EEVA 5HYEA 5CEYA 1IM3A 5CCHE 1JVOA 4BA0A 3WKPA 3T1FB 3KM1A 5G2NA 1A21A 2JNZA 4LGSB 4QHLB 2MIZA 2IBGA 4LBEB 4JPWL 2M2DA 4DEWA 1QABA 4YX2H 1YSOA 4JFEB 3KW7A 1K5NA 3LKRB 1S5HA 2AXHA 3BPOC 4M7KL 4WTQA 4ZFFA 3DKHA 5AVRB 3TN0A 1NEZB 1P4BL 5GGTA 4EN3A 1OARL 2UZIH 5HYFA 3KJ6H 2DWEA 4J8QA 2D03L 3CFDB 1NFAA 2R2EB 1CFMA 2PXYD 4LLMB 5JIMA 2ZYIA 4JRFA 4MS6A 1HZHH 1EX0A 2I9LB 4Y2NA 5CCKL 3QRBA 2V2WA 3QWRD 2F54D 3MNZB 4A39A 3MV9D 3UXFA 4XNZB 1MN4A 4OKVA 1AIZA 3QULA 4PLJD 4K3DL 1ZGLM 3VRIB 1VFOA 1YPZE 4FQJH 3RL1B 2L7QA 5B1KA 1R19A 3CSYA 2ITCA 4O9HL 2P46B 4R7NB 5D1ZI 4ATWA 2FR4A 2DJSA 4YDIL 1EA9C 3MQIA 3NK4A 2CR6A 5IROC 1DL7L 4WFEE 3TO2B 2IPKA 1AXSB 3J7HA 1E65A 5AYTA 4RMVA 5BXFB 3LZPA 2RAMA 3VRJB 2ZXWB 3JYCA 1HKFA 1M9SA 3EOBA 4FFZA 3TXAA 3QXDB 5EV7A 1WT5C 2ZCKL 5E1IA 3RNQB 4ZSOB 3V4PL 2XWEA 1BZDA 2X7LB 2AEIT 4UTCA 4DUVA 5CN3A 2X4OA 4KKBD 3VQ1C 1RZJH 3G6DH 1R24A 1WFTA 3CDFA 4E9VA 2F54E 1MHHA 3RDTC 1HN1A 5F7WC 1SJHB 1E9PA 1Z0NA 1DJIA 1Z3GL 4UUJA 5DS8B 1CLCA 4HJ0D 5ABZA 5CEZE 5GIRB 5JOFA 4JFED 2KQMA 1U3HC 1O6SA 2BNRA 1QMUA 1X7TA 3SYQA 1T03H 3SBWC 5L2KA 2WO4A 1IV8A 2EDDA 3LS4L 3UYRH 3UADA 4MZ3A 3OLIA 1AD0A 4MCYA 4I0CC 4BM7A 2YK1H 3I2CL 5FYLD 2WZAA 1UD5A 4CADA 5J13C 4F7CA 3WTVA 2IEPA 1D6EB 3HUJA 1RJLA 4N2HA 4LIQE 4P4KB 1F00I 4ATTA 4J8RB 2OL3H 4ADJA 1M71A 4R26H 4AJWA 3QWOB 3P4MA 2ITEA 5I71C 3SE8H 3CFJB 3GMNB 3KW8A 4AYBA 4NRXB 4DPRA 1ZA6B 4OLUL 2XWBB 4UQ3A 3V7AG 3F04A 3K3QA 1ZLWK 4NAJA 1VAHA 2CNZA 4MDRA 1SDAB 4WW1A 1UT9A 2CDFA 1B3IA 2NY1C 5CMAA 2R4SL 4MSWB 1N10A 2E3VA 5C0IA 2WYZA 4NP4H 2I85A 4A63A 3PCYA 3SJVA 1Z5LA 5IJKC 4BKSC 4N8VB 3OQRA 4JO1L 5IHUL 3OV6A 1XR8A 5T3ZH 1F6LL 1UXLA 4BBWA 3WXVL 1S7VA 2W38A 3ZDWA 4BEIA 4WUKH 2WGXA 4JQIH 1IC4H 2C3HA 4D9LH 3MFFA 1PZDA 2ED7A 3EIFA 3VFRB 2CRZA 3RDTD 5IEHA 3V4PB 4ONGH 4PJIF 3K6SB 3QCUH 5IESL 4D8OA 1EAJA 3VD4A 2ENSA 2FD6L 3FTGB 4M7ZB 4WJ5B 5C3TA 2C3WA 3GS7A 4PR5B 2XJLA 4ORGB 1PZSA 4XCEB 3WTYA 3H9HA 1MAJA 4JZJC 1FGNL 4Q74A 5CZVH 1RKRA 4GXFA 3CVHH 5L8JB 2E9GA 4FQLH 1Q0XL 3P0VL 1TTAA 4RMUA 2AERT 4OD3L 4G59C 3VFMA 5FLVA 1AHWC 2L7EA 4AH2A 3ESNA 4UT6L 1BFOA 3AXIA 1OOWA 2BS8A 3CFIC 3V8OA 5TE4H 3SO5A 1GGIH 4XB7A 4H8UA 4K7FB 2BHYA 1H3PH 1ZT7B 3BD3A 1CGTA 4F3FA 4WEEA 3QDMA 4BKTC 3T0EA 1U2HA 4MQ7A 2A3TA 2KL6A 4AIZB 2OP4L 5I16B 3MLZH 4TQHA 5I6LA 2DLFH 2NTFA 3CN1A 4GIAA 2QBWA 5B4MC 2SODB 2MPAL 1CXEA 2H2PD 2OZNA 2VLRE 2W95A 4PMEA 5D1ZA 5JHLL 3W38A 2C1PB 5FA3B 4LCWE 1F11B 3FU7B 4ZUVB 5KYXB 4OCXH 5AW5B 5LGYA 5JUEH 4LLQA 1EHXA 1A6ZA 5E9DD 3WN5C 4U3XA 2RIKA 4FYQA 2H32B 1P9MA 2YHGA 5ESVA 4G6AC 4LVHB 4ZDHA 1FNHA 1IIIA 1NAMB 4XBPA 4CGTA 5I6XB 4FQXC 5AVYB 2DWEB 4LCIL 2EE3A 2FBJH 3QCTH 4J8RA 4LSUH 3D0LA 3T4AA 1HOCB 5KVEH 2DYPB 5IQLA 5EIIB 2ISDA 3MLYH 5AW4B 3CX2A 1BVNP 3QHZH 1KPVB 3TYFB 1DZBA 1CU4H 2LLNA 3F83A 2BS9A 4N28A 1LO5A 3H3PH 2E8ZA 4XMLH 3ES6A 3A3YB 3VWJA 2O72A 2I07B 5EF0A 3M88A 3GSWA 3L08A 5TPWH 1VZIA 1WSST 5EO0A 1A4JA 3K8LA 1SDDA 4XPFH 1VERA 4YMPA 2J55A 2P48B 3TFKC 1ET7A 5ISZD 3L3OA 1KJ2A 4FADA 3Q8CA 1OGTB 2DQJH 2RCSL 3O6ML 4XOCA 5HHPA 5CD3B 1FLRH 1ACYH 1DFXA 4JANB 2ICEA 1A02N 3KJ4B 3GMLA 1VGKA 1MKFA 4PJ8B 4FNLH 3MJGX 3T5WA 5KANG 1XIWD 1BAFH 4JVUA 1OT4A 1E50A 3IE4A 5D2LB 2UWEB 3OXSB 3FONA 1UD4A 3GS4A 2EKSA 4PJEF 4YHKH 4F9PA 5C0EB 5KG9A 4R9HA 3LY6A 4ZTPL 1S9XA 1IEAB 3CVIH 3VA6A 3VRLE 2IANE 1ZANH 3ELQA 4I9WE 1LE5A 3RWHA 1N6QH 5D71L 1SUHA 2V2WB 3IT8D 5K9JH 2WQAA 3QWNA 3LB6C 5B39B 2PO6A 4EZJA 5I18L 5HSFA 1I8MA 4Z3IA 2VITA 1UADC 4XMWA 3IKCB 1QFHA 2BY1A 2YLHA 5JR1H 2JQMA 2FO4B 1UXMA 3QPXL 5T1JA 4IU3B 4GO9A 5ANHA 3ZTEA 2APBA 1LO0H 3QR2A 4YK4C 1OP3K 5DVNA 3FFCB 5F7KC 2P5WE 1AIFB 5EC2A 1CD9B 2GY7B 4KI5F 1I1AC 3MX0A 3JTSA 1ASPA 5J57B 1VSCA 3NGBB 4KUCF 5J6HA 4CJ1A 1OAUH 5E6IB 5C0ND 3MRCA 4NT6A 1QA9A 3O4LE 1PD6A 1ZHKA 2EC9T 3CK0L 3JTTB 4S1DC 2P28B 4FKHA 3BC9A 4QYOA 4P57A 4ZAKB 4HWNA 2F8VA 3KPRA 2ZPKH 1FPTL 3EJZC 3ELAT 2V7NA 1CL7I 4ABQA 4HKZB 4M4RB 4CKVX 3QQ4B 4HPHA 4P04A 3OB0K 5DUBB 5M7QA 5LQBL 1B2WH 5IHWA 3M17A 4WY7L 3S3CB 3FQTA 4DP8X 1DLHB 2P80A 3S7GA 1GOHA 3RGVD 1B0RB 2NYYC 2AEWA 1N26A 3PQYE 4Z7UB 1AKJD 3AW5A 3JQOB 2CKNA 4YLCA 3RU8H 4U6VH 2J6EH 1GHFH 2GJ6B 3PGDA 4PV1C 2QADD 5KN5B 1AS7A 5KW9H 3HUJF 4O4YH 4RA3A 2OPCA 3S5LB 2A83B 1XB6A 1G9MH 1NBYB 4YIQA 3GKWL 5HI3D 4ZOAA 3QI9B 4HSAC 2CIKB 2CLVB 2F58L 4NCC2 4WAFA 1X5FA 2WQWA 2HG5B 2HFTA 2AXWA 5EN2A 3F64A 2AXJA 4X9GA 5T1KD 2CDEA 3ARZA 3SCMC 4KY2A 4MMXB 4Q52A 3ZRFC 3DYOA 1I9EA 5JNYA 5IJCC 4J4PA 2JCCF 3GLZA 1ZLSL 3DTDA 4Y9FA 5CGBA 1V54B 4DFHA 1DQQA 1JXDA 1RUML 3P73B 2A9AA 5SWZA 1S7VB 1SDYA 2JKJA 4P2CG 2Y5TB 4OGYH 5GJSH 2JIXA 2R9HC 3BD4A 4PRHE 1TLKA 3T8XB 4FFWC 3MLUL 3LXAA 5GS0C 2GBTA 4KJPC 1JWMA 3U6RA 1LE5B 5DHMC 1UM6H 1F2QA 3MHZA 4WWOA 5F7YC 1AHMA 3OKNA 1JXFA 3F05A 4Y5VA 1XF2B 4OV5A 1OCZB 3CZKA 2QV4A 1WWWX 3JV4B 1J9SA 4UV4L 5HI5C 2Z7WA 5FGCB 3WE6A 3G6AA 4UQDA 3OR6B 1M2VA 2ICWB 2OMXB 3DDGA 1I8AA 5EUOF 4JQXA 4CVUA 1R5WB 1KJMB 1PW3A 3VXTA 3MRKB 3N1MC 3KPLB 1J5OL 1DBAH 3GSQB 5PCYA 3D87B 4KMQA 3Q2VA 5B3SB 3VG0H 3BH9A 4PG9A 3RVWD 3KPNA 3DETC 3T4YA 1W72L 5EUOE 4ANUA 2C9VA 3AWEA 3L95A 4XWGH 1SDDB 1OZUA 3V4UL 2AXGA 4PRPE 4MKMA 3LRSB 1AJ7H 1N64L 4DF9A 2B5IB 3MOAL 5JZ7D 4PJFE 1NPUA 2AKRB 2J73A 4KJQD 5FCUL 4DQOH 1K5WA 4OF6A 1NBYA 2GK0A 5SWSD 5I76B 3QJFB 3WEXB 2WKOF 4KMTH 2DBLL 1G7IB 2V9RA 3UZEA 1FA4A 4LCCA 1X4ZA 5DO2C 5GRUH 5AVXB 1OW0A 1LWRA 3GSVB 1OXYA 4Q4IA 1OM3L 1YEEH 2JKWA 1HHKB 4I0PA 3V0WH 3BKYL 5BZXA 3O11B 1DLHA 3HE7D 1S7QA 5T3XE 2BNQE 3QJHB 4HF5L 4FMVA 5HHXL 4NQUA 1LJMA 1IKOP 1UWGL 1UCBH 1WEJL 2G9KA 3MLPA 4Y4FB 5IK3B 2CCVA 3OSKA 3X11B 3QUMB 4M4RA 4MCZB 3ECQA 3QCVH 4OBRA 1FSKC 1QKZL 4U6TA 5T3ZE 1BFVH 2IWFA 3T1WA 4FI6A 3S3PA 1GZHA 2N7AA 2WO3B 3BH8A 3D7PA 5F9OL 1QFOA 1RK7A 1XL6A 2YAMA 1MCNA 4HDIB 2PWHA 1E3FA 1AXIB 3GZOA 5LGHL 3WNNA 1S7WA 1BQRA 4XMKH 1DANU 4W9FC 3TNNA 3UTTD 5DWUL 4NPYA 1L7IL 2CR0A 4B9YA 1JUFA 5BV7L 4IS6B 4LO9A 5E1QA 4H8WH 3V6FB 2WXOA 4FGMA 2GIXA 4M6OH 3UC0H 1M1XA 4GRLA 2VDLH 1A4KB 2X6MA 4IIQC 2H41A 1LVEA 4YSDA 4YUEH 3IXTB 4XVUC 4AV0A 2NYYD 3JTBA 1VF5C 4N6RB 4YJZL 3L4ZA 3VFNB 4QT5B 5I1JL 3KYOA 2BNRD 2BRRL 3QAZB 2E59A 3FZUC 4H25A 4QXWA 1WZLA 3MV9B 3N44F 3ZYJA 4G8GA 4NUGH 5CEYB 1H0DA 1CXHA 1ZHNB 2ZYHA 5AQ0A 2AQSA 2ALAA 4ETQB 2HX8A 3UO1L 3LKOA 3E6HB 2VDNH 2MCMA 1S3KL 2Y1ZA 3VD7A 4M7JH 2VZOA 3ARVA 3LN4A 3ULUH 3NFPB 4TN9A 5BJTA 4Q0XH 4NC1E 4CW1A 4XGZA 5DFAA 3HE7B 4BWTA 2JLPA 4XO5A 5C0AA 1OP5K 1HWHB 5DMGC 1XH1A 2YQBA 4WO0A 4JFQA 2P7TA 4FNQA 1VGKB 4TUJA 4KVNH 5F9JA 2D31A 3IU3A 2X3AA 3O4LD 5EU4B 3UYOD 5JXAL 2HFEA 5F88B 2R0KH 3LX9A 3QISA 5C0FA 4Y2DB 3BX7C 1YN7A 3BN9C 3PAUA 1XZ0B 4MB3A 4DVBA 1QWUA 5HHOA 4CNIA 5FB8A 5JMOC 1EJ6A 2O6DA 2DM4A 4UB0L 3FRPG 3HN5A 4OGAC 5GS1A 4GAAA 2HPTA 4NZRH 4N25A 3W9EB 5DUPL 3MV8E 2ENJA 2QV2A 5KYUA 1PKQA 3PAZA 3ZGIA 4OLYH 4RDQG 3BHBB 3EF4A 1QTSA 4KXDA 4AIEA 1JPFA 2V37A 4N24A 3ZVVA 4NHCL 1IGIL 3EOAA 3SO3B 2OAAA 3MZGB 3UX9B 3HZKB 3LQMA 3TV3L 2N7BA 2BP3A 3TVMB 2OJEA 1GS7A 3CZNA 1DEEB 2PW2A 2WCPA 3BP4B 3L5WA 2AJSH 3IEAA 3U7YL 3CUPA 2IGFL 5K5YA 5GGSB 5HYJD 3QI9A 2VLRB 1UWFA 4KC3B 4FFYL 2L7JA 1S8DA 1X9QA 4TXVB 3QUXD 3X11A 1BEYL 2YZ1A 2GJ6A 5DJ2B 2EVFA 3KPOA 5F0LB 3STLA 4V1DB 4Z7WE 2BSTA 1F1GA 1Y0LB 3QEHB 4S1RL 3TVMC 1RV6X 3WD5H 3FF8A 1I8UA 3QE5A 3T6ZA 1D7CA 1U92A 3IWUA 2TAAA 2WJ5A 1HZKA 1HQRA 4N2KA 1ZS2A 4P3WA 3KLSA 3QR0A 1QSEA 1HL8A 3VFWA 1J1OH 4XCYA 3X1NA 4XE5B 2B4CH 2P8PA 1CIUA 3DXAB 5IY5B 2X4UA 4OGAD 5JYLA 5DMJB 5KS9E 1UZGA 2NCEA 3QIBB 3R7QA 4NCDA 3FN0H 2Q7NA 1BGXL 2BOCA 5D1XB 3FB5A 2W0FA 3ZXAC 3IS1X 1FHNA 2YPLB 3UMNA 4GKSB 3GMRA 3U0WL 4HXBL 2O5ZH 1KB5H 1HE7A 4UDUB 4Z7WB 3GHBL 4XMVA 4CBPA 4LVOC 3FUNA 3QFGA 3BSGA 4LFHD 1OCRB 3GMMB 1OSZA 2JSFA 2YUWA 2WY3B 1N18A 4JCLA 1AG6A 2OR9H 2B0SL 2BC4A 3VI3F 2CKBA 1J1XH 3AY4C 3OXRA 5A2AA 3Q01A 4PRDB 3CFBA 5T1DH 2CA3A 1NGQH 3S36X 2ZZUT 4JGJA 3WIIL 1GYWA 4OGXH 4ONFH 2OYLA 4WW2C 4XNDA 5E8OA 3FCUB 5EOQL 5KVDE 1FL6B 4PU2A 5IM7B 2ICWI 4P3DA 3FAWA 1OHQA 2OZ4H 2FB4H 1NUFA 3IU3B 5EU4A 1I8KA 1BQHG 2UX7A 4JFFA 5C0IB 3REWB 5EO1A 1B9KA 5DGQA 3UJJH 1BZOA 2PXYC 4MA8L 4BH8A 1YNTA 4IGBA 1F42A 2AEPH 4M1GL 1ET8A 3M7OA 4M93C 1U8IB 4JFDE 2CLRB 3EYQC 3QPQC 1Q9OB 4MLIA 2CDGB 4P4RA 1NBVL 3LN4B 3CIAA 4WJG3 4JFHE 3LNEA 5FYKU 4LHUA 3LKOB 3PL6C 4YL9A 4XCCL 4JRLA 4YHNB 4BUGA 3H56A 1FYTB 5DVKA 1D5XB 3ZTJH 4LSPL 1LILA 4BCZA 2VIRB 3COOA 1KXTB 2DB8A 5FKPA 5F9WC 3BP7B 3K2MC 4RGOH 1RURL 1QO3A 3UEQA 5JMRA 2LLLA 1A7OH 1KNOB 1ECYA 3SE9L 2OL3A 3OJDB 5A3ID 1BIHA 2XTJD 2YMTA 2E56A 3W0WB 5DYOB 2EZ0C 3K5RA 4Y4FC 3DX8A 4RFNB 4ZMOA 5JOFB 2UVFA 2J57A 4EOWH 2DN7A 3DC0A 3GSNH 3HLAA 3UMTA 4R90H 4LARH 5KOMC 3PWVA 4S1QL 3WEOA 3EOYG 3MGTB 4MCNA 1THAA 4RZCA 3RAJL 2GTWA 3HS8A 4GO6B 1PX8A 3RX5A 1PZCA 3GPEA 4OD1H 4TPRH 1A0QL 4P4KC 3RL1A 1S9WB 1WH0A 4RFOH 3QHTC 2WWKT 3SGKC 1RERA 4GS7C 4KQ3L 4QJ3B 4HS3A 4KY1L 1NSNL 4AQZA 3P0YH 2WZ6A 3T9WA 3K8MA 3LXUX 2Y23A 2OSWA 3UJTL 4HSCX 1FL6A 4HYTB 5B3NA 5I1GH 4PP1C 3GTNA 2ZUSA 5AG8A 3UYPA 1X7SA 4TL5A 4Y19B 2WHVA 5T3ZD 4F7PA 2RJMA 2XU9A 4YQXL 3ZDZF 4GNKB 1L3NA 2Q8BH 4AQ8C 2H1PL 4TUKL 3SGJA 3LS5H 25C8H 5ALBL 4LOFA 4XC3L 5E9AA 3FN9A 4X6DA 5IFAH 3UZVB 2Y22A 3GJEB 1QBBA 4FMKA 1HL5A 2CH8A 2D8KA 4F27A 1TYJA 5I19L 3P3UA 3LEXA 1WZMA 2UWEF 2A6DB 1MAKA 2NYKA 5FPIA 3LZQA 3NZHH 4NFBA 1JERA 1C1EL 2UYLB 4XVSL 4JGNA 1JCKA 4Z7VA 2VDMB 2VDNB 3SKOB 4XN8A 4PJCB 3I74A 3KGRA 5CEZD 5HHVH 2WLKA 1O0VA 1SN0A 3UBXG 5DFWH 3F3HA 4DKTA 4Y9BA 4IKLA 1KBKA 3JZ7A 2ADIB 1MRCH 5E1HB 4NSKB 3PRZA 4AQAB 4PJEB 4ISVB 5C0EA 1ID5I 2GY5A 2AEQH 1P5UB 5GGTH 5AKSA 4PJ9D 2XXMB 3GQFA 4Q9QL 1SPDA 4DP7X 4QHNA 5BMFL 4AYFB 3HZ3A 1KJMA 4P4KD 1USQA 1RUPL 2CO6B 3MRFB 4R6UA 5EPMA 5T33L 2DI8A 3OR6A 3ZL4H 2HJFA 5HHPB 4P2OC 2NSMA 1YJDH 5A2FA 5E5MA 1OLZA 2DMBA 1J18A 2QGBA 1AE6L 2VLKB 2F1AA 4R0LC 1SY6A 3ATAA 5CAYB 4AYDC 3VTTA 2QZ5A 3DI2B 2EIBA 4IRSD 2PPDA 5DJCB 3DK2A 4NRXA 3QBTB 2GT9B 2D3VA 4LOUC 3FTYA 4O02B 1AKJB 5EO0B 4M5ZH 3N9GL 4NJAL 4QHUB 1LD9B 4NQCD 4ZX4A 5BOZG 4BFIA 4LNRA 2WBJC 1Z0MA 2QADB 4TVUA 1EPFA 2WVTA 3H6JA 4NKQB 3ZT5A 1AR1D 2APFA 2N56A 2HFGH 4K2UH 3CMOH 3QW9A 5EOCH 3RQ3A 3LD8B 1MCEA 5BRZA 4D2NA 5TK2A 4U4IA 1FRGL 1QYGL 2AABH 3EJYC 4NWTH 2BVPA 3RDTB 1BOYA 4KQ4H 1YZZA 3NSXA 1Z9LA 5IVXE 3PP4H 6CGTA 3ETBJ 5TH2A 1GGYA 1KFAH 1OT1A 3F58H 3VG9C 4ECNA 5CWSB 3T3ME 4DOHB 3RVUD 4N0RA 4F58L 4DESA 3KEDA 2Z9TA 3ARUA 5DJ0A 3OJ2C 3VFUA 4DK3A 5T1LA 5I28A 4X4XB 4XBGB 4BZ1H 1J88A 1GGTA 3MROA 1PQZB 1T66D 4KH9A 2J4WH 3S96A 2FK9A 1AC0A 4AYFA 3WMSA 5F89A 3B9AA 1XF4A 4BGDA 2FR4B 4L9DA 4OU3A 3GBLA 4QOKE 1ZVSB 3BWAB 3T65A 1LTXA 5I5IA 5DHVH 3F7PC 2WWMD 3QQNA 1SM3L 2GPZA 2XCMC 1FVEA 2NY7H 2E7CA 3TO2A 1LL1A 1CBVL 1NC4D 3L48A 3UFIA 1KXQA 3C60B 5HPMA 4WTXA 3MNZA 4QO1B 3T2PA 2QHRL 1GSMA 3E0GA 4J27A 3D0VB 3UTTE 4NQCB 2VZSA 1WGVA 2ZG3A 5E9DB 4M5SA 2R2EA 4QY8B 3MLRH 4ZW8A 4M48H 3FTXA 4RISL 1YMME 1EAPA 1KYFA 5E8PA 3I9GL 1HIMH 1T89C 3QZWB 4K5OA 1DVFA 5ITFB 1WS7A 3HBGA 3BO8A 4X6DB 4DCQA 1BM3H 4NOBA 1KIQA 2EYSA 2AJYH 1VJSA 4G9DA 5GQBA 5E24E 3LIUA 3LEXB 1O5DT 4OFYD 2WXGA 4X80L 1KIRA 1XR8B 3MV7D 3N2JA 3PHSA 2VZ3A 4H13C 4LPTA 2DQEL 2AJUL 3JZYA 3RRQA 1G6RB 4DETA 1ZY9A 4H26A 3N06B 3K2IA 3U30B 1IQDB 1I8LC 2I60L 4FAAB 1IEAA 1FZKA 5E9DE 1ZGLA 1JZGA 2NXYC 1SMOA 2XNAB 2XVKA 1MI5B 4Z3JA 1AO7E 2VISB 3OC5A 5F7LB 3ZYIA 5LG6A 4LVNB 1MCIA 1A7QL 3GS0A 1HH9A 3NT0A 1Q9WA 2XN2A 2P5EA 4EZKA 5E8NB 4IM8A 4OLVH 5FX3A 4X99A 1B6UA 2MQ0A 5AAPA 1JVKA 1U8CB 3K80A 4LK4A 1J10A 4IEFB 6PAZA 3BH4A 3MJ9A 4AUYA 1PNDA 4LCCB 2VWEC 1QLFB 1Q1JL 2YPVH 4EEEA 3Q6FB 4JAMA 3WTUA 2HB0A 2YXFA 3FCTB 4CA4A 5D2NE 3DSFL 1E4XL 2DTMH 5C71A 5AOMA 4KZEH 1MREH 3SIKA 1G1CA 3O81A 3C5ZC 3GSWB 1DR9A 5EF1A 3L3GB 5I1AA 1I9IH 4OCWL 2H26A 4GFXA 3EBIA 3V55A 3LN5A 2D7NA 3FOMA 3BRDA 5H8DA 2A74B 1T22A 1FVDA 2VUOA 5F7AA 3TIEA 2WBJD 3V4VB 2F2HA 5MEOA 1PKOA 4PGCB 2B1HL 4JHUA 2JKNA 4WW2A 1EGJH 1XHHA 1PG7L 1IE5A 1FYTA 2WXLA 4JFFB 2YXMA 4M6NL 2Z7ZA 1FZJB 5DK0B 1HH6A 3QFJE 3HAEG 1QFWM 4Q6IA 5AOLA 4KNTA 1AZUA 2C4FT 1JK9A 1HDMB 3TONA 4AQ1B 1U8IA 1MSPA 5HGHB 2E9JA 3SKMA 5HGBB 1N8OE 2PR9A 1PCXA 4K7PL 3SY0B 3B5HA 4R83A 3TEXA 1UFGA 4Q56A 5HDQH 1VDGA 1FO0A 2HLEB 3ZRCC 3MJ9H 1JRHL 1KZYA 1DQVA 5B38A 5I0YA 5I16A 2A73B 4P07A 4QR7A 3ZYZA 4DFIA 1F18A 3VXQA 5EA0L 4YXLH 1SY6H 4FS0A 1CD1B 2ZX6A 2HLAB 3IDJA 3UIZA 4QRRA 1GC1C 1A6PA 4QRUA 3SZ6A 2EECA 4QLWA 5E5MB 1PD0A 2BVEA 3SPIA 5DD5L 1Z9SB 1TTBA 5FIEA 2BC4B 2Z65C 1EAPB 3CXHJ 4IRZH 2CO7B 5LN4A 5FXCH 3FT2A 2LU7A 4MJ4A 4QAWA 5I15H 2CLVA 4YHZH 1ICTA 4N8PA 2YIHA 1YEWA 2V9QA 3BVXA 2CE6A 1I3RB 1U3JA 4RFEB 2C34A 4PRPB 1ZSHA 4RSYA 1BW8A 2FBOJ 2WTRA 5I73B 5F0JB 2VSCA 5C08E 1MIEH 4FP8H 1UFUA 3ZE1B 2EXYD 1PDKA 4R2GB 2FX9H 3AT8A 1MHPH 4ZO8A 1XGUB 5DRZB 5IT2L 4LRNH 4POYA 2YEVB 2VMEA 1D2OA 3MREA 4KKPA 2FJUB 1GW0A 1JRHI 1EFXD 2VXQA 5D7EA 5B4MD 1QHPA 3FCGA 1F4HA 1JN6B 4OIIL 3IS0X 2X4PA 3T6VA 4J3TA 4F2MA 3D2TA 2IAMB 1EANA 1QW9A 1FZMB 1KC5L 3QJQB 2EAEA 1BJ1J 5DMKB 2FNWA 1I7ZA 1WCBA 3LHAA 1YY9C 3QUKB 5K1VA 1IAKB 1T5WA 2AI0H 4ALAL 3ETSA 3SY0A 4N0YL 3TBVB 2NQCA 1MNUH 2KZBA 4NNYB 4KK5C 4Y16B 5ILTL 4YHLL 5KSBF 1IARB 3ULSA 3ZKQD 3JWOL 4JN2B 3TA3B 4Y0GA 3WNJA 2NY4D 2EYTA 3BI9X 1J86A 3QIBD 2VQTA 1AP2B 2XG4A 3NJLA 4NQEB 2YKLH 1RD6A 1HHJA 1BMZA 4OD2B 1DBJH 6FABL 3QC6X 2CO1A 3ME0B 4H88L 1C16B 4NN6C 4AENA 5KYWA 2J20A 3L81A 5TJWK 1BF5A 4B9FA 4E41A 4CBZA 2NT0A 2VUKA 2G3NA 4M6MH 3ABGA 3I75A 4IBSA 4YNYB 4X5LA 3DARA 4I48B 1C5CH 4OFQA 5F3FA 1UACH 1A9EB 4JKNA 1C7TA 3RPKA 5E08L 3FPXA 2JJTA 4PB0H 4Z7NE 1J8RA 4WW2B 2GJRA 4ODVH 1AKJA 4KV5F 3SGDH 1U8JB 4LQFH 1QSZA 1BQSA 4R4BB 3IDGA 1J5CA 3H3BC 4JAMB 1XO8A 3KWWB 1UB6B 1UC6A 4R2GD 4Y4KC 3C6EA 3RHWK 4A7SA 4RRPM 4WFFD 5E2TH 4EUPG 2H26B 3ZIYA 4HX1B 3SODB 4FQ1H 5F0MB 3G6JE 4LVOB 1J9TA 4MA7L 4X83A 2P8LA 4H8HA 4AGOA 1KENL 5FUOL 3VFSA 5CP7B 1IMHC 2JJSA 3DHUA 1EAQA 4X6BB 4HXAH 4YDJB 2NQ3A 4Z7WF 1AY1L 3VXSE 2E7LC 3ZSSA 4CC0A 4CW1B 2C1OA 1PU0A 4GQQA 1YEGH 2YRLA 3MUUA 4A67A 1FZKB 2EABA 2Z7UA 4LDOB 5EMYA 4Z18A 4K0OA 2QGEA 4JEGB 4X8JA 4FLHA 4ENEC 1EEYA 1MCCA 3DUSB 5JLZB 4HGWA 3ZL2A 2DICA 3VFOB 1W16A 1R3LA 3N1FC 3CN4A 3PAYA 1L6XA 1A4KA 4H25B 4BUQA 1MAMH 5CD5D 1KOAA 2QTEA 4NX0A 2NT1A 3CFNA 5J8OA 1MOEA 2UWEE 3EJPA 3QJTB 3TT1L 1X5XA 2C9SA 1RSFA 2EUZA 3KJ4C 3K81A 4TUOA 1FL5B 4K71B 4DCQB 3ZU8A 4F33A 1MJ7H 4PJ6A 3U9WA 4JQIA 2MRYA 3BYYA 2XPZA 2LU3A 3D48R 2K6WA 2VSKB 1FH5H 1K4DB 4X0NA 3WIAA 2PYEA 5CZXD 3L3HA 2CHWA 1CGXA 4A2LA 5C97A 5DD0L 2ICCA 1KDJA 2UY6B 1E3XA 4E0RA 3O45A 5B38B 2D3JA 5E7BA 1XIWA 4YE4L 1FDLH 2EIEA 3SSGA 3O2DH 4PTTB 4PUBL 1G7PA 4ZG1A 2EUWA 1TYEB 2NY5L 3B34A 3CQPA 3ISWA 4P5TA 5AAMC 4Z7IA 4JKPH 1CS6A 3VWJC 4FFZH 4LSQL 5AOZA 1DYZA 4Y19D 3D4GA 3VDCA 4AEFA 2UXTA 1ESOA 2WXIA 2WXMA 4J3VA 4P3CL 4D9RE 2VRKA 2ILLA 3MR9A 4FI8A 4FQXB 5IKCA 3HLAB 4GRWE 2FWOA 2KDGA 4LVHC 1MPAH 2ADFL 1I7RA 5ALCH 5DQDH 4B9KC 2KUTA 1BFOB 4WO4D 3FQXB 3FU6A 1MRFH 3PF2A 2NRDA 1YEHH 3GIZL 3VD9A 4E9RA 1UKTA 5EOTA 4JK0D 2Z91A 3QZWG 5C9JB 3ZKND 1UM4L 3RZCB 5FYKE 1TQTA 2FH6A 4Y1AB 2IO5A 5AVTB 2ROYA 4WI4A 2RHEA 3LRSA 3VFUB 2D3LA 2GBVA 1RH8A 3PAVA 3T0VA 1ACXA 3QQ9D 5BV7C 1QAWA 1DEEA 2PW2B 4YLQT 3WE6B 1RAMA 5T5FL 2VLJE 4K3EH 4L0PB 2RGSA 3H0TA 3INUL 2ICES 2XZQH 1ECZA 1MFEL 1C16A 4S0TD 4AENB 3MRKA 4PCTA 3LKQA 1P5VB 3P54A 1U8LB 2BJMH 4K8RD 3FBKA 4UT9L 4YDMA 3MLWH 2G75A 3S2CA 4A7GA 2O6PA 3OC8A 2QQNH 4KKRA 3FQUB 2R1YA 3PWJA 2VXUH 1JF6A 5GS1C 4KFMA 2HJKA 1T0NA 5HYIA 1DBML 1KSRA 2IDFA 4M43L 4HS8H 2AQQA 2IOMA 3BPCB 4IIQB 4F8OA 3A4DA 2XWBA 4P49A 4PJGA 5IJDC 2HSIA 1HSAB 5TF1L 1U3ZA 1R6VA 1HC1A 3HI1A 1ETA1 4UIKH 3QJSB 4BWWA 3BGFB 1MVUA 5GS2D 1T80A 1PF3A 3BFWA 1HCVA 4NPKA 3FQ4A 4GKZA 2GJ6D 1W0WA 5I74C 4HLJA 2FNBA 4CL7A 5E1AA 2WLMA 3NFPA 3VD0A 5I6KA 1XCXA 5J12B 5LGJB 1Z7JA 3H7LA 3CN2A 2EEAA 4Y5VC 2CHDA 1ZLUK 4MNGA 5AYUH 3AMKA 3GI8L 1BVZA 3BMWA 4NZJA 5HYQB 5CIPH 1AGEA 3D30A 3MA9L 4P5MA 1IBGH 2EE6A 2VDRH 1V3KA 3I02A 4ZOEA 3MJ7B 5TD4A 2FATH 1VFMA 4NSKA 1OF2A 1NFKA 4OF0A 4G5ZL 5AKRA 2YBRA 3DMMC 1SBSH 4PJXE 3HVDA 3S34H 3MJ8A 4JDZB 2XZAL 4NBZB 4P57B 2FWOB 1LO2H 3TEYA 1BBDL 1HYSD 1M1XB 3WGUB 3IDXL 4TOYH 4L3CA 5C0NC 5D5MF 1XGQB 4LEXH 3NIGE 4LASH 3HG0A 4O5LL 4E9XA 1A1MA 3CZGA 3QQ4A 2BVTA 1SYVB 3A6BH 3NESA 4JQVA 3V0FA 1QFUH 1TOXA 1G84A 4V2CB 2VLJB 1BVLB 3L5XH 3QP3A 1SQ2N 1O9VA 2DYRB 2Q86A 1Q0YL 4EO5A 3E38A 1D7FA 4HIIB 2ZCLH 3VO0A 3I50H 2UV3A 1H6TA 2WANA 3IU4H 4MKTA 4FKKA 4Z8FL 5E94A 2ESVE 3P77A 4NNXA 3MV7A 4TVPD 5KZCB 2WD0A 2F1BA 4X4YB 2ZX7A 3WDHA 1OK8A 4E42B 2QVTA 1BPLB 4DT2A 5KYUB 5AWNL 5T1KA 5C07A 3AZUA 1I3UA 1B9ZA 2XY1A 1PY4A 2BHUA 2ARJB 2WC7A 4UIMB 5E95B 3AQXA 3W0WA 2EE0A 1QBLL 4U6XB 3RVTD 3VXMA 2A1WL 4ZD3H 1MEXL 3C8KA 2R0ZH 1MZZA 4PWHA 3G3LA 2NNFA 2XTJB 5IP4A 4Y8AA 2V6HA 3I6GB 1LE9B 2K0RA 5EEXA 4Q6IC 1T1ZA 1PG7X 1EZLA 4UINH 1R3JB 3HC4L 1T7WA 3CFEB 1OAXH 32C2B 2YARA 3MBXH 5AZEH 1E4WH 4ALAC 5KG9B 3FO9A 3C60C 5FUZL 3NCMA 4FTDA 1W0WB 1J05B 1FFTB 5I6OA 2L7UA 4Z5RB 4UAOB 3HI6H 1NGZA 1Y07A 2HTKC 3RIAK 1DVSA 1T2XA 5BRQA 5F3BB 2E0PA 3IETB 3MRFA 1HHIA 2VDML 2Z1PA 3GBNL 3QZLA 4X4KA 1B4JH 2GSIB 4KXZH 1U8QB 1VZGA 4LCCC 5I75C 4XPGH 1VA9A 3F7VB 5EU3B 3A6OA 2GTZA 2PWEA 4LKXB 5BRPA 4AQOA 4QT5A 3NCXA 3MNWA 4QTHB 1P0SE 3MTRA 3EG9A 3NP3A 5IQ7H 3KYKH 4AX3A 3CVCA 3APCA 4JHAH 5C0CB 3RFZA 3T8XA 3VMOA 3NFSL 3RVWC 1IAII 3KYMB 4LFHG 4YHPA 2BMKB 1ADQA 2XN1A 5E8OB 4LXFA 3V0HA 1T89A 1G87A 1EO8L 4UDUA 3B2VL 4Z7WA 5C92A 3AT0A 1D5MB 4NXKA 1J0ZA 1QZ1A 3IVKB 5T8IA 4JN1H 3H2PA 5C8JA 2CZNA 2CKBB 2ZG2A 2LAAA 1S9VA 3PWLA 4B9PA 1DBBH 4U7KA 4D9QD 2ETWA 4DOHE 5IV2B 2W9EH 1VFBB 1E5CA 1I1AB 3T2OA 3BJLA 2WLNA 3ZKMC 5KJRH 2XXFA 2V2XA 3FQNA 1WIPA 3QUMA 4NNYA 4BHUA 4DGWC 2VLKE 2YRBA 4N1HB 4P23B 1CLOL 1QSEB 1S2EA 1GVIA 2CJUH 1KJ3L 4G9FE 4PJBF 4KRPC 5D1ZB 3VFWB 3X3FH 4HH9A 3TIDA 5J06A 3TJPA 4GMTL 4IOSD 4TULL 4ZS6C 4AQEA 5C7XL 2WUBL 2XT1B 3KD4A 5AG9A 5FO8B 4FXKA 1NCJA 1JGLL 1PLBA 1S9YA 4DN4L 1OPGL 3MR9B 4FQXA 3BDYL 3ZKXC 4Z7OE 1FFPB 2ENYA 5DJ2A 2VLKD 1KJVB 3CQFA 3B2MA 4OFPA 2V7HB 4YHMH 2V7NB 1RJYB 2BNQD 4AIXA 1JTPA 3P3SA 2DJMA 3DURB 3HFFA 1YN6A 4POZD 4JG5A 4DP1X 2YPKB 2X3BA 3ARSA 4BXSV 3FCSB 3MFFB 1PZUB 1BZ9B 3TNMA 4PJFB 2R29L 1WAEA 3KL5A 5IBTH 1IGML 3FRPB 5IUSA 1V3LA 4WHDA 3KCPB 4XCEA 3LIZA 4L0ZA 5JQ6L 3D18B 3MYZA 1EQWA 4G72B 4IBQA 5I8EB 4AYGA 1HT6A 1IZJA 2FECI 3O6LL 3F65A 4NM8L 1A7NL 1HSAA 1YC8A 1GAFL 2QR0B 1JHKL 4J6RL 4KVCL 4MVBC 2QL1A 1JPST 4JPKH 3W3BA 2HX7A 4UOQA 4XC1H 1TETL 5AD0A 4HOXA 3LQAL 3RVTC 1NGPL 1NCOA 3OWRA 4Y16C 1YVLA 3LPPA 4HFWB 5E0FA 4O2CA 2X05A 4XPHL 3I6LE 2GSGA 5TQ0H 4FDWA 4P9ML 1AVAA 3RUGF 4FZEL 5D7LA 3SYAA 4BSJA 2DKSA 4HJIA 3U4EB 2NY4B 3L1OL 1E8XA 2X0VA 4JHWH 4JO4H 4JY5H 4N0UB 4WTZA 3WAJA 1AD0B 2LABA 3QIUC 3X1BA 4RGMC 2CDEB 5LGKA 5FHAL 1H0DB 1MCPH 3U4BH 2BFVL 5D1XD 3N04A 4GKLA 2R51A 4PBVC 4XN7A 1I7UB 1OTSD 1LO3L 1CFVL 1J05A 3NJHA 3L4CA 3HNSH 2ADGB 4HPOH 3U4AA 4PWGA 4PGJA 1KBPA 4GH7B 2B9AA 4F7EB 2JQAA 3M8OL 4ICWA 3HR5A 4O2FB 3MJ6A 4GO8A 4XN5A 3MOQA 1G9NL 5BZZA 1RFDH 3DRTA 1CDBA 4N2AA 4GW5B 4ELMA 3TCLA 4YSTA 1WFIA 1J9QA 1FFPA 1QRNB 4JY6A 5DVMA 5FW8A 3SDDA 5DZNA 4DUWA 3S35X 1XGRB 1Z9NA 3POCA 4TRPH 5DJXB 3GINA 4WW2F 3OLGA 2W88A 4NFDA 4C83B 4D0CA 3IAQA 4FTVD 4D3CL 2R7EA 4E9TA 3ARRA 4M03A 3CLEL 2M1KA 2UY7B 4PREB 1ZCRA 4WHCA 3SGJC 2Q8AL 1ETB1 1JZHA 3RVXD 4QRQA 5FGCE 4TVSa 4NQTA 1RU9H 4HWBL 1CGSL 1DP0A 2EICA 1XT5A 1CLYH 5IV2A 4AVIA 4QDGA 1YPZA 2Q86B 1MWAB 5ES4B 2VGLM 1IE4A 3FFCA 2AJ3A 1LMKA 2EIZB 4OW6A 3DVGA 3QB7C 3O41A 1FN4B 4OZ4A 4NWUL 4WI9A 3T0EC 1Q72H 2EP6A 4LLDA 1ITBB 4XAWH 3GKZA 4FCAA 1AHKA 4LLYA 5EEYA 2FCBA 2XYCA 3WSQL 1NOLA 5B39A 1UWEH 4YZFE 3QDJE 4BQ8A 4MQXC 3UACA 1ANUA 4EZMA 5KVFL 4XP4H 4EN3B 1N4XH 4OM0H 2AQRA 3SBPA 3U2SB 1IVTA 3H42L 3O0RH 3DXAE 4YDKL 4N4YB 4GP5B 3LJ3A 4OFKA 3VXNA 5FHBL 3CVHA 4RETB 2DI7A 5IW1B 3IGFA 2CGYA 1KCLA 2G60L 5I71B 2MQ3A 4X9BA 1X9RA 1NCAH 5SWSB 4XNYH 4UNTA 3BPOB 1OZTG 5JIKA 3ZJAA 5F88A 3PUCA 2CUAA 2PTTA 1RIHL 4WJ5A 2ZWLT 3BAJA 4JFFD 3ZUNC 1WD8A 4UILL 3NIFB 4TLSA 3CZFA 4PYGA 4KI1A 2F68X 3EJUA 4F2FA 5GS3A 3BIKB 4FEIA 1T6WA 3GBDA 5GGVL 3BUTA 1EDQA 2VABB 4O2EA 4ODXB 1D5IH 3RVXC 3TBCA 3UBHA 3VXQB 2PYFA 3ILPA 1GGUA 3WE1A 2OXGA 4EI5D 1V27A 5L9DH 4QMEA 3QJRB 5I82A 1R3KB 1LO4L 3FO0H 2X38A 4Y2OA 3G5VB 1E28B 1YNKL 5JDSA 3APFA 1NL0H 3CZSA 2KS0A 3CDCA 1LK2B 3DTXA 1DVXA 4K3JH 1RLWA 4ZUUA 1RZJC 4M62H 1DVTA 3KNBA 5EBWB 1KIUB 1QWNA 2ZWZA 4EIZC 4HFWA 3U6RB 1O7DC 2FGWL 4HCGA 1ZRUA 4QGTA 4NC1C 1ND0B 1K4CA 5CGYD 1MRDH 2VN7A 4LLUB 4TQPA 1K8DA 4JUTA 2BLFA 1E6OH 2OX5A 2VOTA 4HAFA 2AGJH 1YECL 5F72S 3CTTA 1BREA 3IJEB 2E7MA 5AW9B 4LLQB 1MFCH 5L7XH 1QUNA 4KHXH 3ARFD 3LV3B 4R7DB 2OTUB 1P6WA 3RKDD 4HIIA 4GEJA 5FF6B 3HZVA 1QASA 4HEPA 1K6QL 2HUEA 2B3RA 3DX2A 4PVNA 4PWEA 1GZQA 4LCVA 3IFOB 1ZSDA 5BRZD 1MQKL 4AIZA 4CVZA 1DE4A 3MPCA 1A6VH 3I85A 2VR6A 4IRJA 2B59A 4BFRA 1K8IA 4JDEA 3NCYS 2DQFB 2COQA 3OJVC 4ZK8A 1WCQA 1IAKA 1T5WB 2BW4A 1AI1H 3HC3L 4ZMXA 4IHOB 3PLYA 4DWHA 3MNDA 4JGMA 2D0HA 2X4RB 4MNQB 3MC0A 4PV9A 4W4OA 3IGKA 1BJMA 3QQDB 2V8LA 3L9BA 4ELKB 3QEHA 4FABL 4KKLC 3TS8A 2OMVB 5FYJL 3EGSA 2IH1B 3BAYA 1EZSA 5INCB 5KVDH 1MCWM 4TNVF 3U1SH 3KH4A 2VB5A 4DKDC 3EO9L 4RMSA 3IFOA 4CVZB 4CU8A 3FSAA 2VERA 1HSBA 2BHFA 5CP3A 4M7LH 5KSAB 4G43B 3CXDL 4M1DL 2PCFA 3GK8H 4GUCA 5A16B 1F3JA 4Z7NB 2J8UB 4KTEH 2LQRA 4MZRA 4NZDA 2VLMD 5L8KB 5HBBA 3G5XA 2H47C 4G8EB 1SN5A 4G1MB 2GI0A 1IFHH 3P2DA 2WAQA 3L16A 2EIDA 5HTSA 2Q87A 2AJXL 1TPXC 3H7BA 3JT0A 2YD0A 2C9QA 5GISL 5ITFA 5G4MA 4O02H 5DRXB 1G7LA 4YPGA 5ETUA 1PJ9A 5E6ID 3VFTB 2GUOA 4UNIA 2GB2A 1B90A 1NDTA 1W91A 2Y3NA 3EUUA 4MQXD 1O5PA 4ZUWB 3IKCA 3BZFA 3VRLF 4OI8A 1TJHL 5CJBA 1F58H 3U9PH 3OSVA 4NQCA 1HNFA 3VCLB 1T0NB 3RUGE 2IQ9L 4BFNA 4Y2DA 4KNSA 3RFZB 3C2SA 5L88L 3NJIA 1D9KC 3FU3A 3QUXB 5DDHA 3VH8G 1N6UA 4OJAA 1GGCL 1CDGA 4JFYA 3C6SA 5D72H 4NNPH 4PJ5D 5I8CB 3SKJH 1CDJA 4I9WD 3RP1A 4IDLA 2IPTH 2IADB 3K0WA 3AG2B 3NJXA 4LSVL 4MLSA 4XVTH 3IBOA 3TN0C 5JOPD 3HE6C 1BVKA 1X44A 3PWNB 3ARYA 3B7YA 3RTQA 4GMSL 2FX8H 2XRAH 2YMXH 4LL9A 5DJZB 5LAXA 3UDWA 4YC2C 4LESA 5IB1A 3QZBA 4PW4A 2M8XA 1CICB 4GSRA 1MZYA 5K9QI 1PSKL 5J3HD 2X2JA 3ZDYB 2D7OA 3RJQB 4UQAA 5I30L 1LEKA 5IQ9B 1DCEA 3QI9D 4F8PA 3BLPX 2IH9A 4RAVB 1HZLA 2P43B 3MRHB 3W37A 2B08A 4D9QE 1QFPA 3VSTA 4C59B 3OKMA 4C56A 4XXDB 4XO4A 1RHFA 3IDYB 3B8SA 2OM5A 1B4RA 3MLSH 5DHEA 5ENWB 2ZXBA 3CE1A 5GS0L 1OAJA 3BKCH 5L4IA 1VPOH 1TCMA 3Q2LA 1FF5A 2CALA 5TDOA 2A9DA 3ECBB 4RNRA 3SD5A 4OZFH 1ADQL 1F3RB 1U4EA 4HWEH 3V2AR 4BD4A 2VDPH 3LSOA 2VDLB 2CLRA 1RZKH 4KX8A 3B56A 4ZUVA 1CJYA 4R3SB 2J8UE 4YWGL 3UZQA 4QKTA 1VENA 1A1NB 3O2DA 1D9KD 1H8NA 4IRJC 2R1WB 2N3JA 1R47A 3A6CH 3SPHA 5KS9B 2J8HA 3EJQA 1SF3A 1MHEA 4LP4A 5D8JH 8PAZA 2D0GA 2CGRH 3Q8BA 3O4LA 3QUML 2X1QA 3CG8A 4QIRA 4NN5B 3KYNB 3FTSA 5J1AA 3NIGB 1OAQL 1SJEB 1M7XA 3SQBA 2DQTL 4DPBX 5JPNB 5CSGA 3KGTA 3OL2A 1YMMD 5J3HC 5FFLA 3H7BB 3V6OE 3ULVL 4DQAA 3AQDA 4I85A 3TN0B 1JXJA 4JFEA 3AREC 3KZ8A 4MMXC 3BDBA 3C08H 1G94A 4G8EA 1R17A 5IOKA 1KGXA 4EQ3A 3ETTA 5F8RC 4X6CB 4K9EH 4KROC 1UM5H 3MUZ1 2E9IA 3CWGA 2D7PA 4FQIH 4AH2B 1MIMH 2VM9A 3DPDA 2WLZA 3EBGA 4I0PC 5HHNB 1EHNA 5LB1A 3R8BB 5IVOA 2DQCH 1EEQA 3J27A 3D0VA 4HIPA 1USZA 4NUPA 2QZQA 4ZFOL 1BM7A 1FO0H 5ACZA 3QWQB 4OJEH 2E7LA 1WA1X 3CHRA 3WI9A 4LHUD 4HOZA 2YPLE 5TQ2L 1SMDA 3D09A 3OGCA 1IGFL 1CB4A 4KI5D 4O9HH 3LXCA 4QJ4B 1ZDSA 2XV3A 4QTFA 3FB8A 1KCUH 5DD3H 5ICUA 3HN8A 2LE9A 1J8HD 1U2CA 2CUMA 4QRAA 4H5SB 1OB1B 4XVUD 1ROWA 1R3HB 3BEWA 4GQ9H 2Z0UA 4R4BA 4AEEA 3FQUA 3VD5A 4K94H 3UTTB 3TFKD 2DQHL 5BOJA 3AB0B 3O6FA 1RZJL 1F5WA 4YHIB 3RJDA 1HYSC 3ZW3A 3FTUA 2KERA 5FF6A 4NOFA 5KAQF 1AO7B 1JDAA 4XHQA 1YMMB 5EWIL 2OJEB 4P59L 3NQIA 5F7EL 4EDWH 1WZ1H 1AZBA 4FX5A 4OM1H 1QRNE 3A23A 3TN0D 2ATPA 1SOQA 5D4HA 4YPJA 5IB2A 5K1NA 2Z3FA 4HCIA 5ICZB 1XCTA 2BNRB 2P3YA 3KLAA 3EFDH 3UAEA 4PLJC 4KTDH 5DA0B 4F7CB 5BNXD 2YS4A 3D4CA 1F13A 5HVHB 4Z77B 4IJTA 4UNUA 5A2JH 3TBVA 3TGXA 2NXZD 4JPIB 4JRXE 4LAQL 3NZSA 4KNQA 4PV8A 3CU1A 1FGVH 3HG5A 1UD3A 4DVBB 2XZCL 4XCNB 5B21A 1ZLWH 2EEFA 4BK5C 4PLKC 2F8XC 5EUKB 2WIMA 4RMRA 1TJGH 2PPCA 4FZ8L 4TUUA 3L3JA 1CFSA 4XP5L 1NCCL 3SN6N 4I77L 4NKOB 2DM3A 1L0QA 1A65A 3WO4B 3ZMNA 2Q5BA 4TNWF 4B95C 1XTMA 1YAZA 4JZNA 5IBUB 4WNQA 4X99B 4H1LA 4MJIE 2FAUA 3G6JB 4NQED 4OZGA 1IC4L 3HC2A 4NN6B 3V9EA 2ESVA 4HQQH 1BFSA 1ZXQA 4HC1H 4ADGA 2Y3AA 3QUZD 4JRXB 4ONGL 5DURD 3CZJA 2IFGA 3OKKB 4IHBA 3QQXA 2IWEA 4PY8I 1IL1A 3PUUA 5MERB 2CM6A 1P1ZA 2EDTA 5CZVL 3Q2WA 5I75B 1S6NA 2ADJA 2NZIA 4Y9CA 3HJ0A 3TVMD 2HRPL 4YHYB 5FM4A 1QVOA 4GIOA 4CC1A 3ARBD 3GD1C 4OZFG 4TQEH 2B2XL 1SBBA 1WBYB 2CQVA 3MBWA 3TT3H 1DUZA 4H1LH 1FSKB 1HILB 5C0BD 4BFFA 5ESQB 4YGAB 5L6YL 2GAZA 4ZNEA 5ADOL 4L2LA 2FO8A 1JZ8A 4D0DA 5KS9A 3HHMA 3GJEA 1WJ3A 1XGYL 2EH7L 2OXHB 1OW0C 4OSUL 1IB5A 5BW7C 3NH7L 3QIBA 1SEQH 3VSUA 3ORJA 5CJ8A 4M61A 4K5LA 1Q9LA 3WMQA 2DLFL 5E00B 1W0YT 4MCZA 3LKNB 5DVOA 3WS6C 2Q76A 3BE1L 1PVHA 2EXSA 2HKAA 1AGFB 3GO1H 3N0AA 5BS0D 4PJ8A 1BQLL 3D25A 3MRDB 3HBZA 4PM1A 1T6VN 4ZO6A 2O5XL 5H94A 4MRCA 3VMPA 1LQSR 4HX1A 2J5WA 2W94A 4B41A 4I4WA 3NRQA 1FVDB 1T04A 4I3RL 4LCIH 1KJ2B 4WTWA 4FFWD 1XH3B 2OMYB 2QVMA 5IFJB 1CT8B 1MJ8L 2HJLA 3GSUB 1MFAL 4NS0A 3ZY7A 3QUZB 4JRXD 1ZSDB 2IBZX 2DBJA 4J39A 1E5YA 4EN2A 4LL4A 3D52A 4X6DF 2GHWB 4XCNA 1TCRB 2BNUB 2ZAIA 2WCSA 5ITBL 4O58L 2YRZA 5FOBB 4A1RA 3HB3D 1QX1A 2DIJA 4QPEA 1RPUA 2G9HB 4PBDA 4HUKB 4PJXB 4UQ2B 3KWWA 5C09B 4LRIA 1EUUA 4F7TB 1PKQE 2HFFB 3T6QC 4N86A 2X89D 4ZFQA 1DSWA 2BVUA 3FT3A 4LDLB 4PG2C 4HKBA 5DZJA 4AV4A 2NY0C 5ADPH 2EC9U 4L4VE 3VJ6A 1A6WH 2EJ1A 1C5DA 2VN5A 1JHTB 1KBGH 1SFHA 3ARGC 3DUHA 3FQYA 4R96B 2JTDA 2YOAA 3G6AB 1U0QA 3CDYA 4XXWA 4KRLB 1OP5H 1RXLA 2XNAA 3O6KL 4UU9A 1L6ZA 2XQBH 5T5NF 1OB1A 1U4FA 1UYWL 2G2RB 2WKOA 4Q8BA 5DC0A 3CN3A 4WSJA 3QQ3B 3AITA 2VAAB 1S7UA 4NN7B 1BAFL 4OCYL 5DTFA 2IG2H 5E4EC 5JYMA 1PAMA 2WNGA 3O6FB 4KAQH 3SE4C 1BVLA 3VH8A 3SY6A 4GKNB 4L1LA 4YHKL 2J1XA 2HFEB 2OJZH 5CLXA 3SDCD 1NC2A 3HMWL 4MVBD 1TUPA 3LPFA 2A38A 1K3ZA 1NGYB 1OAYL 1CBJA 1YYML 4MD0B 2HTLD 5F1OB 3B7TA 4PG2A 1I4FB 1KCVL 1JYNA 3NZ8A 1LK3H 3RZCD 5EZLA 1ZLUH 3UC2A 3GMRB 3BO8B 3UAJA 5ETUB 2HUHA 3HNTL 3KCWA 4AW4A 3TF7C 3U7WL 4LF3A 2L0DA 3MSPA 1ZTXH 4TVPH 2BZ7A 4Y1TA 3WN6A 5AYQA 2F8OA 3GSRA 1ZHNA 2G2PA 1TMCB 2B3IA 3E8VA 3GMMA 3TJHD 3JWDH 2XV6B 4G6MH 4P05A 1KCRH 1FYTE 3ROLA 3VQ2C 4HUNB 3DX7A 1TVHB 4YIQB 1AHWA 3P9MB 1H3GA 4PQXA 2YSSA 2AQ1A 4YSCA 4UT7H 3EGSB 5CINH 1JF1B 3V6ZA 3C60A 1YLBB 2DOCA 1RY7B 5C0BE 5KSAA 4Z7UA 2QKIC 3BIBX 1P84J 1OTSC 3Q1SL 3SDDC 5EZLB 5I8KH 4WI0B 2ZOWA 5ISZE 1FAIH 2HKFH 3B7SA 3EYVA 1EXUA 1T20B 4XNMB 1QRKA 2HLAA 1KLUA 4A2HA 5JORB 3B5GA 3N41B 1ERNA 1UD8A 2I9TA 3GXTA 4RRPA 3PDOA 2WXJA 4ZAKA 4BRJA 1GYAA 2N01B 1KTLA 4PJ5E 3HMXH 2KLRA 3IXAA 1KBVA 5IHHA 1U41A 1NQBA 4Y5XB 4R7DA 5TE7H 1FC2D 4KDTA 4DEUA 2P49B 4OLXH 5FKAA 4AWJC 1E9QA 5ID1B 2BWDA 4WO4C 1VLXA 4Z0BL 4KKBC 4N2CA 1M71B 1PYWA 2LOEA 4YEFA 5BO1H 3V0VB 1XGRA 3NACH 1SLWA 2DKUA 3VWKA 3KWVA 4OH2A 4GUQA 5EO9B 4NJ9H 3F6IA 3KPMA 4ANWA 4DN3H 4FYSA 5I1CH 1XVSA 3LPGA 4ELMB 1EBAA 2A2QT 4Z7UF 3HLKA 2JK5B 1HU8A 2BCKA 4KWUA 1QP1A 2JB6B 4M8QB 4ODSL 3BEVB 3VB8A 3VTAA 4ZUSA 4H8WC 1MUJA 3BGMB 4POUB 3OKOA 4HUUA 3EYOA 1NFDF 4TUJB 5FYKH 5GJSL 3IFLH 3HR5B 2VH5L 3H2QA 5DEJA 3BH9B 1AGDA 4PG9B 2Y6SD 3D9AH 3ETBF 5AW3B 3GSQA 5FKPB 5I9QB 4N0CC 4I2XA 5EBLB 2ZX8A 1X5LA 1NIAA 2CO3A 1KBWA 2J8UF 4G8IA 1GOFA 5DLLA 4ZFZB 4APXB 2VLJD 2NW3A 1PZ5B 2VMCA 4LP5A 4CJ0A 2YN3A 2ZXQA 3R1GH 1G7JA 1BSIA 3QDME 2QSTA 3AY4A 5I24A 4P48A 3ULUF 3QDJA 3LNGA 5KSVB 2G5RA 1MCKA 5I2IA 1AR1B 1WAAF 3IJHA 4QRFA 5JQHC 5T3XL 5I5MA 5I1EL 4NO5A 3MRRA 4D0DB 2E76C 1A7RH 3PJNA 3I6GA 3LN9A 4PIRF 2I9LA 2AMUA 4ZRGA 2GEEA 4KOBA 4G71B 5F93C 5J1TC 3MMEA 4G80B 3UBXB 4IBUA 2NPLX 2EYRB 3BUIA 4LDCA 1C5BH 3NABL 3S37X 3CZEA 3O41B 5H37H 5FA4B 1NGWB 4HLEA 4KMTL 1BOGB 1ED3B 3FPYA 4ZX3A 1XF3B 5I1HL 2YQGA 4NAMA 3EH1A 2NNAA 3S2AA 1PL3A 4F1SA 2L3BA 4EN3C 3ZOAA 2V3EA 4EMZA 2J1ZA 1CLVA 5DRNB 3TNNB 1KIQB 2VZTA 5AB9A 5JTWA 1NINA 4G7YL 4UWQB 5FGBA 5HGGS 4QO1A 4I1PA 4B7IA 4IDJH 3QNZB 2WLIA 2DV6A 3MACH 5CGYC 1EEYB 3G6JA 4MA3B 4B9CA 3RKPA 2VLJA 4OZIB 3FTZA 4IBVA 4QY8A 4G7VH 1LEIA 2F0CA 2ID5A 3OG4B 1KCKA 4NQEE 1JGUH 1EHLL 4TNGA 1MXDA 3LEVL 5DQ9A 1X5KA 3NZUA 4LHQB 2RBLA 2MCAA 4AK2A 4OTXH 5IW6B 1O75A 4KDVA 3NFNB 2E74C 2K45A 5BV7H 2X4RA 4MNQA 2DWSA 3R4RA 2P5WD 1BD2B 3VG9B 3QA3B 2Q7AA 2VDLL 3D3VA 2AQ3A 1MW3A 2D7QA 2FHBA 1XF4B 2WSPA 4PV8B 5D7JA 3W57A 1LDPL 5GHWL 5A43C 2F54A 3DOSA 4QTIH 3BXNB 2X0WA 3RWJB 1NLDH 4HLZG 5HHMD 2O5YL 5KS9F 4AEHL 5I1JH 5L2KE 4TL4A 1KTDA 1NA8A 3LH2L 3RWFA 2CMRH 3UL4A 3WTXA 3CHOA 3T4YB 5F70A 1AC6A 3DGDA 3GXMA 4X0KB 1G6RL 3CH1A 3OR7B 2XBDA 3UO1H 3KBFA 1C12B 5DI8B 4Z7VE 3HOGA 4DKEH 4MD0A 4AMKH 1TNMA 2ZJSH 1JTOA 4X98A 4WFFE 4PS4L 4N2MA 5AEAA 3P3RA 3GIVA 1AP2A 2XG4B 1G9HA 2OXGB 5K59F 2OZ4A 5BRZB 5F96L 1U8NA 1AH1A 4QRRD 3GB7A 2ZXGA 5DRWB 5CFHA 4M9PA 2EZ0D 3K2UL 4HWZB 2EDMA 2ZG1A 3FTVA 4HG4J 1XR9A 1AFVL 2LLGA 2HJKB 1I7ZB 3QUKA 4I3SH 4YDNA 4A2MA 5HYJA 3LVTA 4KVPA 4NUQA 4O02A 1U36A 2CKBH 4JO3H 1SFDA 2Z31A 3L1GA 3P02A 1II4E 2EDEA 1J5HA 1JN6A 1JWUB 2DQIL 5EZIL 2ZSVB 5DO8A 1M4KA 5C09A 1EBPA 1OF0A 1A2YB 1BD2D 5L4JA 4MCYB 2MCG1 2RACA 2WSDA 2ZCHH 2ZONA 1IGIH 1NAKL 4HGKC 2CK0L 3QIWA 2PN5A 4N6QA 3TBWB 2EDRA 5LWYL 1KPUB 1CQYA 1MF2L 4OLZL 2UUDH 5E4IA 5FW7A 5LN8A 1HWGB 1KYUA 1RJYA 3UAJD 2J1WA 3WAKA 2YSSB 1BMGA 2C3XA 3OAUL 2Y7SA 3EJSA 3PJSA 3RA7L 1OAZL 3IKKA 5GRJL 4XCYB 3E7JA 4KKAC 3DPBA 2WBKA 2ZTBA 3INOA 1UT1A 2BY0A 5C07E 1I1YA 3ZKNC 1NIBA 4FFYH 5GZND 4GPVA 5CUSH 1RPQA 4D9RD 2AFNA 1GGBL 3UAFA 1BEYH 1TZOA 3SOBH 2V4LA 4HALA 4Y19E 1YPZB 3VXRE 5LNDA 1QA9B 4V1DA 1FAKT 1JHLL 3CBRA 4GXVH 3S37H 4F15B 5E56A 4FG0A 3G04A 4HJ1A 3VXPA 1ZT1A 1T83A 3KDPB 5BV7B 1PFOA 4U3HA 4E68A 3MOBH 2EUVA 4JJHA 1QLEH 3UTQB 1G0DA 2HP4A 3OMNB 5B1JA 3BQVA 1TU2B 4AMWA 1DQIA 3FH7A 1CE1H 3KPTA 3WUWG 4X42A 1OCWL 1DQLL 4DGVL 3C12A 3B9KC 1A1NA 3UBFA 5I0DA 1V7NL 2WLIB 4MNGE 4MAYD 4QD2E 4X9FA 4WEBL 3C5ZB 5C70A 3VAEA 1HK6A 2OTUA 3TH4T 1QFWH 3NPZB 3AS3A 1MCOL 1FL3A 2XICA 1X5YA 3NCJL 1R46A 2F7QA 3FU5A 4TQIA 3HA0A 2ZKMX 1TQCC 3HIZA 2WXKA 1JHTA 5F71A 1HHGB 4PJ9A 5K9OA 2DMHA 1XF3A 1CICD 4FLSA 1QLEB 3RWHB 4PRPD 4GW1A 4XZUA 2EXTA 4PGCA 1DO5A 4GAGL 4ZW6A 3RWIB 1EXGA 1FP5A 4GG6B 2HVJA 1V7ML 1KLGA 5IZ7A 5AVWB 1E4JA 1OF2B 5FAAA 4RX4A 3RWCA 1KF9B 1P4IH 1EHAA 1FORL 5EU6A 1JGVH 4Y2OB 4FYRA 2F5BL 3O9WA 4KTGA 3PABB 3PL6B 2B20A 1I7UA 1JNNL 2AQNA 2ODIA 3VFOA 1Z9MA 4ONFL 5FK9B 1D5XA 3BT2H 4JPSA 5FOJA 3JVFC 2AJVH 3GBMH 4TNWK 3Q6FA 3O8XA 4J3BA 1WA2X 4NO0B 1MCJA 5DZLA 1GCFA 3KPQA 3RY6A 2EE9A 5L2JB 3EJYD 2R69L 2I7SA 2YC1A 4OBSA 1HINH 4ZPVB 1W15A 3LEYH 1EEZB 2BY3A 2NW3B 1I8KB 4N90D 1FYHB 4BFOA 1OHZA 2F5AH 3GC3A 5I66A 1E4HA 3TA3D 2DY2A 3GRWH 1BQHB 4I0PD 1U58B 1ZEAH 3QG7L 3SJVB 3BAEL 2GC4C 3ILDA 4XCFH 1W8OA 5LBSH 2Y7OA 1A6TB 4XCCH 1NPNA 4F9LA 3DO7B 5AZ2L 1L9PA 3CVHB 1W6LA 4JRYD 3DJZA 5IW1A 4CMMB 2Y06H 4P9HC 4JB9L 1BZ7B 3CLFH 4BV1A 1OV8A 4MDIA 4RQQA 3WY1A 2H8PA 2R1YB 1DQJB 2VCOA 3WGVB 5FO9B 5TF0A 5KZCD 3WV0A 2XHNA 2MSPA 2HLFC 3DVNA 5D4IA 3ZKXB 1A9EA 3ZTDC 1UENA 2Y1VA 3PP3H 4MJID 2X4QA 1DSFL 1OSPL 3FRPA 1IBDA 4ZOBA 5T1MB 4HEME 2F7OA 2LTQB 1WP6A 2GABA 1NCIA 3FC8A 5C09D 5K39A 2XPGA 1QATA 1OD7A 2C1PA 2YPLA 1CGWA 3L9YA 1HX0A 3US1A 4NENB 1VKXB 4XVJH 5EN2B 3RAJH 4PJAB 2PWFA 4E9QA 2C5DC 4PJIA 3UBXI 1JI1A 2X1PA 4MBOA 1N0XH 1WBXB 4G6JL 4PBXA 4MDJA 1KN2H 3RZCA 3QK0A 1MFBL 3OF6D 4KY1H 2EH8H 2ZP8A 2N0MA 4ZS7L 3CMGA 3QDJD 4L05A 4N8UA 4ODUA 4ACPA 3FQXA 1YN6B 4NHUA 4KKAD 4LGRB 4C56E 1IFGA 2R69A 2P26A 3MV8D 4H7VA 4U6HA 5D6CB 4EI5B 3GSNB 4U1MB 2MJWA 1DVZA 1T1XA 1HKLH 2GYSA 4F2EA 5J56B 5ABAA 5IBUG 5FM5O 2FZ3B 1G1KA 4BSWB 1FBIL 1A8ZA 4J23A 3V52H 2Z6FA 4IMLB 4WF7A 3TCLB 3H2WA 4ZW5A 3QYNA 5J6GB 4UYQA 2BDNH 3L4VA 5DUML 5DRZA 2BSCA 2DYSB 4DZ8B 5D96C 3MJWA 3GNML 4JREB 3BVVA 3JV0A 3KYAA 4YSSA 4JFPA 3VFMB 4L1TA 2A77L 3O45B 5LGJA 1M42A 1JF1A 4Z3FA 4Z78A 5DWPA 4ZFGH 2HRHA 4LEEA 2DD8L 2V2XB 4Y4HA 4WK4B 3DX6A 3FT9A 5HY9B 5IB5B 4R0LB 3SJVE 2G3MA 1EJFA 3CUPB 3Q8FA 3GDCA 4FCHA 2NY5C 1ZLDA 5HYJB 3V5HA 2YN5A 9PCYA 3MBEC 3JBG7 5EBWA 4OZHE 4OGZA 4LSTL 3WUZA 5MENE 2NY2C 5D7LB 5JHLA 2VDRB 1GIGL 5BS0E 1PZ2A 1ZTXE 1WRFA 2NXZB 3GJFB 4TVPE 1VFAB 5JPNC 1YYLL 1KB3A 2ZD0A 3V10A 1U8QA 1KY7A 5E2WL 4BHUI 4GSQA 2CHXA 4JW3A 4MNQD 1CDYA 2H8PB 3I2CH 3MNVB 4KO9A 1I7TA 1QSED 2G75B 1SOXA 1WZKA 4XPTL 2DQUL 4JFQB 5IB3A 3L9EA 5D7HA 5DHXB 4N2EA 2VMDA 2HKHH 4MMZA 2KZ1B 2HT4D 3H9SE 1R9FA 2Y07H 5D2LA 2F18A 3F7RA 3BWUF 3RTLA 3L7FB 1NCTA 2CGZA 2MCPL 3DSNB 2NY6B 4YXKL 3RWDA 3VW3L 4FI7A 1SXAA 4ODTH 2BNQB 1ZGLP 3GJFK 1DSYA 4NM4L 5TGBB 3FRUA 4X0KA 4EXPX 5ERWA 3U6XA 1W80A 3QNXB 2OSXA 3MV01 3VVVA 5D9SA 1JFQL 1P7QD 3O3DB 5T3ZL 1DN2A 4X5QA 3IJSA 1X4YA 3U2SA 3WXVH 4FD0A 4C4BA 1XSKA 3LH9A 1J9CT 3NVQA 3ARFC 3FQTB 2QPUA 4KX9A 2VDPB 5A2KH 4X4YA 3QCUL 3VFNA 3VFVA 3QIWD 4UV7H 5IESH 4RBPH 5AALA 2UZXA 3PWNA 3B9KA 3F85A 3LNFA 5CLYA 4W6XB 3ZO0A 3GXNA 1CZ8L 5D7LD 1QQDB 1FGNH 4G6AD 4C4KO 3JWNE 4QYOB 3QJUB 5CEZL 4XBPB 3MBEB 4DW2H 2VDQL 4MNHB 3WL9B 4OD3H 5CKGA 3JXAA 1TU2A 1U6AH 1A25A 3BVUA 4R7NA 4NKIH 3P11H 4OQTH 3SCMB 5AB0A 1X5AA 3VQMA 5E4EB 2WQUA 3KM2A 3MTXA 5TE4L 3AU1B 1OGAD 2DJ4A 1D6VL 5GS0D 4F91B 3L13A 4TLKA 1FYTD 4KPHH 2XWJA 4JFSA 1G6RA 4QCIA 2C7FA 4PJDE 2P24B 5D93C 1AXTL 5EIVA 3HG4A 5HYSG 3MLRL 3LZFH 2AVGA 4FJ6A 4I88A 4OFVA 4X5WA 5ACLA 1EERB 1QUPA 1YEFH 3LSOB 2QDWA 4JFDA 1E5BA 2XTSA 1HIML 4OB5L 2GG1A 5B8CB 1BLNB 3V5KB 1A3RL 5LVEA 4JQXC 2PR4H 3TYGL 1ASQA 4QHLA 1IAOA 3D69B 4F9LC 4HUVB 3VXUE 5D7IA 1QSFA 2AJYL 3H8NA 4WU7B 4PPTA 1A4CA 1ZHLB 1WG3A 2AANA 1WHOA 1OAKL 2MHAB 4U6YB 3R8QA 3O3AB 3HB3B 3V9CA 5HJ3B 4BWUA 2Q10A 4PD4K 3SQOH 5E1AB 3WEXA 4ZJ9A 4DO6A 4YHOH 2JB5L 2IH1A 5INCA 3WKQA 2H9GA 4I0KA 1LEKB 3VGAC 4X7SL 5E6IC 1NEZG 2WWMC 2IGTA 4U1HB 1EUTA 2UX6A 4ZMTA 5EZOL 3AWFA 1P2CB 4X8JB 1F97A 4JQVC 1HVXA 3C09B 3VFRA 2NX5D 2X1WL 5EBLA 5IEHB 4ZPVA 2XVBA 3VSVA 4WI8A 4U0RC 4F8TA 4ZMPA 4JL1A 2ZSVA 4S1SH 4MMZB 1XWVA 3K4DA 2D7TH 3MBED 3OB8A 4KK6C 3RL2A 1WAAE 2VM3A 1UZ8B 2EDXA 3MROB 3X13B 1OP9A 4Y1AE 1M2VB 1F2XK 2ICWA 5F9DC 1I9JL 2FX7L 4G7RB 3MV11 1CURA 3Q48A 2YUVA 2ZYRA 2ZYSA 1TEFA 4JFOA 3GJFA 3LKQB 3DSFH 2VAAA 1E4XH 2DTML 2NCMA 2BSED 3OF6A 4FNSA 1INQB 1O6TA 2F53A 2FWLB 3C87A 4V2BA 1HNYA 2W5PA 3MRBB 3D39B 3GHPA 2IFFL 4HT1H 3S48A 1CVSC 3IPFA 4UMGA 4RWYL 5F7HA 1Q90A 2OCJA 3B2UC 3PWJB 4CC4C 3NYKA 4F8NA 3QI9C 3OJMB 3AJ7A 5C0BA 3X12B 4G8AC 3S35H 4XPAH 4U4BA 3BKJH 4ZXBA 3CPUA 2B1HH 4N87A 4N0UE 4BZ2A 3P77B 2FSDA 2RFXB 5DEZA 1T22B 3OB0H 1R33A 4G82A 5A7BA 4NXSA 3EDEA 5FA3A 5T5FA 3W2DL 2YAPA 1U30A 4MJIA 4LCYA 2LFGA 4JFOB 3AS2A 1ZE3C 5EZJA 1IAIM 2DQDL 4Z3EA 4AKQA 3RY5A 5TDNA 3WENA 4Q89A 4MXVE 5JR1L 2K7QA 3BT0A 3QUZA 2LR4A 5FKAB 2P8PB 3K1KC 3SQRA 1UG9A 1LO0L 2OMYA 3LMJL 5TE6H 3PGDB 3K5SA 5IB4A 4DN4H 2NX5B 2QVIA 2Z4QB 1J8HB 2W60B 3AUVA 3IXAB 4I18A 5DJYA 1F86A 4JDVA 1INDH 4U1KB 4ZZFA 1IFRA 4HWBA 2XBTA 1DDHA 1ES0B 3VRJA 1B0RA 4GSDH 4Y4HC 3VXRA 3NA9L 3PPSA 4P0DA 4UZGA 1NMCC 1WK0A 3FH5A 3FT4A 4YBQC 3KMDA 3T0EE 2Z92B 4HFUH 4XNAA 1T3FA 1M7DA 4P99A 4TSAL 3DX7B 4FHKA 3K46A 2ZPKL 3TP4A 1A6AB 2BVQB 3HS9A 1C8QA 1A1OB 4Y5YA 3C5JB 4BKLA 2X41A 4TMPA 1ZHLA 2XJKA 5L4FA 4N5UA 4J5VA 3L5IA 3GXUB 1MIEL 3FFDA 4XPBH 4KROD 3THML 3DA0A 4GBXD 1J8HE 4XB3A 4PCKA 4PRBA 4A6YL 1KIPB 4RIRB 4U6VL 4NDMA 5IGXL 1N70A 1M05B 2NTSP 5L0QB 3DX9A 3SDXA 2VN6A 3FQ2A 4IGBC 4TNVK 1G9ML 1OGSA 4P23D 3GKWH 3E6FA 2A4ZA 1VIWA 3U7AA 3NZ8B 4DGUA 2F58H 3MUGA 1FNGB 2P5WA 1K5NB 3LKRA 4XNBA 2YAHA 4BGLA 4WW1B 2UXGA 4ZAKD 3BUYA 1RL1A 3K6DA 3BW9A 4XP1L 3DETD 1RQ5A 2AI0L 4P5SA 3F01A 4P2QB 2PWGA 3DUSA 5E99L 2F53E 3ULAB 5FO2A 1LMIA 4JDTL 1DQDL 4WLCA 8FABA 4PJBA 5CU9A 2GW5A 5TFSL 1XB3A 4QRTA 2G0KA 4PS7A 3RGVB 2XOTA 4K23L 3CH1B 1TQBC 3K74B 3SDDB 4R5VA 5DURB 2YKLL 3C5SA 3MLTA 2CPUA 3APMA 5SWQA 4P46D 3RI5F 2QKIB 4L4VD 4MJ2A 3PE9A 2YAOA 3WTWA 32C2A 3EZJB 3QUYC 4H88H 4H8QA 5DO2D 5KVGL 2A7BA 3OG6B 1QWHA 1UWXH 1P9MC 4AE0A 4OF8A 4W6WB 4YXHL 1RZ7H 4M8QA 1NWPA 5BVPH 4QXUL 2VDQB 3I6LD 3LZLA 4FFYA 1RUKH 1MXGA 4I48A 3V8CA 2WVVA 1UA6L 1JYVA 5LCVL 5AUMB 4LQFL 4BIKA 4Q2ZB 2ADGA 4UTBL 5FM5M 1L9SA 4NPJA 4YL4A 1NOAA 2X2UA 2YLKA 1GKEA 3BPLB 1UJ3A 5I6XC 4PIBA 4G6FB 15C8L 1UH3A 1YMHA 2ZXCA 2ENPA 3VQLA 1CF8H 1V05A 3QAQA 3FCBA 2JELL 3DSNA 3QRGH 3RWDB 1A9VA 1UT2A 1EHKB 1P7QA 3ES6B 3AS0A 3X12A 1KELH 3CSFA 4A04A 43CAB