1R5VA

Evidence that structural rearrangements and/or flexibility during tcr binding can contribute to t-cell activation
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
180
structure length
180
Chain Sequence
EEHTIIQAEFYLLPDKRGEFMFDFDGDEIFHVDIEKSETIWRLEEFAKFASFEAQGALANIAVDKANLDVMKERSNNTPDANVAPEVTVLSRSPVNLGEPNILICFIDKFSPPVVNVTWLRNGRPVTEGVSETVFLPRDDHLFRKFHYLTFLPSTDDFYDCEVDHWGLEEPLRKHWEFEE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Signaling protein
molecule keywords H-2 class II histocompatibility antigen, E-K alpha chain
publication title Evidence that structural rearrangements and/or flexibility during TCR binding can contribute to T cell activation.
pubmed doi rcsb
source organism Mus musculus
total genus 34
structure length 180
sequence length 180
chains with identical sequence C
ec nomenclature
pdb deposition date 2003-10-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00993 MHC_II_alpha Class II histocompatibility antigen, alpha domain
A PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1r5vA02
3.10.320.10 Alpha Beta Roll Class II Histocompatibility Antigen, M Beta Chain; Chain B, domain 1 Class II Histocompatibility Antigen, M Beta Chain; Chain B, domain 1 1r5vA01
2OTWB 3DVFA 4X6DF 1L9NA 3TGXA 5GS3A 5JLZA 1FZMB 3GBNL 1AGBA 1TETL 3BN9C 5EH1A 1Q9KA 4QXWA 4QRSB 3FO2A 1FZKA 5K9OA 4OLYH 2QADB 4LLYB 2P4AB 1BBDH 3VFWA 3W5MA 5JXAL 2PR4L 3F7YB 4LLQA 1DL7L 1TNNA 4L4VD 2FIKA 2XTJE 1XF5A 1LO4H 3HE7B 1UC6A 2EH7L 2NZ9C 5DJAA 3HPJB 4PJCF 4G6AD 4I2XB 5FA4A 3DETC 2VH5H 3PWLB 1TCRB 2XA8L 1NPUA 3G04A 2W60A 5E5MB 3SY0A 1NLBH 1VEPA 3F58H 3HRPA 3P4OB 1JF1A 1ZVSA 1U8QA 3NMEA 4RMVA 2R56H 4P4KA 5EFIB 3C08H 4FFVC 3B5HA 4YIQA 3BUTA 2C3VB 3UTQA 5A3IC 1UM4L 1YECH 2Q87A 5JTWA 4UILL 3OAYH 3B8YA 5ACLA 2ARJB 5CD5C 2GCYB 3CX5K 3FQXA 3WO4B 3B5GA 4P2CG 4JM2A 1FG9C 2WUBH 3VI3F 3D18A 2NXYB 3MACH 4X7SH 4QXUH 4Q0XL 1HYRC 1A7QL 4V1DB 4X6CA 3L3KA 3MRPB 1IAOA 3QH3A 1KCSH 3T4AA 1KN2H 4E41A 3O0RH 1LEKA 3CH8A 1BOGB 2XRAH 3D9AH 4JY6B 1PDKA 5DEFB 5I1LB 2AABH 5ALCL 3EKCA 5AWNH 1WIUA 2HJLA 1SY6L 5EUKB 1VGEL 2DWDB 3HZVB 3QHFH 1PSKL 5IR1A 1KCRH 1F4AA 2O26U 2BNQE 2RR3A 3QFDA 5LBSH 4ZS6D 2DQDL 4CVWA 4GXUM 3HAEB 1W2KT 4M9OA 3B9DA 4LMQE 4ZSOB 2CR6A 1M71B 4L4TB 1H5BC 4WDIA 1G9MC 1EERB 3U1SH 2ITCA 3KJ6L 4F7MB 1JZ4A 5E9DB 2BFVH 5F9DC 4QRRD 3STZA 1GPOL 1QPPA 3FOLB 4YC2B 3KPSA 3IXTB 2FLBT 1NAML 2HTKC 2JB6B 5DJXA 2D31A 4HWBH 2V9TA 3KHOA 3DOSA 3EUUA 4PJHB 3CX2A 4EI5D 3ARDC 3LRHA 2X4PB 5FV1L 1CZ8L 2ORBL 3E6HB 1OAZH 1XZ0A 1EHLH 4UT7H 5HDBE 4P23A 4WUKL 3L5JA 5IB2B 5CCKL 4JFZL 3CDGB 4QCIB 2X05A 5T3ZD 3WEXB 1UJ3B 1JGLH 3QPQC 3MLYH 5K9QI 4B41A 5E2UH 3QPXL 3L1OL 4PY7B 1BFVH 1M6OB 4OF5A 4OM1H 3STLA 1R24B 1DQDH 3BPCB 4XPFH 2NXZB 5F88B 2QEJA 4KK6D 5GJTL 4F7CB 3O6FD 2Z35A 3ES6B 4Z7UB 3T3MF 2OR9H 3WXVH 2I60H 4G5ZL 4PJBE 4CN4A 4KJYB 5E03A 4AT6B 4XPTL 4M1CC 5DZLA 4HS3B 5C09B 2E27L 4V2CB 1WVZA 1JGUH 4I18B 3SQBA 2BJMH 5IM7A 1AC0A 3Q1SL 1GL4B 2X2YA 4PP1D 2JB5L 3VI4E 1JTTA 4U33A 3OSKA 3VWJD 1DR9A 4UV7H 5DFVD 1T0PB 2X4QA 3TIDB 5FF6B 3WCYA 4JZOA 3QEHA 2E9BA 1OSPL 3VE0B 4OGAD 3DRQA 1OM3L 1CDJA 4LDEB 3SDAB 3WFHB 4X4ZA 1NEZG 1L4IA 3OJ2C 4JFYB 2B7DT 4WJ5A 5DJDA 4BQBA 5FUOL 1VADB 5KVEL 1F45A 3H9ZA 4PJFB 3Q6GH 5JO5B 4GRLD 1MWAL 5C0CA 5DRWA 1QLEH 5IVNA 3MOQA 1BVLA 3OJDA 5EO0A 4TUKH 4RQQB 1UXSB 1VEMA 5F8RC 1KJ3L 2MSPA 5F21B 4FQQA 1H8OA 3PJSB 3I50L 2EYRA 5TGBA 3TIEB 2IBGA 3C6LA 3PHSA 2Z31A 3AY4A 4Z7WE 1ZXQA 5EBGA 5ILTL 1BREA 3PP4L 1TZIA 2D7PA 1I1YB 2V2XA 2DKUA 4BK5A 1N64L 3PXJA 3QB7C 4KDWA 4LLWB 3BESR 5KVFL 2WW8A 4PTTA 4JQIL 3MA9L 3RVTD 1U8IA 3KYMA 3HNTL 3T2PA 1Q9WB 3S8WA 3VD4A 2P7TB 4OGYH 4ODUA 2ZUTA 4XPBH 3SE8L 4APQC 1B0RB 1GIGH 1FN4A 2IBZY 3ZMRA 1G9NL 2FBJL 4M8VA 3ARVA 4L8CB 1IGFH 4OCSH 2X4RB 1KFAH 1IBGH 1T83A 2CDFA 3QNZB 4LSQH 5T3XL 4ZFZA 5I1DB 1YEIL 3KAAA 3CPLA 5DVLA 4EBQL 1FLRL 1YPZE 4S1SH 5DC9B 3S5LA 2C3WA 1AKJA 3F12B 2XKNA 1FO0A 2DQHH 1IAII 1Q0YH 3T4YA 3RQ3A 3EYOA 4C4KT 2IANE 4JRWA 1Y0LA 3VFNA 2WBWB 4MWFA 4MYWB 3RTQA 5ID0A 4L5FL 2DYPD 2IWGA 3I2CH 3NIGF 4GO6B 4ZFOA 4OIIH 5IK3B 5FB8A 3WUZA 4WHTA 1MCHA 1T1YA 1UQSB 3MRQB 4NZRL 4RAUA 4YPGA 2AK1L 2CUIA 3DURB 1AP2B 4UIMB 4ZAKD 4CDGC 5AD0B 1F42A 2IAMA 3G5ZA 4XP5L 1AGCA 3MYJB 1G7HB 4HFWA 3WFBH 4QTIH 3ARBB 1WWWX 3DV6B 5F3BB 4HLJA 4DZ8A 5TDOA 2ZCKL 3LKRA 2Z4QA 1FNHA 1MRCL 5L88H 1YYLH 3IVKA 3P0YL 4HS6B 3DX7A 5C0AB 4DKEL 5C0RL 1FL5A 1LDPL 4KQ3H 4K94L 1TQCC 4XNXL 4N8VB 3OB0K 3MREB 3KYKH 4KKCD 4QRTB 1NMAH 4MMZC 3KWWA 1K5NB 1CI5A 3H9SE 2NY5L 4XGZA 5C86A 1U6AH 2IEPA 4PLOB 2AJYL 2LU4A 1I7ZA 3OMZA 5DHXB 3TN0D 4BZ2L 3WFCL 2ZUQC 3MLZL 4LKXB 2CRYA 4G3YH 5IMMB 4JPWH 4O2CB 5BJTB 1U8PA 1NUNB 3ARGC 5IMLB 1KTLA 1J0YA 3IGAA 3MV7A 5FKPB 3IDXH 3QDJE 1T7XA 2ZCHH 3O2WH 4P2QB 3VWKD 3UTOA 2P5WB 2YUVA 4DJMA 2RCSH 4QRPE 4GSDL 1ODAA 4UV4H 3ZYIA 4XCYA 3VG0H 2WINA 4OZFA 4LCCC 1FCGA 3GHBH 3EJJX 3IU4H 1P7HL 4P9HC 1RZ8A 3MJ7A 5DRNB 3BH8A 1TPXC 5GS1B 3KXFA 5DVKA 1JPGB 4XPGH 1ZWIB 1CL7L 4U1IB 4G6KH 4D9LL 2AAVA 3AXLA 4S0SD 1EGJL 2FX8H 5MP6L 3SE4A 3E3QC 1WAAA 1HH9A 3LEYL 1F4YH 3C5SA 1K6QH 3LEVL 4P3CH 1ACYL 1TVHB 4ENED 4I1NB 3S35X 3UTTD 2C9AA 4KRPC 1Q1JL 4PS4L 3ARUA 3T08A 2PKDA 2Q7NA 3GM8A 3EYSL 1K9TA 1I7TB 5IHUL 2PCPA 3T0AA 2ENYA 4HH9A 4Z18A 2R1WB 2AXGB 4F2MB 2VQ1A 2RBLA 1T1WB 4POYA 5BZDA 2DQTH 1WZ1L 3BISA 1FFNB 5EU6A 3RZCD 4O00A 3TO4C 4HGKC 5IFJA 1J8KA 1DVFC 4G7VL 4M3JA 4OLWL 1CR9H 5CJ8A 4U1LA 1YN6B 1I4FB 2AQ3A 3QA3A 3FFDB 4XI5D 1U3HC 3CH1B 1SMOA 3AREC 4Y19A 2DBLL 3L3IA 5SWSD 1FJ1A 4LLMB 2WBJC 2YUXA 3IFNH 3T0EC 3O9WA 4WI3A 4WI6A 4Y5YB 1TNMA 1C16A 2BNRA 4Y7MA 1UB6B 4TVSa 4NQDE 1F00I 2LAGB 4PG9A 3SQOH 1LE5A 1XGTB 3MV01 5CP7A 5IHBA 3TH3T 1XGUB 4R2GC 4JE4B 4JDTL 4IOIB 3MRGB 4IM8A 3RGHA 3VH8A 3S36L 2YD5A 4KHTL 5TFSH 2VLRB 1NFIA 3QXDB 1OSZB 1QLRB 2UY7A 3VG9C 1ZSDA 1IGTB 4UOW1 3ZYJA 5EU7E 5IF0B 3MUY1 5KANI 1F97A 4HPOH 3EDEA 5GHWH 1YEDA 5T5NF 1H3WM 5F1IB 4L3EA 5HPOA 1RURH 2YPLA 3HPLB 4JZJA 4LQFH 3QAZC 4GOSA 3CD4A 3O6LH 3DHMA 3KNBB 1E4KC 4HKBB 2IADB 1OD9A 3CVHL 4MXQD 1NH6A 5DJZA 3IU3B 5F72S 5F96H 4K3EL 1S7TB 2ZUWA 3TJHD 3OPZL 4Z9KB 5AYUL 3KPRE 3DROA 3BP5A 4GW5A 4ZYKA 1BBJA 1N6QL 4U6XB 3LS4L 3P4NA 3C60C 3KYNA 3GEWB 5IW6A 4UIKL 1TDQA 3QWRD 2BVYA 3MNVB 5F9JB 2UVFA 1FNEA 5MEOA 4I3SH 5TE4L 4MJ4A 4E41D 4CDHA 1YYMH 1NCWL 1TFHA 3JUZA 1P4BH 4PJGB 1MCEA 3TVMD 2QL1A 5FDWA 4RAHA 1KCUH 1CCZA 4LARL 4WI5A 3W81A 2YPKA 1QBMH 4MNGE 4OFYD 1PEZA 4PJEA 4NRZA 2WWMD 1QRNA 1WCBA 4ZS7L 2P5EB 1A9BB 4IMKA 1BLNB 1UXWA 2RHEA 2H8PA 4X7TB 4KTDH 3LQAH 3FHAA 1YUHA 1H5BB 3F5WB 4XP1L 1EDQA 3NIFE 4TVPL 3QNXB 1JZ8A 2DLFH 4RNRB 4WHYH 2X4UB 4QHUB 3L6FB 5GRJL 1E27A 1NUDA 1WITA 1F4XH 3HZKB 3HG1B 1S9VA 1TITA 5HD8D 3LHPH 1ZHBA 2Z8VC 4Y5VC 1B90A 4JDVA 1RIUH 1ZT1A 4NZTH 4FHBD 4QT5A 5L2KD 4ONFL 5EBLB 3E6FB 4JM2F 3QDGA 1AFVH 1ES0A 1UM6L 1PYWB 3ARDB 4GMSH 4EUPB 4R90L 3VXQB 3V5HB 1EMTL 1U95B 1HSAA 4X6CF 5IB1A 5CIPA 3MR9B 4J3WA 5H35B 4QRQA 4P23D 4ZXBA 5IVOA 4KZDL 1RHHB 3W5NA 4HKJB 1M1SA 3GSQB 3HZYB 3QUML 1MJ7L 3QUXA 1QHPA 2UWEA 5FO9B 4G8IB 1NFDE 1JHTB 4G9FB 1MCBA 1T7YA 3DBXA 3SBWA 3WV0A 3VGDA 2DTML 4UOW0 1TVDA 2BC4A 2BVQB 1RUPL 3HCVA 1JK8B 4FXGA 3ZKND 4PGJA 5E95B 4PYHA 4NC2B 3PWPA 3SJVB 2HYMA 3EJZD 4KPHL 1KB5L 5FOBA 1NGQH 4G6AC 5HI3D 3BH9B 2J8HA 4N8VG 1FQ9C 3KG5A 4LFHG 5D8JH 3QHZH 4NNYA 1IEAA 1HI6A 3KPQB 3DVGB 2HFTA 4NHUA 1GYAA 4JFXA 5GRUL 4NGHL 1Z2KA 4YEEA 2GUOA 5EZLB 4RA0C 1I8IB 1DBAL 2EO1A 5T1MB 3GI9L 3UJIL 5DMGD 5EULV 2QTEA 3L5WB 3KLHD 2F54B 6FABL 2QQNH 2NTSP 5FYLL 1SBSH 2VLLB 2G75B 3OZ9L 1U3YA 2AK4B 3D5OF 2YD8A 1MHCA 1DFBH 1EVTC 3VXUA 3IFPB 1HSBB 1CVRA 5B4MD 1MFDH 2CXKA 2FD6H 4XCCH 5JHLL 2OMBA 1RIVH 3L7EB 3N1FC 4NDMA 4BFIA 4LP5A 4AL8H 1CTNA 3CLFH 4OF8A 1P7QA 5HHOA 1JYNA 5HVHC 5C0CD 3QDAA 1XGRA 4PRPA 5CBAA 2AS5M 1WEJL 1C5DB 2AEIT 4RMTA 2XPGA 2ZKHH 1CBVL 1RUAL 4JR9L 4MNHA 5D2NC 4ZS6C 3WIHA 1H0DA 3EFDL 1RZKL 5C0BB 1ZHKB 3K46A 3EFFA 2B5IC 4KK5D 1EXUB 3RWIB 1IILE 4KK9D 1BX2B 3ZYZA 4NQEA 5GRXG 5EO1B 1M7IB 1BD2B 5SX4I 4HIEB 4MXVF 2F15A 5C07B 2Y06L 2VC2L 4N1CA 5EZJB 3RAJH 3WIHH 1VEOA 4WCYL 5GGQH 5EB9A 4WUUB 1KYOK 1IGIH 4C56A 4AMKH 1D9KA 3R06A 3U7AA 2YWYA 4JRXB 4NIKB 3X13B 4EI5C 3M8OH 3FONB 1FP5A 3BEVB 4GXUN 2IBZX 5E8PB 4S1QH 2VLJD 3I75A 3HB3D 3QI9D 5DMKB 1P9MC 1F58L 3RWJB 3OKNB 4G43B 1T7ZA 3UZVB 4APQB 3V7MA 1QSED 4YZFE 1UACL 1SJXA 4R3SA 1AGEB 1HK6A 3U30C 1EAJA 1XMWA 3CU1A 2OL3L 4X6DE 4JFPB 4JKPL 1G0YR 1IC4L 3IFLL 4U1SA 3NCYP 1J86A 2AJUH 4D0BA 2HRPH 1U8HA 4GW1A 4I4WB 3BKCL 4RMSA 2A0LD 5F7LB 4Z76B 1MI5A 1U8JA 4S10A 3QXUA 1CG9B 1JFQL 1QA9B 4KK6C 4KMTH 3ARQA 3SO3C 2Q3AA 3FN0H 4LSPH 1QYGL 1NBZB 1KPVB 4FQIH 3RTQD 5DHYA 3JVGC 3AS0A 4XCFL 5TDPA 3I02B 4ODVL 3E8UL 5I1CL 1CT8B 2Y5TB 3T2NL 1U58B 2OLDA 3FQTB 2NQCA 1EAPB 4LSSH 5F3HA 4KRNA 5ANMA 4MD4B 2ITDA 1ADQA 4PP1C 3V6ZB 3VWJC 5DFVC 4UNUA 1VFAA 3TA3A 3D3VD 4GKNA 1PZ5B 3TYGH 5ADOH 1S7VA 1U8MB 1BM3L 1JPFB 5E94B 1V3JA 4U6VH 1YNTB 2MTPA 5KSAB 3X12B 4WFGE 5B39B 1LO5A 4PGZA 1A6WH 3JSSA 4GUPA 3BP6A 1SYSB 4R26L 5DJYA 1OAKL 1Y6NR 3CDYA 4ZOBA 2ZUXA 4BSWB 3FJTA 5C0FA 1TJHH 4RX4D 3BP7B 2P48B 3VI3E 4CMHB 1TQCB 1QSFE 1GRWA 2CR3A 2RIKA 5GPRA 3IETA 5KG9A 1DDHB 4FTVA 1GZQB 1Q94A 5F7EL 2GSIA 2FX7H 1HZHL 3TNNB 4DOHE 1J1XL 2GHWB 1UWGL 3NFPA 4GRLC 1F6AA 1A14H 1AD0B 2AJZB 4DFIA 5HY9B 4IS6A 5INDB 2DDQH 4N8CL 4W68A 3U9UA 5CEXA 2HN7B 3ARGB 1WBYA 3O3BB 4GAGL 3VFVB 1OF2B 2R0WL 3VGBA 2YS4A 2XFXB 3MV7D 4F3FA 3KS0J 3EOBA 5CP3H 3MA7B 3W9DA 2NY7L 4FQ1L 4JFED 1RULL 5ICYB 3U2SB 1DQQB 4DN4H 4K7PY 5JPMA 2VISA 3U4EA 1DQJB 3WIIH 4UQ2B 1MAJA 5T5FH 1GHFH 1TENA 5ACZA 4NRYB 5FUCC 4LCCB 3GSUA 1I9EA 1PJ9A 3H6JA 3PQYB 1A0QL 4BH7B 1S7SB 3REWB 3QG6A 4F9LC 1MEXH 1TPXB 3GSXA 5JXED 1ZKAA 3KXFD 4MJIE 4I9WD 4TVPE 3V5DA 4MD0A 3RVTC 2O61B 4BKLA 1X5XA 4OCMC 2A77H 4ISVA 5J11B 4Y4KA 1CFNB 1S9WB 4NQVB 5D7IA 2R2EA 4EUPG 4GG6B 3P4MA 4ZPTA 2X4TB 1HHIB 4KY1L 5T33L 1MOEA 1JIBA 4YXKH 4N0UE 2G9HA 3CZFA 1JV5A 3BKML 4XC3L 2OM5A 4KRPB 5C9KA 1RVFH 4P57A 4QHLA 1C5BL 2WSKA 2EIEA 3MYZA 1I8MB 3AFLA 1A6VL 3HC0B 4MCZA 3GKWH 2ZOLA 3U7YH 3ZT6A 4M7KL 5B38B 3QFJD 4ELKA 1BZ9A 4L29A 3HE6A 5I8EA 4PV9A 2A83B 1WV7T 1YMHB 3DSNA 2EDXA 1MJJB 2ZUVA 2J6EL 4QY8A 3TO4B 1NC4D 4X98B 3WXWH 3RL2B 1DVFB 3O11B 2GJZB 2ATPA 1JWMB 5E4IA 4KTYA 1S9YB 5INCA 5K33A 2FX9L 2BOBB 1NBVL 2FWOA 5CEZH 3T3ME 5IG7A 1N4XH 3MCKB 1PFCA 1F3JB 1JNLL 1U3HB 4F7PB 3R1GL 5C1MB 5BS0A 1MELA 4JPKL 3CFKA 4XAKE 1A2YA 3MRHB 2WBJB 5DQ9A 2W9EH 2NW3A 3T0EB 4ERSH 4WGVB 2HFEB 4ZAKC 1GC1L 1XGPA 3FZUD 4TULL 1WAAF 2A9ML 5I2IA 1HXMA 4XVJL 4R2GB 2BOCB 3FT2A 4Y1AE 4F57L 1KG0A 4FQHB 3OGCB 4NKDB 3WJJA 1ETZA 3MV8B 3H3KA 3SGEH 3VG9B 2NR6D 4KKCC 5TH2A 3FN9A 5FYLE 4EEEA 2CGRL 3TN0C 1R3KA 1HWHB 2YPLD 2PW1B 4LL9A 3X14A 3BXNB 3QAZB 3VXMA 3N85H 1NGYA 2VLMD 5DQDH 4JG0L 1BQLL 1KIRB 4QXTB 5EZIH 1MCRA 3JWOH 3CFDB 3LMJL 3MLSH 5D7LE 3VWKC 1IM3B 2F53A 5J6GB 1L7IL 2GTZB 2AGJH 2CDGA 2CIKB 2W38A 2FYYB 4OZGB 3GZKA 1DUYA 3C60B 4U6HB 4E5XB 5CWSA 4DKAA 2HFFA 4U6YB 4XBGB 5CKGA 1QFUL 2IPKA 4NQSA 3CVIH 4OCYH 1PQZB 3MOAL 2PYFB 1FFPA 2CKNA 2R2BA 2DQFB 2QLVB 1F6FB 1WIPA 3X11A 2YSSB 2ILLA 4RMWA 3O4LB 4NJ9L 3C8HA 4HZLA 4LU5L 2HLFD 3WL9A 4XCEA 5I0ZA 1QRKA 3U36A 1R3LB 1FE8H 2Z92B 1OGAD 1IC5L 2FIRT 1IEBB 1OAXH 4ENEC 4RFEA 1MCLA 2XACC 5FFLA 1AHWA 1TZHA 5IEHB 3KPOA 3WFEL 4ALAH 2HAZA 1XF2A 2I9TA 1B0GA 4KUCD 3K4DA 3DV4B 1CXIA 4PP2A 4LRIA 2B0SH 1Z3GH 12E8L 2BVUA 4U1MA 4Z7NE 3UTSB 5D96C 3RZCC 3GJEA 3BDYH 3GJFA 2MCPH 3LOWA 3QJHA 4Y5VB 2I27N 5T1KB 3ZKMD 4RWYH 1N3NA 2Y7QA 3QDGD 3WIFB 3K7UA 4MA3A 1BVKA 3C9NB 4JG1L 4OJFH 3LH2L 3C87A 1FFOB 2YZ8A 4P59H 4XI5C 2R23A 5J6HB 1ZA3A 2C1OA 1G7QA 1R5WA 3OJMB 1BIIB 3BQUD 1WJ3A 3NIGE 1F4HA 4HK3J 1TTFA 1WBZA 5EORL 4GJTB 4HBCL 3MNZA 1IAIL 3DMMD 1PW3A 4U05A 1CFVH 3NA9H 3TESA 3UMTA 4PJEF 3CCHA 4M62L 2IQAA 3HI6L 2VNCA 1ZA6B 3WD5L 4MQ7B 1HOCB 1OB1A 2YPVH 4PY8J 4ETQA 4H20H 5JNYB 2YKLH 4L4VB 3PWPD 2IFFH 1ND0A 4Z0BH 3QUZD 2IQ9H 2A73B 1OWRM 4KUCF 5I1KH 4LCIL 2RAMA 1RUML 1X5HA 1FPTH 3WHXA 4GRWE 3VGHA 3TCLA 4ZTPL 4IMLA 2VKXA 4WNQB 2E9WA 1YNLH 4HS8L 4M48L 1IZKA 3U46A 4MXQC 2R0LH 3SE9L 2AJ3B 4NO0D 4JEGB 3QZWB 3CLEH 1G6VK 3K2UH 3TJHC 3B9KD 1U3ZA 2AKRA 4XH2B 5GRZA 2ZJSL 4LLDB 5DUPH 1C12A 5CILL 3ULUH 3U6RB 1X5YA 5IMKA 2V7NA 1LK2B 2CLZB 4LEOA 4XMLH 1YNKL 1HILB 3OHXB 4I5BA 3QEQB 5IMOA 1EEYB 5JOFB 4HDIA 3P9MA 2UWEF 4XVSL 2XNAB 4U7SA 4RBPH 4JANA 3QXAB 2UYLB 3FT4A 1P2CA 3TVMC 1K4CB 4J8RB 3L3HA 4YR6B 1NCBH 1P7QD 5BVJB 5HVHB 3RWGA 5HSFA 4D94A 2CK0H 1JHLL 5D2NB 2FJGA 2WWMC 4I13B 4LRNH 2GIYA 5TE7H 4OM0H 1IAKB 3S35L 4JB9H 1XCQA 2NX5A 5I8OH 2B5IB 2FGWH 4UT6L 1FV1A 3TT1H 5FAAA 2EE9A 4QRRB 2DKSA 4JFQB 4NQED 5L9DH 3DHJA 3T04D 4P2RA 3PWVA 1HINL 2VITB 3CSPA 1S8DB 5GS0H 2YZ1A 5HD8C 3BVNA 5DTFB 4C56D 1ZHNB 3TV3H 4FFYH 1H8NA 4OSUL 3QDMD 3R0NA 8FABB 4EI5B 4ODXA 4U1KA 2VXSL 1MCOH 2XZAL 4OB5H 4DVRL 2A6DB 5EU5B 3L3JA 3GBML 4P23C 2C3HA 3SKMB 4Z7VA 4GAYB 5I66A 5I1JH 4N5ED 4YHNB 1KT2A 1NGXB 4P46A 1EZVX 4LLVA 3TZVD 3D87B 2WQ8A 2F8XC 1J8HD 1RUQH 1Y18B 3DUSB 5LGJA 5LWYL 1KNOA 3W0WA 3ZT7A 5C2BH 2WUCH 3H42H 4JJ5B 1VENA 2FRGP 3G5XA 4HF5H 4RISL 5DR5H 5IHZB 1EO8H 3UBXG 4NUGL 4M1DH 5HYQB 5F7FA 4X8JA 1W8NA 4ONHA 4GAFB 3V6OC 3ZKNC 4JO3H 4ZTOH 1ZT7A 4YX2L 3O6FB 1X5IA 1W72B 5DJ2B 3SO3B 4XBPA 1FC2D 1KELH 2BY2A 3JV6A 4TRPH 4Y4HB 1MFAL 1F11B 2H2SD 5B3JF 5D9SB 5DFWH 5FO8A 4H1LA 5ESQB 5HI3C 2APTA 3MRKA 3PDOB 5I1AA 4G42A 3MLXL 5J1TC 1FNLA 5C70A 2P8PA 4KJWD 1BFOB 1A3RL 1TTGA 2F58H 1PG7H 5LJYH 4QXGL 4NSKA 3VWJB 2XQBH 2R1YA 2EZ0D 5D1ZA 2AXFA 4F9PC 1N5YH 5DMGC 1D5ZB 4A2MA 4FQXA 3KLHC 4H5SB 3IDMB 4FP8H 3UYOD 3C5JB 1I1FA 4HHAA 5DMIH 2VZOA 4LSTL 1FRGL 2Q1EA 1UEMA 1A4JA 4ZNCD 1UA6H 3TPKA 2VMFA 1DUZB 4NT6B 4E42A 4G8EB 5I75C 1FO0L 5FHAL 3QEUA 4KRLB 5L8LB 5J7CC 1OLZA 2DQJH 5B4MC 4M00A 1KN4H 5FO7B 1LP9B 5JQ6L 1AO7B 1OAYL 2MKWA 5CUSH 4OF0A 4GRMB 4OFKA 4ZUUA 4JM4H 5DHVH 4HUWB 4GRLB 1RV6X 3B9VA 1C5CH 1E6OH 4LPXA 4ZFOL 3Q0HA 4NO5A 1R5IB 5L2JA 3GSRB 4K7PX 4H0IA 2E9IA 5DK2A 5HGBA 3MRFA 3SCMA 2VERN 2Z93B 5EO9B 4LCUB 1A64A 1CD1B 5D71H 3IRPX 3C5ZD 4KK5C 1VKXA 4KK9C 5GJSH 1M05A 3OR7B 2MMXA 5JOPD 1JZ6A 1S7XB 5FYJL 5I16A 4F58H 1FYTA 1XFPA 4XNUH 2OX5A 1NCCL 4KI5D 2P8MA 1T22B 5IQ9B 4WEMB 4C83A 2IPTL 43C9A 3I3EA 3L3GB 4MAYA 4HC1H 4MJ5B 4N0FA 5E5RB 1S7RA 4P48A 2DI7A 1BAFL 4XPAH 1J1OH 1YC8A 2KKQA 4UTBH 5CJXA 5B8CA 4JHWH 4KHXH 1FZJA 5DD1L 4AM0A 2FO4A 3WNKA 1FDLL 4EN3A 3HB3C 1IGMH 3PL6A 3QI9C 4I77H 2LVCA 1NDGB 3UYRL 3VXOB 3I6GB 4X6CE 5F6HI 5L8JB 4NKMB 3LPWA 1I3GH 1RK1B 1I9JL 5GZOD 3TPUB 4H88L 1BJ1H 1F2QA 3KDMA 2ICWI 2IGFL 4F7EA 1V7ML 3VFGH 3ZTJH 4RGOL 1OPGH 2FL5A 4KDVA 3SKUD 4UT9L 1QSVA 5CEZD 4YHZH 1G1YA 1L6ZA 1JPTL 1KIUA 2VL4A 2A0LC 4PR5B 5HYSB 4J3SA 1TVBA 1ZGLA 3MNWA 1AH1A 25C8H 1QNZH 3V4PH 1KCKA 3RTQC 1G7JB 3BUYA 3MLWH 1DBJL 2YK1L 3LSOB 2DYPB 4BZ1L 4YDJB 2X6MA 1QBLL 5HTSA 4LCWA 3TJEH 5EWIH 1RFDL 1CIUA 1H3PH 3DUHA 3S88H 3TWCL 1E28A 3N50A 5BS0D 3QYCA 3KPSE 1CU4L 1A02N 1DLFH 2OZ4L 3VD5A 3K1DA 4YO0A 2W65A 2ZNWA 3BGFC 5M95B 1PLGH 1JGDA 4YBLC 4ZAKB 4G9FE 1WTLA 5ADPH 2QQLH 4G9DB 5D7IF 1KJ2B 2VZVA 3QZWG 4CL7A 1A7OL 1LNUB 3OBAA 3F6IA 3D39E 3FMGH 5E6ZA 5EU4B 4XP4L 5EPMB 1E4WL 4X4XA 3IS1X 1LMKA 3UC0H 2XZZA 1L0QA 3NGBC 2D03L 4A6YL 1Q0XH 2J8UA 2DL9A 3SGKA 4FNLH 5I18L 3MGAA 3TN0B 2VXTH 4OGXH 3NCJH 4QWWD 3BZ4B 1NMBH 2A9NH 5F71A 2L4OA 2OQJB 2HWZL 4OQ1A 3G5YA 3VXMD 5HHME 4QRUA 1BQHA 2VKWA 3FQUA 2R2HB 2PYED 5DRXB 5SWQA 4LF3A 1MCPL 3UYPA 3VWKB 3V4VH 2FDBP 3D0VB 2VSCA 1IC7L 1QBBA 4K3JL 4M6AA 4JO2H 2F53D 1JI2A 4BK4A 2CRZA 4JFFD 4BFBD 1N7MH 1YN7B 2JIXA 3O4OC 1ZLSH 4LGRB 5FECA 3SGDH 3UJJL 2MKLC 1P1ZA 1XCTB 5JHDA 2X42A 1AXTL 1IGJB 5JXEC 4Q9QH 4MJ6A 3FL7A 5KTEL 4I48B 1IVLA 5F9AC 4QGYA 4YAQA 5ITBH 3T65A 5HHPB 3FFCD 2DQUL 5ICZB 2X9WA 4K8RL 4KKLD 2DICA 1OAQL 4HK0A 2X4NB 3JTSB 1YEEL 1J9CT 3MLRL 4FFZL 3MGOB 1RZFL 3UTTB 1PKQB 3OKMA 3GGWB 1T04A 3PWNB 4JFOA 3RPIA 2HVKA 4ELMB 1X5AA 5IVXA 3CFCL 3PE9A 3OKKB 4R9HA 3ELAT 4GLRH 4RIRA 2V5RA 3BP4B 4RAVA 3AAZA 2CH8A 3MFGB 1ZLWH 3RBGA 3QXWA 4YJZL 1QQDA 5D96B 5DK0A 4AENB 4QHMA 3BZFA 4PJ5A 1JNNL 2MPAH 2Q76B 1TZGL 5E1AA 1AI1H 3KPNA 3VJ6A 3HZMB 4EXKA 2VWEC 5DJ0B 1JRHI 5D1QD 5SWSB 5JDSB 4P5KB 1R5VB 1XF4A 4YFLI 4JLRA 3P40A 2V7HA 3GSNL 4QOKA 4NP4L 2HFGL 4WW1B 2E6QA 2EDJA 4WI8A 2C4XA 1Q9LB 4WW2A 2ZCLL 3HS0B 4G6MH 4YXLL 2E5EA 3FZUC 4K2UL 2R9HD 1Q9KB 4Y4FA 4PJ9A 3M17A 1ZS8A 3FO2B 1FZKB 1RMFH 3OAZK 3F6LA 4EI6A 1JI1A 4YNYA 1VPOH 4OCXH 4XAWL 2HKHH 3BRGC 4LLQB 4X6BA 3UPRA 3N9GL 1JGEA 1KOAA 3GJFK 4ZG1A 8CGTA 1QFWH 2NR6C 2WMPA 3LKOA 3QIUA 2AEQH 4WO4A 3TNMA 3OJVC 5DJAB 3KR3H 1NKOA 2HJKA 2B2XL 3CSYA 1W0YT 3RWDA 3ULUD 4R7NB 4TTGA 1A7BA 3W82A 3D0LA 1GGUA 3VXNA 2W60B 3SY0B 1NCDL 1G6RA 3DUUB 3I9GL 4CVXA 1G9EA 1ZVSB 3FOMA 2B1HL 2K9UA 3CIQA 5IBTL 3QNYA 5GQBA 2BHZA 2XN9D 3EYFB 5E8EB 1QR1B 1WTGT 3KLDA 1ZT4A 4OCRH 4PTUA 4K7FB 1S7UA 4FABL 2OTUB 3CC5A 1OQXA 5ICXB 1G6RH 1FGVH 3WLWD 5CJ5A 4Z7WA 4M5YH 2VO5A 3QQ4A 1Q72H 5D7JA 3V8CA 4E41B 3S6CA 1S7QB 4JKKA 3RX5A 3G9AB 3LQAC 5JORB 3WE6A 3ZHLA 3TVMB 4U1HA 5FYJE 3RWCA 3UCRA 3MRMB 3RUGE 1YC7A 5IKCB 1NJ9B 2PF6A 3L95B 1QKZL 3KPLB 1T0NA 1U91A 3U0TA 2HLFC 3GRWA 4NO2A 1WSST 3S34H 2XWTB 4XP6L 4ZO9A 4FS0A 1JZ3A 4RA3A 5GS0D 5HGAB 1JGVH 1KPRA 3DIFB 2NX5D 1WCQA 1EEQA 4Y16D 3KLAA 4WDIB 1T4KA 1X6NA 2ITCB 3K0WA 5HI4D 5HDOA 3STZB 4G8GA 4HULB 3BIAX 1OHQA 1FG2A 3FCTA 4I3RH 1DBBL 3PQYE 2G2RB 2V17L 4MNQA 1U8KA 2X4SA 3BW9B 1ORSB 2B4CL 4HJ0D 1T7WA 1GVIA 4NCDA 1Q9OB 1QO3B 2IANA 3IKCB 4LMQI 5L2KB 1SMAA 3ZKMC 2W0PA 2W1NA 3KJ4C 4X80H 2XI9A 3P0VL 2VOTA 1HKLH 5A43C 3AS3A 3NACH 1UM5H 5BRZD 3QRGL 2EDTA 3BIKB 5KOMC 5DUBA 3NCYS 4P23B 3EGSA 1C1EH 4YPJA 3BQUC 1EEZB 1U93B 1P4LA 3IDUA 4I0PA 3QJFB 5DJ8B 5LGHL 2WBKA 2NNAA 4AH2A 1FFQA 5ERWB 3DMMC 2YC1B 4HAFA 3GBNH 3QUXC 4JVPA 3MLTA 1TETH 1R3HB 2IH3A 4WFED 3SBWC 4EIGB 3S4SA 4GLRI 4XT1C 2UZIL 5LQBL 1WAAE 3FRPG 4OQTL 5JXAH 2PR4H 1R6VA 1DL7H 1XH3B 1GOFA 4H26A 5A2KH 3QUZC 5IEKA 3ZE2E 1FL3B 2EH7H 2NTFA 4M8QB 3U79A 1D5BA 3OF6D 2NLJB 3PGCB 2OK0L 1JUFB 2XA8H 5DYOA 2C5DC 2H26B 1ZHLA 5F93C 5TQ2L 3NZ8B 1ZVHA 2D7TL 5I1IL 5EU6E 5F97E 4M93B 4BSVB 1NDMA 3VXPA 3QDJA 1UM4H 2GJ6A 1MFCL 4UILH 4FQXD 5D93C 5MENA 4PJDA 2ESVE 4Z7VF 1GXEA 3ILPA 2A74B 3MJ9L 4Q0XH 4Y19E 1A7QH 1OP5K 2VE6B 2JJWA 2VLKA 3ARTA 5IVZA 4O51A 1BP3B 2BNRE 2CLVA 5ALCH 1DN0A 1IKNC 4GQ9L 3BPNC 4Q9CA 4PV8B 1SY6H 4UINL 3VXSD 3MCLL 2V5MA 5C0CB 2KL6A 5EBMB 1VGEH 1UG9A 1MUJA 5I74C 1PSKH 2QKIB 1NSNL 5EO0B 3ZE0F 1AXIB 2DQDH 5K9QG 4WTZG 1Z9SA 3FKUS 5KAQF 4FQQB 1A6UL 1WBXB 1ADQL 5J57B 3GMPB 3O8XD 5I17A 3VA6A 3KJ6H 1BF8A 2D7QA 2EE3A 5D6DA 1GPOH 1XIWD 3LN9A 4L3EE 3P30L 5BQ7A 5DS8A 2A6JA 4MDIA 4GKZB 1NAMH 3DX8A 1A1MA 5T5NG 4TSCL 1ZLUK 3QWOA 2KH2B 1U8IB 3KYMB 2X1PA 2DM2A 3QUKB 2BZDA 2NY1D 3L5XL 4JRYD 2VLJB 4HUUA 4EN3D 3SKOB 1CZ8H 2D0GA 2ORBH 2R0ZL 2QR0B 4XPHL 2A6KA 5E1HB 3QI9B 4ODUB 1LEGB 1KTDA 3LN4A 4WUKH 1QSEB 5CCKH 4JFZH 4N5EC 4HLZG 3VXRD 5FM5M 1H3VA 1DE4B 1EVUA 1CLZL 5TDNB 4NOBA 3DJ9A 3W9EA 3TH2T 2CUMA 4LHUD 5KS9B 5SWZA 4NQDA 4ZFZB 2ICCA 2EIDA 3ZTNL 3P73A 2RQ8A 3QPXH 4UOJA 3L1OH 4XBEL 4P9ML 4BZYA 4PJEE 1LO3L 2A1WL 4GQPH 5GJTH 1VESA 3FQWB 1QRNE 3H3PL 1Y0LB 1DLHA 2XTJD 5F7KC 2H2SC 4G5ZH 2MHAB 1Y6MR 3MBED 3MRBB 2R15A 4BM7A 1OQOA 1RZGA 4P5TA 3LN5B 1AE6L 4HIXL 1IL1B 3GMOA 4JPIA 5DD6A 5FB8B 3VRIA 4XPTH 1KGCE 4YFLF 3DXAE 4NC1E 4CADA 1U9KA 2E27H 4J4PD 5K59E 5IFAL 2FJFB 4KJWC 4RAUB 3Q1SH 1OOAA 2JB5H 3BGFB 2EZ0C 1MVUB 4YBLB 1DEDA 1CGXA 3D3VB 3VDCA 4GG8A 1AGCB 5HGDA 3EO1B 3RVVC 1JZ5A 5MERA 4OD2A 3REVB 1UEYA 1IQWL 4YQXL 5I1GL 1OSPH 5TDOB 1P4IL 1OM3H 1LGVA 4LIQL 4YHPB 5CBEA 3IVKB 4LKCA 3DX7B 4V2BA 1FL5B 5D72L 3LV3B 4E0RB 3NGBB 3D69B 4IEFB 4NZJA 1DN2A 1NGWA 3O41A 3A6OA 5FUOH 5KVEH 2DN7A 2EYSB 4TUJA 1ZEAL 1MWAH 2PO6A 4UNTA 1W0WB 5JW5A 1G7MB 3WFDL 4WFFE 5C8JA 4P2OD 4MNGA 2QHLA 2BNQD 5IB5A 3WN5C 3MV7B 1KSRA 1KJ3H 3LEXA 4IRSD 1J05B 3C5ZC 4JFEB 4D9QE 1CFQA 3P9LB 4GAJL 3SE3C 4Z6AT 2XY2A 3I50H 4YHIA 4LVNC 4M7LL 5DUML 3QEQE 2Q86A 4KI5C 2XZCL 3O4OB 4WV1A 5ILTH 4D0DB 4NC0B 3PP4H 1JJUA 2HVJB 2BSED 5JR1L 4NOFA 3STBA 3MJ7B 1N64H 1MCQA 2DMCA 3CFJB 4XNQB 1CGWA 3KXFB 5KVFH 1T5WB 4JQIH 4HK3N 3MA9H 5EC2A 3HNTH 3L7FA 4KFZC 1JNHA 2ADIA 5KZCD 3SE8H 1LO0L 4H0HB 2J8UF 4BQCA 1KIPA 3VXUE 3T77A 1G9NH 2FBJH 3VGEA 4CW1B 5GZOC 2CPCA 3HR6A 2ADJB 1A6ZA 5T3XH 4ZNEE 1YEIH 3P77A 3QFJB 4EBQH 1NFDA 1NGPL 1FLRH 5HHOE 4PRPE 2I5YL 1AQDA 3OWEA 3GB7A 1NC4B 3ZZ1A 2VQUA 3IXAB 4QHKJ 4YDLC 4HKXB 4N5UA 4RDQF 3S37X 4N1HB 4L5FH 4U1LB 5HYJB 4R4ND 4ZUVB 3HNVL 3QA3B 4OFPA 5CD3A 1HH6A 3E0GA 4BQ9A 4WVRA 4NZRH 2VL5B 3PV6A 4LHQB 2AK1H 3BMWA 1C16B 3JV4A 1KJMA 2YD6A 4XP5H 1CE6B 1LE5B 3HFML 2XXCB 1P53A 1QEWA 1I1AA 4S2SA 4Y4FD 4WWKA 2ZCKH 1NANH 4M7LT 1CFTA 2RGSA 4EOWL 5AYQA 1MRCH 3NCFB 4L8SB 4X6EB 2KQNA 3P0YH 4DKEH 5C0RH 4PRNB 1LDPH 2Y5EA 3RKDD 1VA9A 4K94H 5HHNB 3JWOC 4XNXH 4JHAL 1ZSDB 4PRIE 4QHNB 1KLUA 5ESAA 4WO4D 4EQ2A 3TO2B 1IM9A 5IVXF 4NQCA 5EOQL 2NY5H 1YEDB 3P2TA 1I7UA 4WY7L 4GKSA 3NFNA 2AJYH 1WWAX 4BZ2H 4QWWC 1CFVL 3MMEA 3WFCH 3ZDZE 4LDLB 3MLZH 3EDKA 3FQRB 4RFNC 3BN9D 5GRWA 1RIHL 3TM6A 4K7PL 1JWUB 3C2SA 4D8PB 2P47B 5DJZB 1MI5E 1JYWA 2KZWA 5EA0L 3SO5A 3MRIA 2VB5A 3ARXA 4PJ7A 4HV8A 4FXKB 3JBG7 1MAML 3DROB 4GSDH 3WJLC 4XVUC 2Z8WC 1EGJA 4DGYL 5FA3B 3P4NB 4JZNB 4X5WB 4HKZA 4WW2F 3ILQD 4OT1L 1LP9E 4DK3A 1AO7E 5CHNA 5D7JD 5ENWA 5ANME 2ZOKB 2C1PA 3KHQA 1K2DA 2VJXA 1D5MA 1CL7H 4D9LH 5FDWB 3SKNA 1CK0L 1EGJH 5B21A 2YPKB 5MP6H 2H6PB 1J7VR 3TBWA 4KKLC 4UNVA 3WS3A 4OV6F 1W8OA 1OGAB 3LEYH 4HXBL 3VA2C 3LEVH 1FSKC 2AP2A 1ACYH 4HEPG 4TUOB 1Q1JH 4PS4H 4K3HA 1AHWC 4NRXA 3G6AA 2DQIL 3EYSH 3TBVB 5IHUH 1J0ZA 1YQ2A 3QHTC 2EIZA 1KCVL 1D7FA 3SDDA 1E27B 4LRIC 2FHFA 4LLAA 1XR8B 4QF1B 5KANG 4HBQA 5FXCH 1WZ1H 1SYVA 1S9VB 1CICA 3VFRA 1V3MA 4B50A 4MVBD 2IAND 4JCLA 5E7BA 2C7UA 5EC1B 3QDGB 1ES0B 4G7VH 3KJ4B 5F9OL 4OLWH 4U1NA 4XX1E 4Z78A 4Z7WF 4R0LA 3BPOC 4AEHL 2HJFA 5TF1L 3O45A 2DBLH 3BQUB 1NLDL 3JUYA 3R4DA 5E8DL 5GRYA 4CU7A 4MD5A 2GYSA 1FZMA 5E6ID 4YDIL 3DMMB 5F1KC 2R9HC 4QRSA 5C3TA 2JCCB 4LNRA 4JY5L 5HVGB 3HUJE 1BOYA 4JDTH 4GKOA 1J88A 4CU6A 5D7IE 3F7YA 4FXGB 1CXHA 4J1UB 3S36H 4KHTH 3HE7A 3PWPB 4X0KB 3QUZB 1SEBA 3ZKXC 3HPJA 1A6PA 2DOCA 3RVXD 1IGYA 5I73C 3ARWA 3PWLA 1F8TL 3H9SD 3ULUC 4LIQE 3NCBB 4M6ML 3D85D 1MNUL 1HI6B 1R3IL 4GBXB 3F65A 5EFIA 3CVHH 4NO0B 2APBA 3A6BL 5FGBC 1RSFA 2C3VA 4LPTA 4K3EH 3B9KB 1OARL 4HIJA 3OPZH 3B43A 3QDJD 3VCLB 5AYUH 4M6NL 2GCYA 5D93B 4XMKL 4TRPL 4EDWL 4UDTB 1N6QH 4QRPD 3LS4H 1JF6A 4V1DA 1ZK9A 4OBSA 4UIKH 3WLWC 3BJ91 1HCVA 3OL2A 1BOGA 1GOHA 4JY6A 5TE4H 1N0LA 1OW0A 5DEFA 5I1LA 3I85A 3F7RA 1WFTA 3ULSB 1NCWH 3VFPB 4BFIB 3WKNA 3BPNB 2DWDA 3HZVA 4JQXA 4LARH 4NZUL 5I74B 5F1NB 2YUZA 3SDXB 3RWFB 1J18A 1UADC 3HAEA 4ZS7H 3V8OA 5GS0C 4ZSOA 4ZO6A 1M71A 4L4TA 1UKTA 1HE7A 1MLCA 4F7MA 4Y16C 3OKLB 4XP1H 3V0VA 2VDNL 1N0XL 5HI4C 4TVPH 1BJ8A 4NQEB 4CN6A 4F7TB 3ARRA 3FOLA 2EDYA 2P49B 5LKNA 5GRJH 4KKBD 1C7SA 1X4YA 2BSSB 5EUOB 4N0RA 4LHJB 3ZHDA 1U8OA 4KVNL 4HJ0C 1L0XA 2DLEA 3D2UD 5HDLA 3FB8A 4CVZB 4C56B 4PJHA 4PJDF 3R06B 3QDMB 3RA7L 5J56B 3TBTB 4ONFH 1CL7I 4HEME 1WIOA 4Q58C 2X4PA 3U4BL 1UGNA 4OLUL 4R6UA 4LSUL 1UM6H 2D0FA 4W6YB 3E6HA 2H32H 2VAJA 4R90H 1EMTH 5L0QC 4H8WL 2H2PC 2Z91A 3GMLB 4HWEL 3TBYB 1NFKA 4PJAF 3CDGA 4QCIA 1E6JL 4KZDH 4R3SB 3IDYC 4TSAL 4O9HL 3TZVB 3WEXA 4OF6A 1UJ3A 1I85A 4ELME 3QUMH 1J8HB 1KB5A 1MJ7H 4NQDD 4PY7A 4D0BB 4KHXL 1M6OA 3S9DB 4XNZC 4GW1B 5HGHA 5ISZB 1T20B 3MZGB 2DTMH 4DW2L 1RUPH 1U8JB 4WENB 4F7CA 3AGVA 4WFHE 1MHEB 1JRHL 2ED7A 3DTXA 5E00A 2JLLA 4OV5A 1DQML 3S3SA 4KPHH 1KB5H 2DLHA 5DHYB 4KJYA 5GSVB 3A67L 3VH8G 2W0FA 1OAUL 1ED3B 3MRRA 4DN3L 4AT6A 4MJ2A 3HMWL 4F37F 3V9FA 5I19L 3INUL 4HS3A 4LPUA 1G7PB 1CDGA 2VIRA 4KGJA 2AV7B 5GRUH 4NGHH 3RRQA 5DJCB 2BK8A 2ITDB 1WUNT 3UO1L 3TIDA 5FF6A 2DQEL 3DO7B 1C7TA 1DBAH 3GI9H 3UJIH 4MSWA 4FQXC 1S7VB 2E9JA 5FYLH 3KPRD 3VRJB 1N6UA 4F33B 1MCKA 4OD1L 3SDAA 3OZ9H 5TQ0L 4G80A 5CZKA 2EIBA 3O3EB 1FVCB 3WFHA 1YEHL 2XV6B 3S3PA 2ZNXA 2IBBA 5FM8A 3BZDA 2E7MA 1N59B 2YD3A 4C59B 2CJUL 4DGIL 5JHLH 1VADA 3O2VL 1MY7A 4PJFA 1T2XA 2GSIB 5JO5A 5I1EL 1C08A 2IPUG 3N06B 4PRDA 3VFUB 1F6AB 1O7SA 2JJSC 2PO6D 4HFUL 4RQQA 1A9EB 1WEJH 2GAZA 1CBVH 5CINL 4L3CA 1RUAH 1UXSA 1A1OA 4JR9H 3MV9B 2NW2B 3WN5B 2EC8A 3PJSA 3EFDH 4WHYG 5HYFA 2D0HA 3EOBB 3WNOA 1RZKH 2VDQL 1U0QA 3W9DB 4ODTL 3C5ZB 5C0DA 3O8XC 2VISB 1RZIB 1X9QA 4LVNB 1KIQB 1FH5L 3UTZB 4DKFL 1XIWC 3P0GB 4PRHE 2O5ZL 1AJ7L 1KPUB 3GSUB 5EBWA 1REIA 2Y06H 2VC2H 4P3DB 3T1FB 3QG7L 4WCYH 5GGRY 3PF2A 3VMNA 4LLWA 3V79C 4WTXA 1P6AB 5CJXC 3H0TB 5IWLC 2JTDA 1Q9WA 3Q48A 4ISVB 5T3XD 2NY1C 1SQ2N 3BWAA 3T0VA 4EN3C 5D1XD 1SJVA 1B0RA 3WHE1 3P4MB 5AG8A 2NZIA 2G9HB 1JV5B 1UACH 4MDJB 4L8CA 1I75A 4OZHB 3K4AA 1LDSA 3F7PC 2OL3H 1NCNA 4JKPH 3IFLH 1IC4H 1B6UA 2R39A 4GMTL 3QIWA 5HHVL 3F12A 4L29B 5F7DB 2HG5B 3ALXA 3K81A 3BKCH 2ZG3A 1S9XB 4ZUTA 5LCVL 1JFQH 4JAMB 3N0PB 3O2DL 1VERA 5EIVA 1QYGH 1TTUA 2XTJC 3NIFF 4YDLB 5F7YC 3WSQL 4XCFH 3MBEC 5INCB 1R0AL 2GITB 2FWOB 4ODVH 4OUOA 3NFSL 5IG7B 2CKBL 5B3NA 1ZTXL 3E8UH 3MRQA 4P2RE 5I1CH 5BS0B 3T2NH 4J4PC 2A6IB 4F8TA 5DQ9B 3LVEA 4X5XB 5AD0A 4UIMA 43CAB 1G7HA 4R7DB 4TSBL 3DV6A 5F3BA 1BM3H 3VFSB 2QHRL 5GGSY 4QGTA 1I1AD 3V6OE 2LU7A 3PIQB 2H1PL 3FT2B 4GRWH 4R26H 4WHCA 1OAKH 2DIJA 5EOCL 2E7HA 1V3KA 1LHZA 1U92B 1ETZB 3ARED 2R0KL 3MREA 3RIFF 4QRTA 1K5NA 4LASL 4DAGL 2APFA 1MRDL 1A7NL 1NFDF 4M4RA 2MOVA 4TPRL 2VTFA 1NKRA 3OB0H 3W0WE 5F7EH 2G60L 1HZHH 1J1XH 1UWGH 3A0OA 4LKXA 1EHNA 1RY7B 5IMMA 1G7LA 3VXMB 4O2CA 4LGSB 4N8CH 4P2OC 5IMLA 5FKPA 5IHLB 4GAGH 2PYEB 1CXKA 2R0WH 4IRSC 4P2QA 1NBYA 4OCLC 3ZE0E 2NY7H 4FQ1H 1S3KL 1RULH 2F53B 3U0WL 4G7YL 5KJRL 4JFFB 2H9GB 3RNQA 4MA1C 2NY0D 3EYUL 5DRZB 4Z0XA 5A16A 1I9IL 2RFXB 2PW2B 3BD4A 2PNDA 3K3QA 3MLVL 1I7RB 2ZPKL 3F62A 1T6VN 1RK0A 5FGSA 2F9BT 5DRNA 2IPKB 7CGTA 1TJGL 1A0QH 2O5YL 3B6SB 5C08E 3QCVL 1ZWIA 3WHE0 4U1IA 4Y5XC 1INEL 1Q38A 3QT2A 3TF7C 2XWJB 1OCWL 3FFCB 3PWJB 1TVHA 4KY1H 5T33H 1FSKB 4RFEB 1FCCA 3BKMH 3EO0B 4DWHA 4XC3H 3FHQA 4ZODA 4N0YL 1EFXD 3MXVL 1KUMA 4P5MA 2AXGA 5D2LB 4ODWA 1C5BH 1KF9B 5MHSE 1XF2B 1A6VH 1EA9C 3DX9A 5GIRA 1T1WA 4M7KH 4WU5B 2LTQB 4X6FB 2OI9C 2X1QA 1ULVA 4PJ7F 4D3CL 1FFNA 3HC3L 5D6CA 2Z8RA 1CICD 4PJIB 1IAIM 2QSCL 2W0LA 2F5BL 2J6EH 4ODSL 2ADFL 5KSBB 5DI8B 1N3NB 2DIBA 1YN6A 4C58B 2XG4A 1I4FA 3NH7L 2FX9H 4YH6A 1NBVH 3FFDA 4R4NC 3F8UB 4POUB 4FOMA 5GRVK 1FYTE 5D1QB 3BPOB 1RD6A 1JNLH 1ZA3B 4NFCA 3R1GH 4LLMA 4PJXB 1CDHA 4BSJA 3GRWL 4JPKH 4Y5YA 4KV5E 4O2FB 1JZ2A 1UB6A 4WW2C 1X44A 3TBSB 1MHPL 1GC1H 4TULH 1XGTA 1FNAA 4UUJB 2EKSB 2X41A 2A9MH 5JA8B 4Y4FC 4PJ9C 5BW7C 4XVJH 4IOIA 5DF0A 3MRGA 4E9LA 2EDWA 4WFGD 4F57H 2H45A 3PUCA 3IDGB 3ROOA 2VLRA 3RGVB 3QXDA 4NKQB 1QLRA 4OD3L 1EFQA 3MOBL 4M9PA 3RKDC 1IGTA 1ND0B 1MVFA 3ZKXB 5IF0A 4WO4C 1QSFD 2AJVL 2E8YA 2NY6C 4YHKH 3D25B 5I73B 5F1IA 1WISA 5C0GA 3HPLA 2CGRH 3LRGA 4C55A 2J4WL 3IDNA 5C0IA 4HKBA 1T03L 3J7HA 4HLZH 4NQXB 3HI5L 4JG0H 4MGXA 1NGZB 3ZDXF 1LQSR 1BZ7B 1S7TA 1BQLH 3LMJH 2XN9B 5D5MB 4Y8AA 1N8ZB 1N2RA 2D4DA 1L7IH 4U6XA 2YRPA 3D6GA 3WNMA 2NXYD 3PGFL 3BYYA 4LCWE 4G6JL 4L8DB 5F9JA 3MNVA 3U9PL 3ILQC 3MUGB 1DEEB 4ZPVB 5D7JC 3BD3A 1T21B 1QFUH 3P9MB 4PJGA 5BO1L 1NC2B 2AXJA 3MOAH 4PGCB 1P2CB 4Q9RL 4MJID 4TVPD 3ROLA 1T3FB 3RWGB 1H3GA 3QULB 4NJ9H 1FNSL 4LU5H 5GGSA 2P5EA 1A9BA 2Q6WA 1BLNA 1IC5H 2HT2D 3IJHA 5IV2B 1H5BA 2NX5B 3F5WA 2VDRL 3CK0L 2L7JA 3PHQB 4TQEL 4Y16B 2J8UE 3A6CL 3MLPA 4RNRA 4LNVA 3WFEH 1UWXK 2X4UA 4QHUA 2E6JA 3L6FA 5DFTA 4YHML 4HPYL 1NEUA 3HZKA 4TNWK 3HG1A 1QOKA 3PWVB 4CBPA 3F7VA 4AEFA 1HNGA 4ORGB 5JW4N 12E8H 1K8DB 4URTB 3BVNB 4MVBC 5EBLA 3E6FA 5FK9B 5DURD 4RCAA 5IP4A 1PYWA 3S37L 3VXQA 2D9CA 3V5HA 1U95A 4JG1H 4TNWF 5SV4A 3LH2H 4XHQA 5L0QB 3MR9A 5BRZB 2YR3A 5H35A 1EPFA 2W9LA 5I66B 1A6AB 4HKJA 3GSQA 3HZYA 4OLXL 4I0PC 2PXYD 3IDYB 4LLVB 1GGBL 5F6IC 4XAKD 5EORH 5BOPA 5JHDE 5E6IC 4HBCH 1IAIH 5FO9A 5LGJB 1KNOB 4QNPF 1JHTA 4CNIB 4G9FA 1IC1A 4M62H 3HI6H 3MXWL 4XNZB 1QP1A 5IGXL 1JK8A 3WD5H 2FATL 5TE6L 3D39A 2OJZL 4Y1AD 4J3VA 3U0PA 1UB5A 5KSUB 1FAKT 2DAVA 4PB9L 3JV6B 5HYJE 3RVXC 4DFHA 3ARFD 2CIIB 3BH9A 3G6JB 3PNWB 4HUXB 4JGMA 2LFGA 4LCIH 2EH8L 1G7IB 3MRKB 4M61A 1IQDB 4M6OL 1RUMH 5FYLD 4OZIB 2HA1A 4NBZB 5IVXE 5KN5B 2Y23A 3KPQA 32C2B 2XT1B 2HLAA 4CMMA 3BGMB 4ZTPH 1IAMA 4PJHF 1EO7A 4X7FC 4HS8H 4M48H 2XY1A 3SE9H 3BOVA 1GGIL 5E56A 4PRAB 4NSKB 5T1MA 3X17A 2I25N 1ZLVK 4PJ5E 2F54A 3NBNA 2ZJSH 5D7LD 2XG5A 4FQXB 3LY6A 4U2YA 3BIBX 3FB7B 5CILH 2XYCA 4MLIA 5DHVB 1I1FB 2AK4A 1UZ8A 1YNKH 5I15L 3IFPA 2FSEB 1HSBA 4XB8A 5IW3A 1D5XA 4NHCL 4HMDA 4IIQA 4QOKE 4UDUB 4XVSH 2AXHA 3BRDA 3BZEA 3DSFL 4U1JB 4XNYL 3AROA 4HWUA 4ZUUB 3VXSB 3TC9A 1C5DA 3CFEB 3C09C 4U0QB 5L2JB 1JHLH 2R69L 3MRFB 5C0BA 3S35H 1GSMA 1ZHKA 2W07A 4QYOB 1BX2A 1IMHC 5FHBL 3O8XB 4UT6H 3FB5B 5EO1A 1M7IA 4HIEA 4HIIB 5D70L 1XIWB 1AY1L 3QQ9D 5C07A 3H8NA 5EZJA 5BXFB 4KKBC 3JWDL 3T0XA 4OLZL 4C83B 1HINH 2N56A 4ZD3L 2F5AL 4MZ3A 4WUUA 1ONQB 3QEGL 4N0FB 5MEPB 1S7RB 3TT3L 3X13A 4OSUH 1D6EB 3FONA 4U7MA 3GSWA 1QD0A 5E8PA 4AM0B 3BEWB 2NY1B 2VXSH 4ZUSB 4JRYB 2XZAH 4DVRH 1JBJA 5DMKA 5I1HL 3RWJA 3OKNA 4G43A 3GBMH 1SJHB 1BFTA 1VGKB 2R8SL 1O0VA 1AGEA 5K9JL 1S78D 3VXRB 2ZP0T 4Z7OF 3R8BB 3FRUB 4PJFF 5D7SL 3FO9B 2P1YA 3IJYB 4JFDB 4XP9L 2BVOB 3K8KA 4LHUB 4L9DA 5LWYH 4BJLA 2C3GA 2EXYD 4RISH 4I4WA 3WUWB 3QIWD 4G8FB 4Z76A 2X89A 2BSRB 1CG9A 4HUKB 2X4OA 4NUGH 3K4ZA 3JZ7A 3CAFA 1ZGLB 4UBDD 3LZFL 4YX2H 1NBZA 1KPVA 4Q2ZB 5LAXA 2XTJB 1AGDA 3I02A 3MBEB 1MFAH 2J12B 2JK5B 4NJAL 2N1KA 5EU7C 1JN6B 1VFMA 3GMMB 4G8GE 4YHYC 5FUZL 2APWA 5CMAA 1U58A 3DWTA 3FQTA 1EAPA 1ZMYA 4MNQE 3MPCA 3MLXH 4Z7NF 4MD4A 4AZ8A 4BFEA 1BWMA 3V6ZA 4YO0B 1A3RH 1IKFL 2QV2A 4QXGH 1CQYA 1PZ5A 1IGCL 1ZAGA 4WI9A 5E94A 1YNTA 4JKLA 5BCAA 1X5JA 4PGEB 5KSAA 5B39A 5GISL 4LLUB 4ZFFA 1D3CA 4Y2OA 4NKIL 3HKFA 4Z8FL 2EDEA 1UKQA 4HT1L 4LSTH 1FRGH 4PREA 3FN3A 2Y4SA 4TTDD 4BSWA 2IJ0C 1KJVB 3BP7A 4TNVK 3O3AB 4FZ8L 5KVDL 1FO0H 2DI8A 5FHAH 3GIZL 1DDHA 4FRWA 3ARYA 4RMQA 5JQ6H 1GZQA 4NUJB 1OAYH 3TNNA 1MJ8L 2AW2A 3O3DB 1T0MB 4O58L 3LDBC 2AJZA 2V2WB 5HY9A 4TNVF 3RUGA 5DVMA 1FVEB 1XR9B 2PO6C 5C71A 1MHHA 4UU9B 4C54A 2HN7A 4P2OB 3ARGA 3O3BA 4QRUB 1BQHB 3CMGA 3WS6A 2BNQB 2FJHB 1HHHB 2ZG2A 3MA7A 4MMXC 2ZWLT 4IRSB 5SWQB 1OP3K 5ICYA 1DQQA 4O2EB 4S11A 1BGXL 4UQ2A 4JN1L 1WT5C 5CLWA 1LILA 4MA1B 4NRYA 5FYJH 4LCCA 4GRWF 1QPXA 2DM7A 3EO9L 1NCCH 5HPMB 3BE1L 3HLAB 3PQYA 4HX1B 2IPTH 1S7SA 3REWA 3I3DA 3ISWA 4Z77B 1G9NC 1BAFH 2YEZA 2ZSVB 4MJ6B 4Y5XB 2IH1B 5DD1H 4KAQL 4K3GA 2GJ6E 1S9WA 4HQQL 3PXHA 4NWUL 5I6XC 5MENE 4PJDE 5D1XC 4NQVA 5I76A 1FDLH 3EDFA 3T65B 5KZCB 1J1PL 4GG6A 3GIVB 3W39B 1T66D 2X4TA 1XT5A 1HHIA 3KPMB 5F7WC 3UYRH 3EYQD 4PRBB 1XAUA 2Q8BL 1F02I 4PJAE 2VLKE 4M3KB 1I9JH 4H88H 1FL6B 1T04B 1I8MA 2IGFH 1AGFB 3HC0A 4XWGL 5JQHC 1V7MH 2HVKB 5B38A 4RGOH 4IOFD 1AIFB 4UT9H 1YJDL 5T1LD 2OI9B 1YMHA 1JPTH 1QR4A 4OZFH 5KW9L 1MJJA 4KJPD 3VGGA 4IRZL 3TO4A 1QQDB 1Z5LB 4NM4L 1LEIB 2OZ4A 1MJUL 1PY9A 3RL2A 3O11A 4ONGL 1YMME 1XGYL 1JWMA 2VUYA 2VZ3A 3SPVA 3CXDL 1J87A 1DBJH 2YK1H 4NO3B 4HW6A 1KXQE 4NPYB 4BZ1H 4PJBB 3MCKA 1QBLH 1F3JA 1U3HA 4F7PA 1RFDH 2C26A 3DO3A 2BRRL 3TWCH 3MRHA 2WBJA 1B4JL 4H1LG 5GRVL 4JLRB 3T0EA 3WNPA 1CU4H 2V7HB 2HFEA 2OZ4H 4TN9A 1X7QB 3S96B 4WW2B 3G08B 4K94C 4A6YA 1RUKL 4YDKL 5ISZE 2NY5C 1I1AC 5MEQB 4Y4FB 2BOCA 1ZS8B 1A7OH 2ESVA 4FQHA 1OTSD 4WWKC 4EQ3A 1J0JA 3OGCA 3LQZB 3SKJL 4NKDA 5ITFA 4XP4H 1EJOL 1E4WH 2P42B 5J13C 3MV8A 3GMNB 4AG4L 7FABL 1LVEA 4I8DA 5BV7L 2D03H 4WO4B 4A6YH 4AYFA 4KVCL 3DYOA 1MQKL 2IMMA 2WWKO 5I18H 1WC7B 3IDIB 4PJ8A 5SWZE 2PW1A 1E4XI 1IFHL 4JQVA 1HEZB 3C6SB 1X5FA 3D0LB 4K23L 4LPYA 5AZ2L 2HWZH 4YBQD 1BFSA 1G6RB 1KIRA 4QXTA 5HDQL 2YRZA 3FOMB 3IDJB 4WI2A 3ZSTA 3IS0X 1IM3A 2N7BA 5IB4B 5J6GA 1MCPH 2GTZA 1YY8A 2QSTA 1IC7H 2CIKA 3V6FB 4K3JH 4R4FL 4RGNE 3BD5A 2FYYA 5CS7A 2NY0C 3C60A 2ATKA 4E5XA 3ZL4L 1S7UB 1G0DA 2FBOJ 4PG2C 2KZ1B 4U6YA 1GZPB 4XBGA 5DO2D 3TFKD 3UJJH 3QQ4B 5D7JB 5EN2B 5CZXD 1PQZA 1HN1A 2PYFA 2X70A 1AXTH 1VCAA 2DQFA 4LBEA 4P4KD 3WE6B 2YMXL 5KTEH 3DGCR 1OD7A 2SEBB 3DVIA 4Y2DA 5E7FA 3O4LA 3Q2CA 4FQCL 5DXWA 3CFBB 2CK2A 3MV9E 4NO2B 1R3LA 2DQUH 2Z92A 1YEGL 4K8RH 3ZTJG 4JM2D 1OAQH 4D9RE 5SX4H 1YEEH 2LQRA 3B9AA 3MLRH 4FFZH 1RZFH 4PLJD 3UTPE 4HIHB 3KLAB 5BZWA 4NZDA 2GFBA 3DV4A 4Q74A 1P84J 3CFCH 4LHUG 3OR6B 1YPZB 1ZANL 2Y36L 3UTSA 5ID1A 3WUWG 1CICC 4Y5VA 4JDZB 5H8DA 1AR2A 1JTPA 3GSNA 1RJZB 3WIFA 1ORQA 3FO0L 4YUEL 3C9NA 1EEUA 1JNNH 4DVBA 1TZGH 4MB4A 1FFOA 3OQ3B 5J6HA 4R0LC 1C8PA 3EGSB 4AIZB 1BIIA 3Q5YA 2CRMA 4PJGF 1P4LB 5I8KL 3DXAA 3GSNH 2NY4D 3KLSA 4NP4H 5EIIB 2HFGH 3KPSD 5F6IB 2NNAB 1UJTA 5E6IB 5E24E 2ZCLH 4OCWL 4YXLH 1WFUA 3HHRB 3QIBA 3HN3A 4G9FD 4K2UH 1ZA6A 3QRFM 4F15C 1EX0A 4MQ7A 15C8L 1HOCA 1XGQB 1OT1A 1GGYA 4X4YB 3D39D 5JNYA 1ZE3C 1F3DH 4L4VA 4XAWH 3N9GH 4H26B 2A73A 2QQKL 3VD3A 1F4WL 4M43L 1HWGB 4O4YL 3RY5A 1MLBB 2B2XH 3NTCL 3H9SB 4NQUA 1U42A 4WNQA 3D85B 3MUZ1 4X4ME 5SX5K 1ZHLB 2AJ3A 3AVEA 5CIPH 1NCDH 3BMVA 3I9GH 2B1HH 5HHMD 4LP4A 4XH2A 5IBTH 4GFTB 4MZ2A 3QDJB 1BQHG 1MREL 3U6RA 4NNPL 4YGAB 1A7PL 3ZLQC 1LK2A 4QRPB 2CLZA 2NXYC 3LKNB 3U48A 2NYYD 1PX4A 3ILPB 1L0YA 1RJLB 5D7KE 1QTYT 1CFBA 3IFOA 4FABH 1HILA 3OHXA 4YDVB 3QEQA 3BO8B 1EEYA 5JOFA 1J0KA 4KWUA 4IHOB 1DBML 4O51B 2UYLA 2CD0A 3O81A 2JF1A 3QP3A 1DN0B 1MRFL 5BVJA 5ETUB 1HYSD 1QKZH 2EKJA 3EYVB 2BVPB 3C09B 5D2NA 3TP4A 1J5OL 3VW3L 4XP6H 1IAKA 1KENL 1Z9LA 4ZUWA 4NBYB 2HT2C 1NAMB 1MPAL 2G5BB 2YHGA 4QRRA 4KKNA 2BY3A 4JFQA 3ZE1F 4OKDA 4NQCE 4NWTL 4KJQD 4ZNEA 2EDQA 5JMRA 1DBBH 2V17H 4MDIB 1S8DA 3OKEB 5JW4Q 2B4CH 3D2UB 4FG6D 3PHOA 1ZHNA 1A1MB 3QWOB 4PJ7E 5E8OB 3SHSA 2VDLL 2A6DA 3MC0A 2KQMA 5EU5A 3HRZB 3P0VH 4N9GA 1NUGA 4HUUB 5BOZG 1P9MA 2VDMH 3QRGH 2A6KB 3SKMA 4IDJL 2FR4A 4AQ1B 3C6LD 1NGXA 1CFSB 2Z31D 2PXYC 5C0EB 4OQTA 3LKQA 5FCUL 1S9KC 5LGHH 1Y18A 3DUSA 3W9EB 2ENSA 5DEGA 4EVNA 4NQDB 5K93A 2W9DL 5JPNB 5IHZA 3ZYOA 1JPSL 4M03A 5CJBA 5HYQA 2BMKB 4H25A 2GK0A 4WI7A 5J1AB 3PDGA 2CDEA 2VXVL 2UZIH 4M5ZL 1MIEL 5LQBH 3O6FA 4XWOD 1W72A 1LE9A 5KSBE 3ARZA 5DJ2A 2OYPA 4OQTH 2ADGB 3OKDB 4JPVL 2D7MA 5DJ6B 1EUTA 2OXGA 4DUVA 3JVGA 1DLHB 1LD9A 4Y4HA 1U8LA 5D9SA 4Q6YA 1PD6A 3ARFC 4PRIA 3VRLF 2WIIB 3TEUA 2FO1A 4YHYB 3VDBA 2OK0H 5LVEA 3I84A 2LVEA 5FYKU 1HDMB 4NYLB 1EZVY 3Q5OA 3DYPA 2EDOA 3MJ9A 4RMRA 5GXBB 3RI5K 3C2AL 1AKJD 3VWJA 2J7LA 5TQ2H 4XMPL 2D7TH 5I1IH 1WZMA 1OP9A 5A2FA 1D5ZA 4OZ4B 2AERT 3O6ML 2N7AA 3ZDXE 3IDMA 3H7BB 1MFCH 5KSAD 3KPRB 3MJ8A 4NM8L 2OJEB 5EDXA 4ZOAA 5B22A 1MWAB 3FQNB 3B83A 3RI5F 4YK4C 3MJ9H 1DUZA 4J6RL 4NT6A 4KMQA 3S7GA 5CBEB 4LKCB 1KLGB 3CXHK 4RZCB 2F74B 4K9EL 5FO7A 5IW1A 1LP9A 1AO7A 3V5KB 1RZKC 2OMNA 3O41B 4GRMA 4L1HA 3OG4B 4HUWA 4GRLA 2VQTA 4GQ9H 3LDBB 3MUJA 4LSVL 3THML 4UINH 4MCYA 1GH7A 2IAMD 3MCLH 5FYJD 2PO6B 3DX6B 4ZOCA 1R5IA 4PLNC 1NSNH 3GSRA 2VSDA 5C8JB 4MNGB 4N90E 5I71C 4WU7B 2Z93A 5EO9A 2IG2L 1CD1A 3VGAC 1A6UH 1T89C 1ADQH 1UKSA 3OR7A 5I0DA 3Q3GB 5ELIA 1S7XA 4YHIB 2PTTB 1TMCB 4I2XE 5E2TL 2D4FA 3QQ9C 2Q86B 1T22A 3P30H 1QZ1A 3I6KB 5IQ9A 4OAWA 1JPST 2ZUQB 3L3GA 2VABB 5IOPB 4MJ5A 3PQYD 4R96A 1INQB 2XQYG 1SM3L 3E2HC 1HHGB 4RFOL 5H2BB 5DMYA 1FAIL 4TSCH 1VACA 2VXQL 3VFTA 1HQ4B 5I6XB 1DQLL 1BECA 5D1XB 3L5XH 1CD9B 3GMRB 2ADIB 3S98A 2R0ZH 3DPBA 4CN1A 4XPHH 1HQRA 1L7TL 1FGNL 5C6TL 4CU8A 4V1DE 3I6GA 4NKMA 1S78C 5J3HD 4U1GC 3ULVL 1RK1A 3TPUA 1CLZH 4Y0GA 5GZND 5FYJU 4P4RB 2UVEA 4W4OC 2VR9A 1AC6A 3RUGF 4LDOB 2EXYC 2M1KA 1V7NL 5CLTA 3SDCA 3ZTNH 1NFDB 3QIWC 5HYSA 4XBEH 2VAAB 4QNPE 5C9JA 4P9MH 1AQDB 2CLRB 3HUJA 5T1DL 4KK8D 4JO4L 4UBDC 1LO3H 2A1WH 3S4SG 1G7JA 2NY3D 2R4RL 3K2MC 3BDBA 3H3PH 4ZSOE 5DD0L 4HJGB 4L4TE 5E2VL 3LSOA 2DYPA 4YDJA 3LKSA 5E9DE 3KYOA 4PGDB 2L0DA 3UX9B 1AE6H 4HIXH 2R1XB 2P8LB 2WLZA 1H9VA 3JXAA 1MFBL 5IFAH 2HTLD 4ONOA 2ED9A 4YE4L 4ZAKA 3JV4B 1KJMB 4G9DA 4PJHE 3RKPA 5HXMA 3GO1L 1KJ2A 4UAOC 5EU6D 4GG6F 1LNUA 1I1AB 4OIAA 1IQWH 4YQXH 5I1GH 5EU4A 1P4IH 2ESVD 5EPMA 4LIQH 4TTDC 4BFGA 3MLUL 5J13B 4RRPA 3AREB 4Y19D 5D72H 5IB3B 5I8CA 3O9WD 5IJVB 1LK3L 2BNRD 3P3YA 4GKSB 4PJ8D 3BZ4A 2DF3A 1ZEAH 2OQJA 2VN7A 4LCYB 2F19L 3UBXB 2L7UA 1T5XB 3B4NA 4LEXL 3WFDH 4YBHA 2R2HA 1H15B 4HGMA 2VDKL 1DSFL 2R2CA 4IDLA 4KQ4L 3ZE2F 4Z7UE 3VWKA 3D0VA 5CJOL 4NNXB 4YWGL 4HV8B 4GAJH 4U2ZA 4POZD 1H8SA 1BJ1J 4M7LH 1YN7A 2NY0B 4YHKL 5DUMH 2XZCH 4J3OC 4L3ED 5C09E 4XNMB 4K8RD 1XCTA 4QHKI 4AQOA 3ECBA 2B1AL 5JR1H 1B88A 1HHJB 2I07B 1IGJA 1K2DB 4I48A 4GS7C 2AV1B 4L1DA 1GAFL 2X1OA 4U7KA 5DZOA 2BCKA 4Y2DD 5HHPA 5IUSA 5ICZA 4X8XA 1T66C 1I1RA 3TBWB 1DQTA 1S5HA 2X4NA 5HYIA 3JTSA 4Q97A 1LO0H 4EIZC 3EYQC 4U3CA 3EDJA 1PKQA 5IT2L 1WLHA 3GGWA 3PWNA 1EFXB 1U8NB 4QTHB 4ELMA 4Z7OE 4JHBA 3CDCA 4PJFE 5GGTA 4X6DB 3OKKA 4IOFC 3RIAK 3L3OA 3EOTL 3IF1B 1YDPA 1NGPH 3BP4A 2I5YH 5BMFL 4KJPC 4AENA 5A40E 1JCKA 1CICB 1KV3A 3AU1A 4XZUA 1VFOA 4OZGF 5IQ7L 3QCUL 1QRND 4FMFA 2P43B 1GC1C 5DWUL 3SOBL 2GEEA 5DJ0A 1FORL 3HNVH 1T6WA 3JTTA 5JDSA 2AJXL 4XTRD 4P5KA 1S7WA 3O45B 4L4JA 4PJCB 4JFDE 4WW1A 4Y5YC 1F90L 1KGCD 4AK1A 3DXAD 4MD5B 3VXTB 1Q9LA 3HS0A 3HI1B 3HNSL 3L5IA 1D6VL 4NKOB 3VFOB 1U41A 4DZBB 1EV2E 4LPCA 3ESUF 3QIBD 1G9ML 1QG3A 3HFMH 3KGRA 1I8KB 4LNRB 4F15B 1OTSC 4EOWH 4OI7A 3VFMB 1M7DA 1OT2A 3T0WA 2YBRB 3CVHB 4Q6IC 4YXHL 4ZXBD 5IIEA 3OAZH 4OKVA 1SEBB 4JHAH 1QSFB 3L5HA 3GJFH 1IGYB 2LV4A 3MRCB 4K3DL 4X9IA 5I30L 5C0JB 5EOQH 4NBXB 4R7NA 4WY7H 1PKOA 2BSTB 1INDL 2GI7A 3X3GL 4DOHB 3NABL 3QUXD 5LXGL 4YBQC 2W0KA 3DUUA 3RU8L 5JW4R 2BY0A 1RIHH 3PV7A 4K7PH 3FTGA 4WFFD 3MRJB 1I3RB 5EA0H 3MRDB 1SJEB 2LABA 3VGFA 3EYFA 5E8EA 2GT9A 3V0AC 1QR1A 4HIJB 3GUTB 1DANT 3C8KB 4GXVL 4N9OB 4XVTL 4KXZH 5GGUB 1MAMH 1BEYL 2Q20A 4D9QD 4K7FA 2MQ0A 2OTUA 5CZVL 3RX7A 4DGYH 5ICXA 2YD1A 3QWRA 1VFUA 5IJKA 3HC4L 4PRHA 3QEQD 5DO2C 5K59F 3TFKC 1B4RA 1W0VB 3X3FL 4OT1H 1S7QA 5FOJA 4IJ3C 5CZXC 1N5AB 1OVZA 5JORA 3V7AE 4IRJA 3TVMA 2J2ZA 4P4KC 3MRMA 5IKCA 2V2TB 1CDBA 1NJ9A 3L95A 3RWHB 4D0CB 3KPLA 4MJIB 5GSRB 1CK0H 3ME0A 4OFYA 1I8LA 2XWTA 2Q7YB 1S5IL 2XWBB 2OSLB 5EOCJ 2EDKA 3CMOL 3OXRB 4JM2C 5C0AE 3PGDB 5HGAA 4HXBH 1K3ZA 3DIFA 1OL0A 4HWBA 1V05A 4PLJC 4N0UB 5EU3A 2VXUL 1MLCB 3VXUD 2EYTA 4XRCB 4OFVA 3V0VB 4C4KO 1CGSL 2HMID 2DQIH 2H32B 3MJGX 2P45B 3OXSB 5BVPL 2G2RA 4HD9A 1KCVH 3BW9A 1JP5A 1ORSA 3T8XB 2ICWA 3H9YA 2HH0L 3CUPB 1U8OB 4JN2B 5HHOD 3ULVE 1B2WL 1Q9OA 4PRPD 1QO3A 4DTGL 5KBNC 3IKCA 3FB8B 4MA8L 4BH8B 5L2KA 5HGGS 4P2QE 3M45A 5DURB 3QUMB 2P5WE 1AD9B 3ORJA 2ZG1A 3TYFB 1A1NB 5HJ3A 5F9OH 3BIKA 4YFEA 2FNBA 1FIGL 1A3LL 2BNUB 2Z91B 2DQCL 2FEDD 4AEHH 1EEZA 1U93A 2W92A 2D7OA 5TF1H 1NLDH 3QJFA 1P7KA 3K1KC 2PXYB 5DJ8A 5E8DH 3UZEA 3LIZL 2NY4C 3GSOB 5ERWA 5K9KA 2YC1A 4O02L 1J11A 4YDIH 4FN0A 1KB5B 4J7RA 4Q9BA 1R3JA 1R3HA 2V5TA 5E8NB 1SVCP 1D9KD 3P11L 1JWSB 4MA7L 5HGHB 4JY5H 2GY5A 2IFGA 1FVDB 4HJJL 3PWUA 4M1GL 3V6OA 2I26N 3MO1A 4HG4J 4YEFA 2Y07L 4Y1AB 1XH3A 3BKYL 3LKPB 2ICEA 4RWHA 5F89A 3DTXB 5E00B 1FL3A 4OV5B 2BY1A 5FYKL 5A2IH 4M8QA 4Y4HD 4PBVC 1FZOA 5CEYB 3ARFB 2W0FB 3LS5L 3U30B 4PRID 2NLJA 3MRRB 4AJ0A 3PGCA 1U2HA 1JUFA 1PVHA 1F8TH 3MROA 4DGVL 1RZ7L 5L7XL 2H26A 2DJ4A 4M6MH 2VIRB 4XHJD 1MNUH 1R3IH 3WNLA 3NZ8A 3RL1B 3BT2L 4D2NA 1CGVA 1ZGLM 5JW3L 1PGRB 2VDOL 4BSVA 4F9PA 3A6BH 5F70A 1MI5D 2APVA 3RDTA 1OARH 5AZEL 2JJTA 2GTWA 5D7LB 4MSWB 4M6NH 5E2WL 4ETYA 1KBGL 4XMKH 4EDWH 1NAKL 2NYYC 2A74A 1JE6A 2K7PA 4G80B 4R8WL 4YK4B 4OI8A 2VE6A 5FM5O 5IROA 1E4XL 2VR4A 4OLVL 3GMQB 4IIQC 3MX0A 1AO7D 3QCTL 1OP5H 5CFHA 5C08A 5KVGL 4PV8A 3BWUC 1C08B 4PRDB 1HYSC 1GCFA 5EBMA 3SEPA 3TA3D 2QKIA 3FT3A 3VD7A 1CDYA 4H1LH 3RVVD 4NZUH 1CXFA 2MCG1 1OGTB 2BVTA 2GK2A 2GAZB 4L3CB 1A1OB 2ZZUT 3B3IB 5I71B 2VLRE 3I6LE 4J12A 1WBXA 3NN8B 3GMPA 3VGAB 4FQ2L 4W70A 4KXZI 5C0DB 3U83A 3WDHA 5F7UA 3RHWK 2VDNH 4HZAA 1N0XH 3ZDZF 2A2QT 4HGWA 1EBPA 4KJQC 4FTVD 5EBWB 2Z9TA 2CUHA 1F5WA 4GKZA 3NZHL 4KVNH 4FG6C 3E2HB 3BAEL 3B2VL 3HA0A 4G6FD 3RHWF 4ODHL 1QLFB 2P24B 3RA7H 2X9YA 3Q6FB 3QUKA 2O93L 4FQPA 3U4BH 4OLUH 2VLJA 2OL3B 4LSUH 1ZLUH 3SKOA 5JIPA 3DRTB 3BWAB 5A2LH 2QR0A 1I3VA 3QI9A 1LEGA 4H8WH 3MRNB 4HWEH 1QSEA 4BUHA 1LP9F 2COQA 3C6LC 3SN6N 2Z31C 3AY4C 1DE4A 1E6JH 4U1GB 1A4KB 1JHKL 5TDNA 4DCQB 4HUVB 4TSAH 4O9HH 4PD4J 3G9VA 4BELD 1YQVL 2BXYA 4PJGE 5KS9A 5FKAA 1ZOXA 4KGLA 3SDCD 4JO1L 3QIWB 3MGTB 4KI1A 4LSRL 4Y4KD 5DT1L 4AEIL 4DW2H 4ZUTB 4XWOC 3BPLC 3FQWA 2P5EE 1RJYB 4P9HL 3RNKB 1JRHH 4JREC 1PG7W 1QVOA 3BGAA 2AJSL 4HWZB 1DQMH 1M4KA 2MHAA 3MRBA 3A67H 4OTXL 3OTTA 1OAUH 3LN5A 3V0WL 1J0HA 1IL1A 4DN3H 1DTUA 1T83C 3HMWH 1WF5A 2H3NB 5I19H 3INUH 1A22B 1ITBB 1G0XA 1GGCL 3EIFA 4KTEL 3HG1E 4NN7C 4GRWB 2FJFA 5FGCB 3T0DA 3PABB 5HHXL 4ZQKA 2ID5A 3HE6D 3OKOB 1MVUA 4FZEL 4BYHA 2I9LB 4OFDA 3UO1H 3D3VA 2DQEH 3N1MC 3EO1A 4UAOB 4KZEL 3REVA 2YA1A 2W91A 5KSAC 3WKML 3QQNA 5IESL 2E7CA 4S1RL 4YHPA 5KOVC 4OD1H 5TQ0H 2ZUUA 1AXSB 3NAAL 1BHGA 4ZFGL 2VRAA 4RX4A 1YEHH 3L3DB 1I9RL 4CMHC 3LV3A 2ZUYA 1CGYA 4E0RA 4R4BB 3D69A 5AAWA 4NQTA 1QFWM 4AIXA 2CJUH 4DEPC 4DGIH 2DWEB 1E0OB 2EYSA 3O2VH 5I1EH 5DQJA 3HUJF 2IAMC 1W0WA 1HXYB 2BP3A 1G7MA 3CSBA 1G7LB 4HFUH 1Z9OA 5CINH 2I24N 3WS6C 5J9PB 3SJVE 1J05A 1NBYB 4JFEA 3P9LA 1DBKL 2VDQH 4ODTH 4YLQT 2G5RA 1YEFL 3HMXL 3HAEG 1FH5H 3OAUL 1O5DT 3RNQB 3QQ3B 4DKFH 4Z0XB 5A16B 4OF3A 2O5ZH 1AJ7H 4D0DA 1K4DB 3ZE1E 4UTAL 2HVJA 5H94A 4O5LL 3AS1A 3QG7H 5ESVA 1RK0B 1XF3B 2R29L 1QHOA 4UZGA 3CFJA 4XNQA 5JXEA 1T5WA 4GS7B 3MFFB 3FB6B 5J11C 4Z95L 2F54E 3EBAA 2AEWA 5CAYB 2ZSWB 1KXTB 3NCCB 3RX8A 4YHLL 2AK4E 4XVUD 4ZDHB 5J3HC 5LGKA 1YEJL 2UUDK 1WQVT 3BSZL 4CW1A 1URLA 5GZNC 4MQTB 5F44A 3O2DA 3RWEA 2ADJA 1AQKL 5AG9A 2CRIA 4P5MB 2EICA 4ODWB 5JUEL 1U2CA 3QFJA 3DX9B 4XXDA 5GIRB 4GMTH 4U6TA 5T1LB 5GGVL 5HHVH 1CLCA 2CKBA 2KDGA 3U7WL 4KK8C 4OF7A 5D6CB 5LCVH 3SE4C 1NC4A 2NY3C 3O2DH 5C0BE 2MNUA 3IXAA 4WFHD 2DM4A 4HKXA 5E99L 2EDDA