1KJMB

Tap-a-associated rat mhc class i molecule
Total Genus 13
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
13
sequence length
99
structure length
99
Chain Sequence
IQKTPQIQVYSRHPPENGKPNFLNCYVSQFHPPQIEIELLKNGKKIPNIEMSDLSFSKDWSFYILAHTEFTPTETDVYACRVKHVTLKEPKTVTWDRDM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords RT1 class I histocompatibility antigen, AA alpha chain, heav
publication title Crystal structures of two rat MHC class Ia (RT1-A) molecules that are associated differentially with peptide transporter alleles TAP-A and TAP-B.
pubmed doi rcsb
source organism Rattus norvegicus
molecule tags Immune system
total genus 13
structure length 99
sequence length 99
ec nomenclature
pdb deposition date 2001-12-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1kjmB00
5F72S 4W6XB 5J9PB 5D2NA 3VGAC 3L3KA 3LMJH 1V3JA 4K7PY 4UAOC 4XC3L 5KS9A 3O6LH 5C3LD 3VWKC 5I30H 3G08A 4F7PA 3HCVA 3D0VB 5F9JA 3WS3B 1DBMH 3HZYA 3MYZA 3PDOA 1IC5H 1E4JA 3EOYG 3L3OA 1ND0B 4JFPA 2Q8AL 4ZSOB 3ILPA 4PJFB 3HA0A 1FVCB 4JN2A 2ITCA 1IC4H 4J4PD 4B0MM 1Q1JH 4MZ2A 2FJHA 1TJGL 4DZ8B 3P0YL 4IBLT 4L4VD 2CDFA 4HMCA 2H32B 4LLYA 2DQGH 3DXAD 4R96A 4H25B 1T21B 4Y4HC 5F70A 1E0OB 3V7AG 3O45A 4M02A 5I8OL 3PXJA 5BRZE 5EC2A 4CMHB 4KUCD 5DJAA 2DBLL 1JTPA 4OM1H 2NYYD 4N8VG 5IEHB 2A77L 2BNQA 2W0KA 4I0CC 4BKLB 4HPOL 3IFPB 3RTQA 4M62H 3ZKSD 1GL4B 2ED9A 4CN6A 1P7QD 4OUUB 3VGDA 1BBDL 3U7YH 5ADOH 5CIPA 1XIWB 5BMFL 1UZ6F 4XNQA 2D03L 1W0VB 2FJFA 4NKDB 4UU9A 5J1AB 4W6YB 4LCCB 4JLRB 1JPST 3S6CA 4EUPA 1A9BB 1S9VA 4G8FA 1F90H 1KOAA 4L4TD 5HI5C 4YHLH 3FO9B 5IR1B 4UT9L 1S7QB 1MCWM 3AROA 5MENA 1KCRH 2R4SL 5L0QB 1TIUA 4GKNB 5FYJL 4NIKB 2X4SA 5CINL 3DMMD 3JTSB 5F7DB 3TO4C 4NNYB 1OAKL 3QNZA 1MCOL 4HWBA 2AV7B 4XTRD 3V4UH 1MIML 1UJ3A 3IB4A 4TNWK 1KENH 4PJ8A 1EX0A 3BIKB 4WWKB 1I1AC 4LCWD 1KYOJ 2OK0L 4YHIA 4XI5D 2EDQA 4OLYL 4WFED 4GMSL 5F96L 1YQVL 2BRRH 1AJ7L 4NKOA 5J3HD 4TVPD 1G0YR 3UJJL 2UVFA 3D0LB 4JZNB 5FUOH 1UWXH 5L7XH 2WWKT 1WTGT 5SV3A 3H0TA 4JQXC 3BP6A 3CXDL 2P1YA 1W72B 3GMQA 3LKSB 4NT6A 3CPLB 1A6VH 4MXQC 3GDBA 5F7EH 2XWBB 3QRFM 3R06B 4YH6A 4BYHA 2B2XL 3MRDA 2ICWJ 2ZCLH 1RZGB 5KJRH 2EH7L 3TBVA 4UOJA 3RAJL 4LPUA 3H9ZA 2FLBT 2VUYA 5K9QI 5I1AB 3L95A 5LWYH 1KCSH 2GTWB 2DQIH 4NKIH 2CLVA 3QULA 5ALBL 4DVBB 5IB3B 4HQQL 1T1WA 3B9KA 4DQOH 5J57B 2EYTA 5SWZB 4HJGA 3WV0A 5F6HI 4CU8A 1WUNT 3C5ZA 3M8OH 4JKPL 4LHQB 3O8XD 5HHPB 1OPGL 2HTKD 2IAMB 2HMIC 3QEGH 4BZ1H 5AAMA 4KJPC 3VFOB 1PLGL 4XVSL 4V1DE 4P5TD 4KJYA 1B2WH 3LD8B 5C7XH 2QADD 4G5ZL 2ZUTA 1Q9LA 4GSDH 1ZLWH 3CK0H 1J0JA 4YGVB 3O3AA 4L9LA 5DD0H 1IGYA 3T2OA 5GS0L 4A2MA 2GTZB 2RQ8A 4ZFOB 1FZOB 1FGNH 2X4QA 1RY7B 3OKEA 2VABB 4FMFA 1CDBA 4D9LH 3VE0A 2ICEA 1LE9B 1PAMA 4X7EC 4R7NA 1YJDL 3AS3A 5HGAA 5BRZB 3QUKB 3QIWD 3BD3A 2J6EA 1JTTA 2WV3A 5KW9L 2D31A 2VLJD 2JIXB 4G6KH 5I1DA 2NX5D 5JLZB 4JR9H 5F93C 2VDLL 3MUZ1 2E27L 2BVQA 3Q1SH 4GUPA 5CEYB 3OPZH 4TUJA 1ERNA 4M1DL 1IAOA 2CO6B 3KXFB 1C5DA 3MGAA 5EIIB 4B41A 5GSVB 3PV6A 2PR4H 3S88L 4P2OC 4GG6A 4U1SA 1DLHA 4X4MA 4O9HL 4GKZA 5E8EB 4APQB 3MXWH 2NY0C 3B5TA 5EG6C 2ZG2A 4P2QE 5GIRA 1BIHA 2EDJA 1JPGB 5IEKA 2V7HB 4OAWA 2AJYL 1OP9A 3O4LD 2C9AA 4PJFF 1D9KD 1BHGA 2AXGB 3KAAA 4EUPG 1NFDA 3DETC 1WAAE 1QHOA 4Z76B 3MBEC 1XF4B 1F58H 5EOQL 3QUXC 5KSVA 3WUZA 2ADFH 2Z8VC 2R0ZH 3EHBC 4K23L 2XWTB 1J88A 1KYOK 1F4AA 4NQDA 4WUKH 3AC0A 3S35L 1OARL 4MA3B 1NAMB 5K9KA 1YEKL 5T1DL 3S98A 2VAAA 4CMMB 4IOIB 1FNGA 3M1BB 4S1RL 3ARBD 2QKIA 4CRPA 1HHKB 2NY4D 2X4NB 3UDWA 1IAIL 5IKCB 1CVSC 3KPTA 2V9TA 1UWEL 1LEGB 1JRHI 4NZTL 1JNNL 4WJ5A 1Z9SA 4NWUH 3VRLE 1C1EH 5M7QA 3MV9E 2VDRH 3HZKA 3SDCA 2HJFA 1SYSA 4XPGH 1CZ8H 5T3ZH 2WSKA 5D1XD 1A2YB 5JHLH 1Q94A 2AXFA 2HT2D 1ZA6B 2VISA 1JMZA 4U1MB 1I3RA 5LGHH 5B39B 2GW5A 1G7MB 4DGIL 5C0CD 5FUZL 3I2CH 5ICXA 1ACYH 1OHQA 2CKBL 5DQJB 4I3GA 5EU7C 1YPZF 3ARED 2W0LA 4O2FB 4OCYH 4S10A 2IANE 5K33A 3L3HB 4FQLL 4OGYH 4WV1C 3IJSA 3T0XA 4OM0H 2CLZB 1EFXA 3DIFA 2VUOA 2OI9C 3EYSH 1AD0A 2Q6WB 5JNYB 2BNRD 2B20A 1EGJA 4DCQB 1X7QB 1LILA 3MNZA 3P77A 2HT4C 3NZ8A 3GUTA 4I0PD 1CU4L 2FWOB 3WIHA 4M03A 2QQNH 1IC7H 5LVEA 3QCVL 4G3YH 1O7VA 2WINA 5KG9B 5FECA 4FQIH 4LMQE 2XPGB 4JFXB 4ZOCA 2F9BT 3BPOC 1OT1A 1MFAL 5MI0C 4I77H 5SWSE 3OX8B 4TUKL 2HFFA 3RPIA 4UDUB 2Z4QA 5E00B 1X9QA 1V05A 4X5WB 3VGGA 3GSWB 3QT2A 4BM7A 1NC4A 3G04B 1VENA 3GI9H 5HYSG 4JPIB 4OD1L 2V9RA 3MJ9H 5EWIH 5LGJA 1T1ZA 1MWAL 4KMTH 2L7UA 3IJYA 4PTUB 1JZ5A 3GM0A 3OKLB 4U49A 3HPLA 1RU9H 2Z92A 1JPTL 3LPGA 4ODUB 2I27N 2BERA 5DWUH 1LO3L 3QDMB 3MRRA 5HPOA 1NBZB 3SE4A 3HE6B 5F88A 2IBZY 4U31A 4G6JL 1BF8A 2V5RA 1J8HD 2JJSC 3FZUD 4FABL 3TWCL 3MJ8A 2E8YA 2IH3A 4LGRB 2VXTH 4YHZL 1AGCA 1T2XA 5DQ9B 4GRMA 1YA5A 4PJ5A 5I17A 5D9SA 2E7LA 4H20H 1W8OA 1PGRB 3QDGB 3QXDB 4ZPVB 3ZZ1A 3CZJA 1I9IH 4LCUB 3LEYH 2Q3AA 3O2VH 1NMAH 3VFVA 4CJ0A 1JPFB 1WV7T 2HWZH 4LFHG 1Z0NA 1IGFH 2QSQA 3WXVH 3O9WB 4OD3H 2AK4A 3CVHL 3S4SG 3G6DL 3RHWF 1YMMA 4FQ1L 5AAWA 1S9KC 3DX9B 1B0GB 4F7TA 1ZHBB 4AEHH 3FB5B 1CDHA 2H3NB 4POUB 1GAFL 4WFFE 4Q7DA 3I6GA 2YSSA 1UACH 3GSRA 4NBXB 5AD0A 4LSQL 4LMQI 4JPVL 4EZMA 1RJZB 4QHUA 4WTZG 4EBQL 1HI6A 9CGTA 5E6IB 4MDIB 1H8SA 3QPXH 3QQ4A 4PS4L 4MQTB 1BVKB 3RKDC 5JW4N 4LDOB 5I19L 1YY9D 1QKZL 3LEVL 1KN2H 3WFDL 3B2UC 2X4UB 4JDTL 3VXSA 2OL3L 3QZWB 1YMHB 3AU1B 3RWCA 3LS4L 2HJLB 1U8LA 1RK0B 1RMFH 2HVJA 1KPUB 4X9HA 2WUCH 5TFSL 2FECI 4KUZH 4TTDC 3MGOB 4YPGB 1L7IL 3MGTA 1EHNA 1T4KB 3H3KA 4RAVB 4PJ7E 3ESUF 1F4WH 3LQMA 1G6RL 4KV5E 5GISL 5E95B 2R23A 2YWZA 2DI7A 5J0BA 1NDGB 4ALAH 1Q9KB 4HWZA 3WHXA 4BK5A 2C3VB 2GKIA 2P5EE 4B7IA 1NKOA 3CSYB 4MCYA 3LB6C 3QIUA 1QSFB 1BD2D 4GW1A 1FV1B 1HINH 2R39A 3CZFA 2O5XL 5D1ZD 2E7MA 1OAQH 4WENB 1IL1A 4JDVA 1I8KB 2X1QA 4WFGE 3PIQB 1N6QL 1QSEA 3JWOL 3VG9B 1WITA 5DQDL 2DQTL 1KGCD 1CE1L 3WDJA 2NXZB 1BBJB 3LPWA 1P4BH 4HH8A 5LXGH 1HHGA 1A0QH 5HDBF 1BX2A 3LKNB 3GSNH 5DEGA 4KRPD 5SWSB 1OD7A 3CC5A 4UIKL 4WW2B 1WLHA 4AYFA 2WWMC 1NCUA 2RB8A 2A6IB 1T7WA 4OLXL 2X70A 2CMRL 4LKCB 5F1KC 5D93C 3QWOB 1FJ1A 3IYLW 1CFQB 4XNUL 4GRWE 4Y19A 3IDNB 2DYPA 1XZ0B 5DRNB 1P4IL 3I02B 3RNQB 5EORH 1AY1H 1T2QH 4NN5B 4HWEH 1INQB 5GRWA 4HIXH 1C5CH 3WN5C 4GKSB 4E9LA 4X7TB 1RHHA 5DJCA 3HN3A 4PJCE 5C0AA 4OCLC 5ID0A 5D2LA 1KNOA 2NLJA 4PJAA 5CMAB 2EYSB 5E7BA 5A43C 3MR9B 3JTTB 3KR3L 4JFZH 3UTTE 4NO3B 2YKLH 1CXFA 4LOUC 2BVPA 3SDDD 1ULVA 5FYKL 1HK6A 5FO7A 5D6CB 1C12A 3TYGH 4HWBL 4UUJB 4LPYA 3ZE0E 5D2NC 2AJUL 1NJ9A 2EIZB 2VE6A 3MMEB 5CZVH 1DQQA 5CJOL 5EZIH 3UYRL 2NZ9D 4JZJA 2VWEE 2AJ3B 5F7LB 5IOPB 2FJGA 3EO9H 3G9AB 4O5LL 2XZCL 4OLZH 1Q72L 3W5NA 4A6YA 1M7DB 1UM4H 2HJKA 5CJQL 4YDVA 1LNUA 3WLWC 4P0DA 3WSQH 3UZQA 1KTDB 2YPLE 3V4PL 4LIQE 4KKBD 4OGAC 3QUYA 3HNVH 4XXDA 3F58H 5CSBA 3MRIA 1P7HL 5IHUH 1TZGL 2IBBA 3H42L 5B3JE 1QLRB 3SEPA 4K94H 4TRPH 4YDIH 1R5VB 2A1WL 1Y18A 1U8MB 1KB5A 4WCYH 5HI3C 5FO8B 1PD6A 1PKQA 4WHTB 3H7BA 3FONA 1NCCH 1A7PH 4RX4D 1S7UA 2RFXB 3UJIL 4WUUB 1JWSB 4L8BA 3RTQC 1S7XB 1MELA 3QEHB 4HXAH 4DOHE 3BEVB 4PJ7B 4X6BA 1QFWL 1RZIA 3MBXL 4LL9A 3RWIB 1CG9B 3OZ9L 3LPFA 1IGJA 1ORSA 3BPLB 1WAAF 1BQHA 4L4JA 1GOHA 2P5EB 1CE6B 3U7WH 3KPPA 2BHZA 4MWFB 5C0ND 1DVFA 3N1GC 1S7WA 1GVIA 1YEIH 2LQRA 2P24A 5ENWB 1NLDH 1LP9B 3BO8B 3G5YA 1MCNA 2OQJB 1HHHA 1IAMA 4H8WL 2B4CL 4XP1L 3QFJE 1CBVH 3NZHH 1PVHA 3W11D 3HPJB 5F7MC 2FRGP 1N2RA 1EBAA 4OV5B 3W9EB 4QTHB 4AEEA 5IFAH 3DRTA 3MFFB 5E9DA 5IT2H 1BFTA 1MF2L 1UJ3C 2R4RL 3SOBH 3CFKA 3F8UB 1KIRB 1JGUH 1CLOH 2XA8L 5DMIH 5KVDL 4DEPC 2R0LH 5DJ2A 1SY6H 3SQOH 2I07B 2PYFA 1JL8A 1D5BA 2NXYC 3VRLF 3S7GA 2JLLA 3MRMA 5E4EC 1MFCL 25C8H 4EI5A 1QO3A 3MV01 4TQEL 3RRQA 3FN0L 1PX3A 3B4NA 2YD1A 3NCYS 4WU7A 2ZCHH 1S9WA 3TO2B 2DM4A 4V1DD 5CFHA 1CICB 5EU6E 3V6OA 2ESVB 5FF6B 2N56A 4GRLB 1HHIA 3SKNB 2GSGB 3ALPA 3T1FB 1L4IA 3VWJB 3HFMH 5EC1B 1RD6A 4C56B 1JV5B 2YBRA 4G6AD 5D8JL 3VU2A 3D85D 3LN5B 2HTLD 1XF5A 4CAGA 2VDOL 2YD5A 1YUHB 3UTTB 1WFOA 1IM3A 2VL5A 3QG7H 4MNHB 1N4XL 1TFHA 4PJBE 1CT8A 1WBXA 4HW6A 1P2CB 3O6FB 5CD5D 3EYFB 2C3WA 5ACMA 1N0XL 3B9KC 3OKYA 1U8NA 3MRLA 5IWLA 4FXLA 5TDNB 3IU4H 3K4DA 3IFNH 3M17A 1HSBB 4XZUB 5JXEA 1W72L 3C5ZC 3BZFB 1GZQA 4QY8A 1P6FA 2RHEA 1TCRA 3VMPA 1U8HB 3GMNA 4NKMA 1SEQL 1A6WH 4XWGL 2XZAH 1J0HA 4TOYL 3SDAD 3GMMA 3OKKA 1CDUA 4P2QD 4GG8B 4HIJB 2YPLB 4WO4D 1P84J 4NCC1 5INCA 3IGAA 4F7EB 4O2CB 5FDWB 3H3PH 4O51B 4E5XB 4MHHG 4L9LC 4OJFL 1BFOA 4RIRA 4P3WA 5C07A 1UVQA 1ZGLB 4M8QB 2XKUA 2FX7H 4KWUA 3TVMD 3NN8B 1XH3A 4W68A 3UEZA 4IRZL 2OM5A 3K3QA 4B7LA 4KRMB 3ARXA 4YPJA 3BKJL 1H15A 5J06A 5IESH 3MLSH 1A1MB 3L9RB 3GNML 5DVMA 1D5IH 3V8OA 5I8EB 5JHDD 5L8KB 4PRPB 1EXUB 4X7FC 5EOCJ 3N0PB 3BGFB 2ZKHH 3SPVB 1FVDB 3QQ9D 5EBWB 5I16B 4S1QH 4JHZA 1UFUA 2W9EH 3MO1B 1OF2B 4TN9A 1FN4B 5D70H 2B0SL 3HB3D 2ZPKH 3IDYC 4Z7QE 1C8PA 1EK3A 2IF7A 3UROR 4GAFB 1G7IA 1VESA 1MAML 5FV2A 3BSZH 4JG1H 2VXSH 2XQBL 1A4JB 3GI8L 3ZL4L 3MV9D 1EAPB 1KBGL 4NUJA 3DSFH 1AH1A 3FB6A 5CWSA 1WZ1H 2UUDH 4XP5H 4JRXD 3U0TB 5KTEL 3DVGA 3TBTB 4J3OC 2D7MA 5DZNA 3O4OB 5FOJA 2Y6SD 1DE4B 2IADB 1EUUA 5L2KD 4J4PA 2KPNA 3ZKXC 5JXAL 5ECJE 2YPKB 1YEHH 4P2YA 3U9PL 1OGTA 2VLRB 4L4VA 2IAND 4K7PL 3QIBD 1L9NA 2AW2A 2X4PB 3DXAA 5GHWL 1R5WA 4EVNA 2GT9B 3K8LA 3ELAT 3MREA 4Y5VB 3HS0A 4EI6B 5HVWA 3BN9D 2WNGA 1T04A 5BQ7B 2A0LD 3MACH 5CUSH 4BQCA 4PJ7F 4ZUWB 4XCFL 4KV5F 3UDWC 1G9NC 4P2RD 4LLDA 2MKLC 1F45A 3Q2CA 4FFYL 2OBGA 3B9AA 4NJAH 4WFHE 2OR9L 1KXQE 1CVRA 3CVIL 5LG1A 4WHDA 1BEYL 4HKZA 3ROLB 3GMLB 2XKNA 1FH5H 3SDCC 3STZB 2FLRT 1D5ZB 3ZO0A 1GPOH 5SWSD 3AAZB 4PG9B 3CNKA 2HN7B 5FHBL 1BZQK 1RPQA 1DSFH 1I8MB 4OF8A 3V5HB 4K3DL 1AGFB 3LHPL 2Q86A 3O0RH 5DUML 2CIKA 5ICZA 1GC1C 1CFSB 3DMMA 4EQ2A 1FE8L 3CU1A 5IBTL 4BFEA 5T3XH 4HC1L 5A16B 1KIUA 1M6OA 3VFUB 1F6AA 4FFVD 1QQDA 3BUYB 5TE4L 3D2UD 2BRQA 4CADB 4ORGB 3ULVH 3GGWA 1FZJB 1H5BA 4LCWA 1S7RB 3C60D 5E8PB 1L6XA 4U2YA 3VA2C 2DQJL 1RURL 5ISZB 3MODL 4D3CL 2DN7A 2ZOLA 5ESVA 3TT1L 2VZVA 1CXHA 5C09E 2YRPA 4LK4A 2BCKB 2NNAB 4GRWF 4P59L 1YEJL 2NR6C 1ZLWK 1PY9A 3IETB 3TV3H 1FZMB 4MJ2A 1P84K 5HJ3B 1JYWA 3I3DA 4OTXH 3OKMB 1Z3GH 3LAFA 1RUAH 3ECBA 4YBLC 1CD0A 1KCLA 1UKTA 4PV8B 4CDGC 4R3SA 2Y5EA 3GMOB 1REIA 3CFBA 1IBGL 3CH1B 3OJMB 4PJCF 4Y2OA 5A3ID 3MRGB 4J8RA 2JELH 1FNEA 3MPCA 2VC2L 4HV8B 1WF5A 3UMTA 1AD9B 2FO1A 2VXQL 1YEGL 3QH3A 1MNUL 5MEQA 4HUVA 3O2WL 4LQ1A 4PJGB 1I8LA 3LS5L 1JI1A 4WFFD 4CUCA 1QRNE 3HZMA 3BWAA 3PWJB 3ZE0F 4WEBL 2DTSA 5FK9B 5TPWL 3IFOB 4WY7L 2ZCKH 4NQEB 2IG2H 1XF3A 4LRNH 4GXVH 3OR6A 4PJIA 2OP4L 3DO7A 3GBNL 3IVKB 3NACH 5H37G 4K3GA 3O8XA 2AQ3A 1RUKH 2H2PD 3U2SA 4Z7NE 1ZSDA 3ZKMD 2E7LC 3DJ9A 1ADQL 1G7QB 3FFDA 4NRZB 2ARWA 4P5TA 4M6NH 5FOBB 2HVKB 2XA3A 1I8IB 1MHEB 1OGAE 2W9LA 5HY9B 5B3JF 2O5ZL 3FB8B 4UV7L 1X44A 1BM3L 3PGCB 1IQWL 1N7ML 3MLZL 1G7JA 1V8HA 4YDKL 1JFQH 2IGFL 5J4MA 1S5IH 2Y06L 3PJSA 3TJEL 2NTSP 4U6YA 5TGBB 4DKEH 5J6GB 4MSWA 1MQKL 3BVNB 5D7IB 4WFGD 1WEJL 2VLJA 1UEMA 3N85H 4HG4J 5IVXE 4I3RH 3WFBL 2NX5A 4X6DE 4AIZA 3RUGE 4QHMB 2YD8A 3D3VE 3O3BB 5HYIA 3DI3B 4QRSA 4OKVB 1U3HD 1BF2A 3ZKNC 5CGYC 2GFBB 4WRLA 43CAB 1DQLH 4IDJH 4P3CH 5MHSE 5JOEA 1DLFH 5HHNB 1EV2E 1LQSR 1N59A 1MVUB 1LGVA 4PV9A 5L88H 1T20A 5FUCC 5GGTH 4M7LL 1AIFA 2AP2A 1TVBB 3IAQA 4RGNE 1S9YB 1U8JB 4XPAH 5DK0B 5FFLA 2DLHA 4QOKE 4LLQB 2EKJA 1D9KA 2CKNA 3PXHA 2D4FA 4HS3B 1T5WA 1C7TA 1AQDA 3VG0H 4O4YH 3QIUC 1ZOXA 4EDXA 2J8UE 1V3LA 1DL7L 5F9WB 3VJ6A 3P9LA 5AWNH 3W39B 3O2DA 3QXWA 4R8WL 4X6CE 1DP0A 3BDYL 3KDMB 5I75C 4HUUB 5F9AC 3OKDA 4HH9A 3IS1X 1IM9D 3OB0K 5HYJB 4MJIB 2DM2A 3VRJB 2X41A 2RCSH 4MNQE 5DD6B 1ED3B 5AYUH 3LH2H 2UZYB 3O6MH 3OTTA 3JV4B 5CKAA 1RVFL 2YK1H 3NFPA 2CQVA 2XNAA 4LQFH 3RGVC 4YHKH 4EKXA 3NFSH 5K9JH 3BHBB 3SE3A 4JPWL 3ARBA 1FVEB 1HQ4A 4X6EA 3VXRB 2CDGB 5GPRA 1G7HB 1OB1A 1F2XK 1A02N 2H9GA 3VFRA 3R8BB 3MLPA 2V7NA 4LVHC 3RVTC 1RJLB 3BRFA 4Y16B 3HZVB 1ZK9A 5BO1L 3NCJH 5D1XA 2MCPH 5I1IH 2MNUA 1AR2A 2PO6D 1R3KB 2VERN 1F4YL 1IQDB 2B8OT 5SWQB 5C0CA 3AM8A 4OZGB 4HGMA 4I48A 1JGDA 4PJBF 4R6UA 1HOCA 3AREA 3NTCL 3C9NA 3LN4B 3T09A 2WP3T 1RZ7L 3HAEB 4IHOA 4RAUA 2VDNL 3TJHC 4Y4KA 3GSNB 3C6SA 4G8GE 1IGCL 3GJFH 3L5WA 2BY0A 1R3JA 3WNOA 3VXUB 4UQ2A 2AV1A 3R1GH 1H0DB 5BVJA 1B6DA 4OZIE 4F2MA 1H8NA 3P0VH 4OCNC 4DW2H 1XGUA 4PYHA 3RJQB 2RBLA 4I0PA 5DRZA 3BH8A 1C16B 5FHAL 4HLZH 4KK5C 2YUXA 1WJ3A 4BZYA 2F19H 1V7NL 1T5XA 4JZJC 4U6XB 5IFJB 5KOVC 1EIBA 3MRPA 4NN7B 4MA7L 5J9PA 2EEDA 2NY3C 4Q9RH 2Q3ZA 3QEQE 5I1CL 2J8OA 3CFEB 1BGXH 4FFZL 1QLFB 5KVFL 4L8CB 3EYOB 1LK3H 3L3GB 3E3QE 2AEWA 1OAYH 3LKRA 2WAHA 2V17H 1E6OH 4NZRH 4N0RA 3QFJD 3S96B 4XNYL 4NNXB 4AM0B 3QUYC 1XMWA 2O61A 3D0VA 4KI5F 2X4RB 5IVXB 3NFNB 1ND0A 3EGSA 4XH2B 4EQ3A 2JK5B 3D3VB 5DMKB 4D0DA 3DX8B 4P5KA 4PJFA 4HG4K 4F15C 3OAZH 1OTTC 5DEFB 2OJEA 4Z7QF 4PGJA 1RK1B 4DZ8A 3TFKC 2B1AH 5JORA 3DV6B 5L2JA 3FQNB 5GRJH 4CN4A 1Q0XL 2H32A 3TNNA 15C8H 3QI9B 1J8HA 3V52L 3EYQC 4JO2L 5DK3A 4XPHH 5T33H 2PTUA 4IOFC 4NO0B 5EPMA 5A40E 4M5ZL 3VDAA 4JGMA 1ZVYA 5D6DC 3S3SA 4GQ9L 3ZHDA 3EW3B 3QG6B 4J2XA 3I9GL 4KQ3H 1CIDA 5EU6D 3TA3B 1DVFC 1KJMB 5DD3H 4G9FE 1XIWA 1YNLH 4LSVL 1UCTA 1X5IA 1W0VA 4RFEA 4E41B 4LCCA 4JLRA 3KPMA 3PL6B 2DQDH 4H0IA 3V0WH 4BZ2H 1YYLL 4JKLA 5IMLA 1UKSA 3ARGB 4UDTB 3PWPB 3T0VA 3SO3B 3LMJL 5EULV 1XGYH 4MNQB 5IBLD 1JWMB 1J0KA 4ZFFB 5DRXB 1B0WA 3O6LL 5I30L 1Q0YH 3GIZH 3WFHA 3F6IA 1XCTB 1IC5L 5F7DA 4NNYA 2BSSA 1DQMH 4CVZA 1YPZA 4KZDH 2F5AL 2XN9E 1JJUA 3ARFD 2VIRB 2ED8A 4EI5C 2EECA 3VXNA 1IC4L 4U7SA 1Q1JL 1GYAA 3VXTB 5E6ZA 4YK4C 3CFDA 1WCBB 1UJTA 3P4MB 3VDBA 3CIQA 1CD9B 5C0DB 2IMNA 3UBXA 5CKGA 4ERSH 4MCZB 3D0LA 4JY5H 2VLLB 3KNBB 3TN0C 4UZGA 4M62L 4MA1B 2XQYK 5H94B 3DBXB 3U7YL 3G9VA 5EUKB 4D0CB 4YC2B 3CPLA 1MI5E 3BFOA 2E7CA 3T65A 3DRQB 3KGRA 4W70A 4CVWA 4AIOA 2BVYA 4OZIB 1F90L 2JJUA 4F9LA 2ZSWA 3H6JA 3GRWH 3MRHA 3KS0H 4P4RB 3C8DA 4M5YH 3TNMB 1KCRL 3L3IB 1V3KA 4EIGB 5IWLC 2DI9A 2ATKB 4JZOB 4UILH 5KOMC 1EO5A 4ZS6C 4ZD3H 1RJYB 1JGVH 5FGBA 3V4UL 1AR1D 1ZXQA 3T08A 1H8OA 2HFEA 4XGZA 2VN4A 1EMTH 1KJ2A 1FL6B 3V9FA 1NFIB 5DJ8A 2D0FA 4XMPH 5H2BA 4R7DA 2BRRL 4JCLA 3VFOA 1MHCB 3PGFH 1Y6MR 3T0BA 5GXBB 3IAGC 1UCBH 2ADJB 3DROB 4NZJA 5FUOL 1X4YA 2A9MH 4R2GD 5L7XL 3RHWK 4YIQA 1KJVA 2YZ1A 5FAAA 4ZFOA 4XX1E 1CGSH 3QO0B 3RVXC 3TIDA 2FD6H 4JKKA 2LTQB 4FQHB 2DWDB 4DGYL 1AC0A 1WVZA 1FZKB 2IH1B 4Z7NF 4PLKD 5E5MB 3LDBB 3UC0H 1A6VL 3H3BC 4GAJH 3QNYB 4UT7L 1EJOH 5BRZA 3CSPA 3QDAA 1FYTE 4LSRH 4DUVA 3SDDA 3MCLH 5F7EL 1OSPH 4MXQD 2ZCLL 5KJRL 3LQZA 2L7JA 1ZHKA 5SX5H 1LVEA 1U6AH 1U8OB 5HPMB 4WFHD 1XR9B 3HTLX 4G9FB 4WNQA 5LWYL 1KCSL 2A6KA 3RIFF 5DJ6A 4M3KB 4ELKA 2DQIL 4NKIL 4N9GA 3LKPB 4ODWA 5HDQH 5E8EA 4XC3H 2P5WB 4DQOL 4YNYB 3WDHA 3R0NA 4TVPL 5JPNB 1WCQA 4PRID 1JPGA 2V2WB 1ZHNB 4PR5A 1VHPA 5IVXF 4OF3A 2V7HA 4X6DF 3GSUA 4BZ1L 5D96C 1WTLA 2EIEA 4J4PC 3VH8A 4MAYD 4OKDA 4DN3L 1GHFL 1B2WL 2HG5A 5C7XL 1G9MC 3OJ2C 1S7TB 2F54B 2X44D 2ZG1A 1R3IH 3PABA 3P0YH 2Z31B 3CK0L 3ULUE 1XF4A 4OF6A 2QQLL 3MCKB 3OR7B 5C0BE 4DTGL 1T1XB 1FGNL 4IMKA 4QXTB 4D9LL 2NY7H 2NYYC 4RX4A 4Y4FD 5C09D 3IXAB 1GGIH 2UWEB 2JB6A 3TIEA 1QPPA 5CGMA 2A77H 2YXMA 4YGAB 5T5FH 4R97B 4KH2A 5JTWA 1RUPL 3CFJA 4U0RC 4G6KL 4OFYD 1U2CA 4X8XA 1TVHB 5IKCA 4U1LB 2J8UF 1WWWX 4JB9H 1FFPA 4PLJD 4NFDA 1RIUH 3FO2B 1WC7A 3MRFA 2EC9U 3UBXG 3RL1B 3WNLA 1CK0H 4UT9H 1KPVA 1R5IA 1ORQB 4G7YH 3MRKA 4I2XB 2Z0BA 2R4SH 3WFCL 3DMMC 3MXWL 2FEEL 1T7XA 3K4ZA 4PD4J 3ZT6A 4Z78A 3S3JA 5J1TC 1NDMB 5EH1A 4JFFE 4L1DA 3BZEA 5D7LB 3WHE0 1OAKH 3FOMB 4NC1E 5DFWH 4HUMB 4O58H 1H5BC 1QRND 3PDGA 2OS7A 4XI5C 2OTUB 4K8RC 4ZNCD 5ID1A 3SKJL 3K0WA 5DDHA 3RWHA 2XQYG 3FN3A 2P46B 1IEBB 2CRMA 4Q74A 5J3HC 1M05B 2X6MA 1F58L 4MVBD 4OLYH 1CXIA 1Y6NR 1MLBB 2ADFL 4X8JB 1FFOB 3QAZB 4MLIA 4H1LA 3QUXD 4TULH 4U6HA 1X7QA 1QYGH 4WUKL 1HZHH 3QUMB 4V1DA 1ITCA 2VJXA 4JAMA 3U4BH 5GGSA 4OIIL 2AS5M 4G80A 1OGAD 3VFTA 4TUOA 4MMXC 4IEFB 4Z95H 1A6TB 2WW8A 3CGTA 4UBDD 2JB5H 5EO0B 3MV11 3AB0B 3O11A 1GGBL 3OX8A 4L3EB 4P9HC 4LKXA 1S7SA 4JFEB 4NWUL 4OZIF 1C1EL 2KQNA 4N8CL 2GY5A 5DJXB 2VQ1B 1DQJA 1I8LC 4XPGL 5T3ZL 2EH7H 2NQCA 5JHLL 1PZ5A 4JPIA 2I25N 4IS6A 4OQ1A 3ZTJG 2FBOJ 1MY7A 3RX8A 3OKLA 5IUSA 3I2CL 1ACYL 3DUSB 4HQQH 1EVTC 2AQ1A 1K3IA 4OCYL 1A6AB 4JFQA 5JO5B 2AJVL 3O8XC 1FNSH 3IDGB 3O3DB 5KVGH 3P30H 2HTKC 2OXHA 4OGYL 1K8IB 1L0XA 2UUDK 4Q6IC 3HE6A 2WUBL 4GBXB 3A6CH 1K6QL 4HKBB 3OJDB 2BK8A 3EYSL 4P5TC 1M4KA 5D5ME 1YY8B 4P2QA 2QADC 4LSPH 4ZOAA 5GS2D 4JFOB 1CQYA 1VACB 4XVSH 3THMH 4RGND 4HCRH 4LEOB 1KT2A 4LLWA 4G5ZH 4QOKD 3KPSE 4ZUUB 4EXPX 5FDYA 4MNGE 3TVMA 2QQNL 4LCUA 1IC7L 3ARPA 2GJ6B 3F65A 4G3YL 4FQIL 3ME0A 1WAAA 1ZA3A 5DFVD 1YDPA 3AXLB 1JPFA 3C6LB 1A22B 3ABZA 5C0BB 3T4YB 3RDTD 1NFKA 4I77L 5C9JB 3HI5L 1FO0A 2ORBH 3G6JE 5IW6B 4L1HA 3RVWD 1FFRA 1I3VA 3ZSTA 1DEEA 4ZPTB 5F9OL 1ZWIA 3DX9A 4YDJB 3K8KA 2OMBA 3HI1B 4GAYB 5I71B 4QXUL 1PKOA 3OSKA 2H3NA 5TQ0H 1NGZA 2VDLH 2E27H 1ZT1A 1U92A 3MJ9L 1CWVA 3D87B 2XTJB 5EWIL 4P3DA 2GITB 4KMTL 4G8EB 1G0DA 3X11B 4YHYC 1TQCB 4F37F 2C1PB 1RJZA 1RU9L 5JDJA 3S88H 1MCQA 1U93A 1JZ3A 4MDIA 5DWUL 4MAUL 2F5BH 4YQXH 3MV9A 3PQYB 1FG2A 2GJZB 2XWJB 4X4XA 3BPCB 2WLZA 4OZHB 3QZWA 3AU1A 2HJLA 1BP3B 5I8CA 1D9KC 5IMOA 2CIIA 1F97A 2WBJD 1U8KB 4JJ5B 5D7JB 5DHVH 1T4KA 2VXTL 4RAVA 3FB7A 4Z0XA 4WTWA 4PD4K 4WGWB 4MD4B 4H20L 4QT5A 3OJVC 1Q9KA 1I4FB 3KWWA 3L6FA 1I9IL 5AUMB 3LEYL 2IANA 2KL6A 2C3VA 3QIBA 5EOQH 3BE1L 3CSYA 1FSKC 1MEXL 1NMAL 1NUNB 3O2VL 4G8GD 4XWOD 2HWZL 3O6KH 4K23H 1IGFL 1ZT7B 3WXVL 3F7VA 4OD3L 3HLAA 3V79C 5B39G 4OCXH 5ILTH 2K7PA 4JHAH 3SE3C 1XGRB 3QO1B 3ARBC 4NM4H 7FABL 4QTIL 5T1DH 2NY4C 4U1HA 3G5XA 2CK2A 1KFAH 2IJ0C 5IIEB 4AEHL 2DQEL 3QJFA 3LKOA 4DGVL 1ES0B 5C2BH 3LKNA 1UXSA 1HDMA 2OTWA 5D1XC 3BEWB 3EIFA 5SWSA 3SY0A 3OBAA 1P1ZA 3QEQD 2EDDA 4NP4L 2HT2C 3QPXL 2XZQL 1SBSH 4LKCA 4FA8A 1YYMH 3B9VA 3QWOA 5CEXB 5J89A 3AM8C 1ZS8A 2CUHA 1JF6A 3FT2A 1CFQA 4J1UA 43C9B 5HHOE 3AREC 2A6JB 1FNLA 4LU5H 5IQ7L 1RMFL 2VQTA 5JDSB 4DGIH 2WUCL 4FQXD 5DRNA 3RWFB 3I02A 4DUWA 3L7EA 3MXVH 3JVGA 1EHXA 4Y4KC 1F4WL 3Q5OA 3SGDH 4F8TA 3TYFA 3UO1H 2EIDA 5BV7H 3LRSA 2IMMA 2KBGA 4ETQA 3WO4B 5ESAA 5LGKA 1HINL 2HFTA 4I0PC 4CW1A 2P7TA 2DQFA 4JRYE 3TM6A 6CGTA 4U1JB 1L6ZA 1CU4H 4B5EA 1NANI 1H3TA 1JHTA 3KPSB 3KYNA 2FL5B 3QCVH 2QEJA 1X5LA 4MNGB 5EU4B 3U30C 5I6XC 3RWEB 4OQTH 2DLFH 3B83A 2G5BA 2C3HA 5EBLB 3NMEA 5LXGL 1NBYB 1A0QL 4XCYA 5MERB 4XC1H 1F2QA 3FQWB 3GSNL 4TUKH 1CD1B 1BJ8A 1U3JA 3LSOB 3GJFB 3QEUB 5LAXB 3S5LA 3FJTA 1KIPB 3MUJA 1M7DA 4YZFF 2W60B 3QXAB 1VPOH 1CIUA 1ZT4A 4LVNB 2YD4A 4OZFB 4HX1B 1MWAH 3VD3A 3BWUC 4M48H 1KUMA 2CO7B 2ICCA 3W81A 3WXWH 5J7CC 5EORL 1AY1L 3MUGA 4HWEL 2XN9D 4KAQH 1R5VA 3P9MB 4HIXL 2HT3D 1CGUA 5E6YA 4HFUH 3FZUC 4JY6A 1QD0A 1KXTB 1NGYB 4JM4L 1C5CL 1CTOA 2E6QA 3GMPB 3HE7B 5L6YL 5FO8A 4ONHB 4NQCB 5K59F 1T0NA 4FABH 3TWCH 1I1FB 4PRHE 3V0AC 2RFXA 5DEZA 4EN3B 1JWSA 5IMMB 2UYLA 4PJ7A 4JFZL 3U4EA 1QFOA 2YKLL 2YA2A 3V5KB 3D25B 3D6GA 1HYRC 3RWIA 3VFSB 5SX4I 3VGEA 5FM8A 1K4CB 4FN0A 1N5AA 4QRQB 1DUZA 3EJYD 4LCCC 2E6PA 1INDH 5A2JH 4P57B 3TZVB 1HYSD 3ULUF 2P5EA 1CE6A 2BHYA 5CZVL 3QZWG 4J3WA 3CVHH 2XFXA 1JZ6A 5EZIL 2XG4A 3G6DH 1X5KA 3EDFA 4KRNA 1KJ2L 1CF8H 5L0QC 1GCFA 1MI5D 2OQJA 5HVHC 2AVGA 1I3GH 5FYLE 4OLZL 1PQZB 5JOPD 4WDIA 1UM4L 4NHCH 5J6HB 3RI5K 3W9EA 1AP2A 1F13A 2EYRB 1U3HA 1EZVY 3N1PC 3K2UH 2W65A 5JA8B 3F58L 1YY9C 3DHJA 2W0FA 4ZUVA 5F6IB 5IHUL 2FX9H 4K94L 4YDIL 1CDIA 1S5HA 4YDLB 5I19H 1HH6A 1QKZH 5BZWA 1FLRH 4Z5RB 5CD3A 4RZCA 4GQPH 2OL3H 4QHLA 3LS4H 4WCYL 4K7FB 1QNZL 4Y88A 2J3SA 3MLVH 1L7IH 1NCCL 1A7PL 4F33A 4GXUN 3PF2A 5DVNA 4JO3L 1QA9B 1PYWA 2OMNA 4R90H 5CSZA 1UENA 5JW4Q 3D39E 1F4XH 2CK0H 1W0YT 3WLBB 1O5DT 1WFUA 3VFPB 2X1PA 3OAUH 2GSGA 1MFDH 1MJ8H 1NUFA 2AKRB 2VZ1A 3Q6FA 3KS0J 1IM9A 2NZIA 5EC1A 5KSBE 3U7WL 4PJCA 3BGMA 4NHUB 1TJIH 2BFVL 2D4DA 4F9LC 3JWNC 5FM5O 1I7TA 2X7LB 1YEIL 2FIKB 4NQSA 1NLDL 3FMGH 1N6QH 4D94A 3LN5A 3OGCB 2YUZA 3UTTA 1YUHA 2AI0H 3QXUA 1FYTD 1R3HB 3NZHL 1VERA 1NGXA 4AQ1B 4S1DC 1H3UA 1Z6JT 5IFAL 4ODXA 5IT2L 3QHFH 4AL8L 3EYFA 3NVQA 1CGXA 5DMIL 5C8JA 1JYXA 1KCVH 1B88A 1SY6L 3ARDD 3SQOL 3OKOA 4OI9A 4TSBH 3BZFA 4PJ8D 1KV3A 5E8NA 3QPQC 5DHYA 3VGAB 2CMRH 5EB9A 2X2YA 3PWUA 5GS1A 4PJXB 2PO6A 3PHOB 3WL9B 2P8MA 4UAOB 4GG8A 2YPLA 2V2XB 3OAZK 4LLMB 2H2SC 3VWKB 5FYJE 4O51A 4I9WE 1A7QL 2ZCHL 1JGEB 3G6AB 5CIPH 2ZSVB 3U82B 1X5FA 1R0AL 3NN8A 4YWGH 3S5LG 1QP1A 4BSWA 4EUPH 5TQ2H 3QP3A 1P5UA 8FABB 5C0BD 3HFML 4U1GC 4KHXH 5GJSH 5D5MF 3SDDC 3KR3H 4WHYG 3HRPA 5C92A 2OSLB 4Y4HB 2EEBA 3U7AA 2P8PB 1JPSL 3KJ6L 3DURB 3EDKA 2D7TH 4HWBH 2HKFH 3WKNA 2HLFD 2K9UA 5EZJA 3I6KB 1FN4A 1JNHA 3HMXA 3R4DA 4XP9L 1YN6B 1LO5A 4MHHI 5HYFA 1FNAA 3FFCE 3W0WE 3NPSB 3IU4L 3IFNL 2BJMH 3G6JF 3B9KD 4RMRA 5CJQH 2QSCL 4E42B 4FP8L 4KKBC 1GH7A 1HH9A 3QFJA 4QGYA 4J3VA 1HHJA 1A6WL 1EHAA 2XZAL 1MCSA 3QISA 3VRIA 4JFFD 1EEYB 1S8DB 4X9BA 3H3PL 4Z7UE 1M1SA 5AZ2H 4HIHA 3VCLA 1TZGH 1UB5A 1FFNB 2HLAB 4MDJA 4C57C 3TO4B 5C0EB 2A1WH 2FX7L 1WQVT 4IMKC 4U1KB 1JRHL 3HR5B 2BVTA 4CNIB 4F7MA 2FZ3A 1CXEA 5HSFA 5ANME 2BSRB 5IESL 3MLSL 4YBQD 4HK0B 1I1AB 4EI6A 2R2EB 5IM7B 3GSOA 2JE8A 2SEBB 4Q2ZB 2ITDA 1JN6B 1T7YA 4X4YA 5DI8A 1D6VH 3MBXH 3T4AA 3RA7H 1WIOA 2ZKHL 3D39B 5EU6A 3BP7B 4S1QL 4PJEE 2WWKO 4PJDE 3UTQA 1A6ZB 3IDMA 3ROLA 2YD7A 1MCHA 4UNTA 3F12B 4KK6D 3W11C 3E6HA 3T77A 3AAZA 3BSZL 4U3HA 4JG1L 1KN4L 1I8MA 3V5HA 3SQBA 4OV6F 4LFHD 1SVCP 3DSFL 4QXGH 1WZ1L 4XP5L 1CFNB 2WBWB 4FTVE 4PJBA 1NUGA 3QDJE 4ONFH 1VSCA 3I6LE 2DBJA 3ARFA 3EOBB 3X14B 4M6OL 4ORGA 4YLQT 1VGEH 5EU7E 1FZJA 4BSJA 3DI2B 4QCIB 4QRRB 2Q7NA 1YEHL 3RWDB 2H8PB 1EAJA 5D71H 3MLXH 5KVEL 4TQEH 3FN0H 2AJZB 2J6EH 1G9EA 4NOBA 3V7MA 3PP4H 4HKXB 4HZLB 4JM2F 4K2UL 2X4TA 3MACL 1F3JB 3RZCD 2YMXH 3LVEA 5DJYB 4XRCB 3SDXB 1X5XA 1C7SA 5IW1A 3PWNB 2Z93B 4TPRL 1A8JH 1GGYA 4G6AC 5T1KD 2P47B 5IB5B 4PRDB 4R4FL 3TBYA 3BPNC 4NBYB 3P0GB 4AH2B 1CCZA 2HTLC 2R56L 5IK3B 1H3XA 5KZCD 3LOWA 2EDTA 5D8JH 2EXWD 1O0VA 1U58B 1UZ8A 4HV8A 5JW5B 4WI5A 3FCTA 2PYEE 5J11C 1IEAB 5JA9A 5C6WH 1DSFL 2P8LB 4XHJD 1JNLH 5SX5K 1I7UB 12E8L 3TF7C 3MRCB 3TPUA 5JIHA 5T1LB 4QRPB 5CJXA 3VXQA 4FZ8H 1DBBH 2I60H 3JV5A 2IEPA 1N0XH 4RA0C 4N0UB 3IFOA 3GFUA 4OLWH 5IVZB 4O2EB 5DUBA 3GHEH 3SDAC 1CDJA 3W0WB 3IVKA 4H88L 1EFXD 4WO4C 1BECA 4XWGH 4P2OB 3UTOA 1JZ7A 2DIJA 1QHPA 1AXIB 4QWWD 4MB4A 1MLCA 3J8F7 1CFVH 2NY0B 3KHQA 4Y8AA 1OWWA 4P5MA 4XNZB 1M7XA 4YO0A 3TVMC 3PG2A 1TTUA 4OJFH 3BXNB 3NA9H 4Z7UB 1B6UA 3TV3L 1V5JA 1G9NH 5HY9A 2NR6D 2JF1A 4OTXL 2VYRE 1Z3GL 1DFBL 3MUY1 1K8DA 1RUAL 1FAKT 3BYYA 4Q0XL 2GCYB 3VA6A 1X5GA 5FGCB 4Z7WB 4PBVC 2ARJB 1BFSA 3P2TA 1UB6A 5IG7B 3MBEB 4X7SL 2BC4B 1DDHB 4BA8A 2LU4A 4KVNL 2JELL 4D9QE 3UJTL 5HBBA 3GB7A 2I26N 2PNDA 4ZXBB 3U36B 2RIKA 1ZLUK 2X1XR 2FECL 5KAQF 4AT6B 3H9SB 5BCAA 3HB3C 4QHMA 4ONGH 1GC1H 4QYOB 2QQKH 1CL7I 2IPUK 1WICA 5C0JB 4PJDB 3SE8L 4GT7A 1AE6L 2FSEB 3P4OB 5FIEA 3QWRD 5CBEA 2GFBA 2A74B 43CAA 2O26U 5E1AB 2DMKA 2ZWLT 3MV7B 2ZCKL 1MVUA 2G9HB 2IG2L 2LFGA 4LRNL 4GXVL 3ZL4H 5FB8B 4N1CA 4PUBL 4DKFH 3SO5A 1KBGH 4IJ3C 4NQVA 5DTFA 4L8SA 3H9HB 3NACL 1EGJH 3BP4B 3H7LA 1TVBA 2PUQT 1NANH 3DVIA 1RUKL 1YEDB 2CUMA 4N9OB 3VXME 2NY6D 2Y6SC 3WIHH 1S9YA 3L3JB 4XCCH 5HHOD 1P5VA 4MAYA 5KSAD 4QLRA 1FHGA 3QDJB 5ERWB 4JM2D 4J7RA 3QIBC 5JIKA 1OP5K 3TP4A 4Q58C 2X4OA 5DMYA 1T22B 1U8PB 1W0WA 5GGUB 2DF3A 3W39A 4JVWA 3BN9C 2CRIA 2A0LC 1QEWA 1JFQL 4WV1B 4Y4FA 1S5IL 5C09A 3K8MA 2OI9B 5DVKA 5ESQB 2CH8A 3FT3B 3JV4A 4JRYD 4DKEL 4NC2B 2NPLX 3RNKA 3UX9B 3ARRA 3EJJX 5DHVB 4KROD 3N85L 1WK0A 4OFYA 5BZDA 3WJLC 1MREH 1JK8B 4K3EH 3KLHD 1BVLA 1ZVSB 2BOCB 1NAKL 2JKXA 1AHWA 1BEYH 3CVIH 4OD2B 2E9WA 4LAJH 2QTEA 3MZTA 5KSBF 1DQLL 4IDJL 2VLMD 1RJLA 4MQ7B 4P3CL 4Y1AB 3BPOB 1DLFL 3F7PC 1J5OL 1NL0H 5MI0B 4R0LA 1K2DB 5L88L 5EBMB 4IMLB 1OY3B 5GGTL 1NEUA 5DYOA 2BSTA 5DUMH 4PP2B 3VXSD 3UPRB 5EO9A 1R3KA 5AG9A 1BIIA 3JVGC 2EEAA 5SX4H 3V8CA 4NRXA 5JOFB 1CFTB 1PW3A 1QRNA 5C9KA 1A3LL 1JUFA 3P73B 3QJHA 3LN4A 4NO5A 1VFBA 1YN7B 3HAEA 4LSDA 1YECL 4MXWH 3I3BA 5JR1H 4O4YL 4OZ4B 2O93L 2BOBB 1OW0A 5AWNL 2YD9A 2Z8RA 4D3CH 5I1LB 3DVNB 3QIUD 1H0DA 5D7SH 2NY1D 1T0MB 5DJDB 5DJZB 4FG6D 2MMXA 4QHNA 5DRWB 4UIMB 2RCSL 3BKMH 2C3GA 4PRHD 3U9UA 3O6ML 1J0ZA 2ICES 2YK1L 4LQFL 3D69B 3C8KB 1A1OB 1S9XA 1U95A 2D0GA 2J4WL 4YHKL 3NFSL 3PGDA 5K9JL 3DYOA 1VKXB 1OGAA 5A3IC 5GRUH 4JGUA 1NEZB 3DTXA 2FO4B 4ZYKB 5F1IA 5BS0E 4PRNB 1ETZA 5HXMA 4HKJB 2OJZH 5DS8A 5IGXL 2ZG3A 1C08A 1ZLVH 2VOTA 2R1WA 5FYLD 3NCJL 2MCPL 1MNUH 5DR5H 1VFOA 2E9IA 2PXYD 4KGLA 2IPTL 5IVXA 1KPRB 3EDDA 4X6DA 4ZTOH 3NFNA 4HS6B 4GMTH 5DMKA 2GSIA 3D3VA 1JF1B 4EDWL 4Y19D 2GK0B 3M07A 4WEBH 5TPWH 2ZOKA 5CEZE 4WY7H 1OL0A 3A6BH 4L3CB 4NDMB 4PRAA 3GIVB 4XPBH 5HGBB 5LKNA 4NJ9H 2OP4H 2H2PC 3ZKMC 5ITBH 5IQ9B 4JDZA 3DV6A 3D48R 3BDBA 3UP1A 2I5YH 4PYGA 1HQRA 4Y0GA 1KTLA 4PY7A 3HG1E 4D0BB 3RY4A 5C0AD 4KZEH 3R1GL 2H26A 3ULSA 3VXMB 3T3ME 4ZS7H 1MJJB 3H8NA 3KPRE 1TXKA 2K3TA 3MLWH 3P0VL 3S36X 2E9JA 4QOKA 5IW3A 1MWAB 4Z7UF 4HHAA 5IP4A 3QG6A 4NO2B 1KEGH 3D39D 4JO1H 1TENA 2O5ZH 1WWCA 4HWNA 3TA3A 2IPUG 2F19L 2J8UA 4G42A 2BNUB 2MCG1 4QRUA 4P46D 3RDTA 3WKML 4ZMAT 5B8CA 1X6NA 3PL6A 4X6CA 4OCSL 3SJVE 3KLAA 4N90E 2HA1A 2DIBA 2R2CA 2WM0A 3ES6B 4AG4L 3CCHA 2W38A 3EO1B 3BZDA 3VFMB 4LARH 4OSUH 1QZ1A 4MNQA 5IBUB 1MQKH 3IKCA 1OAYL 3OG6B 4FQ2H 4XB8A 4X9GA 1AGDB 5GGVL 1IGTB 2V17L 1E6OL 1U8QB 2YEZA 4LIQL 4X80L 1U3HC 1WT5A 4M4PA 2IQAB 1NC2D 5FYKE 1JZ2A 4TSCL 2FHFA 4PJEF 4CU7A 3FAXA 1H3VA 2PCPA 4PJDF 1KSRA 1IE5A 4LVOC 4J3SA 3UTSE 3FOLB 1LE5B 1RZ8B 1X4XA 1GZPA 3HNSL 4PREA 3FO1B 4D8PB 1AO7B 4KKAD 3VXTA 3VMNA 3CVHB 1PSKH 3V2AR 2VDKH 2Y7QA 1QR4A 5I2IA 1WCBA 4M7LH 4Q9QH 5FA4A 1U3YA 3EDEA 5GRJL 5C0DA 4LPWA 15C8L 3U46B 2NW3B 4GFTB 4HLJA 2WBJA 4XPHL 4Y8DC 4G6FD 4AENB 2XICA 1EEUA 5D93B 4ELMB 3G5ZB 1A1NB 5JPMB 3EYQD 4MCZA 4F7CB 5FYJD 4C4KO 4I9WD 1TDQA 1Z5LA 3PNWB 1N0LA 3HMXL 1JTOA 3FRPA 5HGHB 1AKJB 1DL7H 5F8RC 3DBXA 5DD3L 4OUOA 4G8GA 3BDYH 1YNLL 5EUKA 2DQCH 4D0CA 4A6YH 3WN5B 1SYVA 2DQDL 4JQVA 3V0WL 4BZ2L 4OZIA 4XT1C 2OL3B 3E0GA 5C08E 1MHPH 1XGYL 1FNHA 4PGEB 1F42A 1CQKA 5C0FA 4P4RA 2H6PB 3L3IA 2VLKE 2F53B 3HAEG 1G6RB 1Q0YL 3HC0B 3ZKQD 5M94B 3GIZL 4M61A 1HKFA 4ZSOE 2VWEC 4ZUTA 3ALXA 3TCLA 4N8VA 2D7PA 3VXOB 1RJYA 4KZDL 1QRKA 5D2NB 3L3KB 5A1AA 1KB5H 3V6FA 5GS1C 4WI4A 3QEQA 5BS0B 2Y07L 3FFCD 2PO6C 4EOWH 1I7RB 3D1MC 1LO0L 1LDPH 4PY8J 5KS9B 4Y5XB 3G08B 3HCVB 5E99H 3HZYB 3PDOB 4FQXA 5IFHH 3L3OB 5CP3A 2FYYA 4JFPB 2BVOB 4JQIH 2VXUL 3NTCH 4ERSL 3ILPB 4FOMA 2DM7A 5HHMD 3DROA 4JY5L 4DAGH 1RZ7H 4JN2B 2DLEA 3OKNA 1T03H 1HNFA 1DTUA 2LVEA 3DX6A 5ETUB 3HC3L 2CDFB 1TZHA 3QO0A 3IFLL 3UTZA 2EE3A 4LLYB 4NRYB 4R96B 1IGMH 4FQHA 5FYJU 1T66D 2IH1A 3O45B 3BGFC 4ODTH 5EC2B 3MV8E 35C8L 1UM5H 2R2HB 4ONOA 2BNQB 3W5MA 4JREC 4M5YL 1SEBA 3RTQB 4U2ZA 4KJQC 1U8OA 3DYPA 4PGDA 5HPMA 5CIPB 2DKUA 1HWHB 2MHAB 4G9FA 4UILL 3B3IA 4XNQB 3KPNA 2V6HA 4MA7H 5I73C 2FJFB 5GS0D 4ZD3L 3DNKA 3MQIA 4FFZH 1JGVL 1S9VB 2AEIT 3EKCA 5DURB 4G8FB 1I1RA 3IJHA 1BPVA 5JXED 1JHLH 3SGEI 4XB7A 1ZLSH 3QRGH 4OCRH 5CLTA 1EMTL 5MENB 1K5NB 1EH9A 1DN2A 1ZHNA 3QQ3A 4GAGH 4XMPL 2X4SB 4NGHL 4W4OA 2VDPH 4FTVD 1QLEH 1IVLA 5A2FA 2BDNL 1QFHA 1UCBL 3ARQA 1EUTA 1S7TA 2XN9A 1XCQA 1D5XA 1FP5A 1UJ3B 2R8SH 2Z31A 4DEPB 3VMOA 1MRFH 1J1XH 5D1QD 4YHIB 3DSNA 5I8KH 1OP3K 3V52H 5D4QA 2NXYB 2FD6L 2R0WH 5IHZA 2EDBA 5K9QG 2VR4A 4M5ZH 5E4EB 4NKOB 5AG8A 1CDCA 3IXAA 3UC0L 1ZHLA 3U0PB 4GAJL 1A4KA 1DANU 1EJOL 1T2JA 4KY1H 1D5MA 3MCLL 4CJ1A 4OLEA 5FO9A 1E4XI 5GZND 2ERJC 4D2NA 4U1LA 3H0TB 1WISA 2VQUA 5IBLC 3FO2A 1YYLH 4LLVB 4NT6B 4KTEH 3V5DA 1HN1A 1MI5A 5T1MA 3U0WH 5SWZE 1ORQA 3MSPA 1CLCA 5HDQL 3FTGB 5C08B 2XY2A 4IRSD 4HF5H 2PYED 1VEPA 3MRDB 1BLNA 4U3CA 3PWLB 1NDMA 3TBVB 4PBWD 4NUGH 2VLKB 3FRPG 1IKFL 4JO4H 4RMWA 3ARFC 1U8IA 4RWYH 3FOMA 3L95B 4X6FB 2F5AH 2IWGA 2CLVB 1EPFA 3QULB 2OTUA 3GO1H 4XMLH 5ICYA 4MD5B 1T1WB 2YHGA 4M00A 2XOTA 1R3IL 4M6AA 1XT5A 2EYTB 2W92A 1OD9A 1OSZA 5HYEA 2WLYA 1MLBA 3C5ZB 3X3GH 5H37H 2NY7L 4NYLA 3UBXI 1GGIL 4IIQB 3RWGA 3QUMA 4KJYB 4QNPE 1XGQA 5T5FL 4U6VH 5DJ0A 1Q9LB 1CGVA 2Z9TA 4P48A 3O3AB 4L9LB 1IGYB 4IRJD 3MRBA 3KXFE 4QF1A 2X4QB 1ZV5A 3OKEB 2F58H 4Q97A 4JB9L 1RIUL 4BQBA 3R0MA 1MCWW 2ICEB 1CK0L 2APBA 4R7NB 3DWTA 1EEZA 5HGAB 5DJXA 3MV8B 4D9QD 5F89A 4G7YL 1FYTA 3BQUD 5CJXC 3SKMB 2D31B 2FGWL 3E8UL 5FCUH 4GUPB 1AR1C 1WBYA 4TUJB 2MKWA 4L9DA 2B1HH 3DUSA 4O58L 4DN4H 1C5DB 1G9MH 3WFZA 3QXVA 3ARDA 3T0EE 3PV6B 1ZMYA 3WFEH 3ARYA 3O3DA 2QHRL 4ORZC 3IDYB 1DLHB 5ACZA 1UYWH 4GKZB 4LLUA 2A9NH 4K8RD 3TCXA 3OJDA 1YY8A 5GIRB 1PDKA 1NGWA 4OAWB 1AQKL 2VZ3A 4TULL 3K4AA 4R2GC 1QYGL 2F8XC 4ZUUA 1HZHL 2YD2A 5JQ6H 5CGTA 1NFDB 3U4BL 2Y1VA 4ZFZB 2NMSA 1IGIH 5IVOA 5HDBE 5DK2A 3W82A 4OB5H 4PLKC 3AXLA 4O02L 3C6LA 4Z95L 3ZKXB 5C0BA 2JB5L 1CFBA 4DGYH 4Z6AT 2EICA 4URTB 4PLNC 4UT7H 4NQDB 3T3MF 2GUOB 5K9KB 4GAYA 3RZWA 1PX4A 1FNGB 4NPYA 5I9QB 2IPKA 4HSQA 2GITA 3X11A 1S3KH 1NCWL 5BJTA 5FKPB 4OFDA 2BY1A 4QRTA 4K8RH 1BWMA 4WJ5B 4N1HB 4L8SC 4ZAKD 3HZKB 1FNSL 4U1IB 4X9IA 5KVGL 3SDCB 3P30L 4TVPH 3BPCA 1A5FH 3A6CL 4MAYC 1PZUB 4F57L 4P23D 1Q94B 2AXFB 4FMKA 4KKNA 2VISB 4KJWD 3QFDA 1U8KA 4LSPL 3GHBL 4JJ5A 4JFFA 5D7JA 4HD9A 4FZEH 1KEMH 4HJ0D 3MLTB 3THML 4DN3H 5ICXB 1GHFH 2YWYA 4HCRL 2ARJQ 4G43A 3VFGH 4NWTH 3CU7A 3J7HA 5HYSA 1I4FA 2YA1A 1WWBX 2QQLH 5EO1B 3IJSB 4Y4FC 4DTGH 5K9OA 3DIFB 2ICWB 3D9AH 3Q3GB 4PB9H 5HHXH 1ZT7A 3UZVB 1AD0B 2EDLA 4XPTH 4P9HH 2QV2A 4TNWF 3L5IA 2ORBL 1XGRA 3QO1A 1KXVC 2BMKA 1O7SA 4OFIA 3K74B 3P77B 1EEQA 3NZ8B 4PB0H 1RUPH 3GUTB 3S34L 1AHWC 3VD4A 4PLJC 2WINB 5TQ0L 4I4WB 5FECB 2NY2D 3BKYH 2CUIA 3ZYZA 3OG4B 5DZOA 5EOCH 4YBLB 4R0LC 3QDME 3I75A 4LASL 5E56A 4FQQA 2HFFB 5LCVL 3RPIB 5BS0D 2Z4QB 1DQDH 2F5BL 4YQXL 1ZANH 4XAKE 3WFCH 1AXTH 1NC4B 5FKAA 5MEPA 1H3GA 1QVOB 4LP4A 4BFIB 3ARUA 3AMKA 2A6JA 3S4SA 4P9MH 5HDLA 4C54A 5LGJB 1T1ZB 4MS8D 3IJYB 1A7BA 3UZEA 4XX1G 4YFLF 4CBPA 3QDGE 4XNMA 2Z92B 4OF0A 3PWVA 5CEZD 4MVBC 3SKJH 1OW0C 2KZWA 4UMGA 3MRRB 3T0EB 1UWGH 5HHVH 1IT9H 1YEFH 2RJMA 1JYNA 2VMFA 1MRDH 4N0FA 4Z7OE 5F88B 4JHWH 4XNXH 2CDEA 2R29H 3QUZD 4WTZA 1MCIA 3O6KL 1NMCC 3HG1D 3MJ8B 4UTBH 5D5MA 4BUGA 2IH3B 1AGCB 4U1JA 1TQBC 4PJ9D 2MOVA 4OCXL 5ILTL 3ZTNH 2CLRB 4JHAL 4GRMB 4PJ5B 1N6UA 5D9SB 3KPRD 4NM4L 3RZCA 1OCWL 5J12C 3KPSA 4OIIH 4UBDC 1JWUA 1EO8H 3IF1B 4ZO8A 5F1NA 4MNGA 5EU4A 1KFAL 3IU3A 5E94A 1K3ZA 4MGXA 3C2SA 5IHLB 5T1KA 3VFVB 5C2BL 4EIZC 1GGBH 3K80A 4KHTL 2AK4B 2Y5TA 3SJVD 3BDXA 1FIGH 3QEUA 5LAXA 3C08L 4N90D 2XRAH 4N8CH 3G6JA 3T8XA 1YMMB 3C5SA 2AJXL 3HMWH 1M71A 1SBSL 1FL5A 4F7TB 1YYML 3IDIB 3EBAA 4NCC2 4OZFA 4HX1A 1ZGLP 2YSSB 4LU5L 3KPQA 5EZOH 5FYKD 3MXVL 4QHUB 3VFWA 4RRPA 1HI6B 5I1JH 2AJVH 3O2DH 3UTSD 5KN5A 3QQ4B 3UO1L 3OHXA 5BV7L 4Y4KD 2WUBH 3GMPA 1J10A 4F9PC 1K6QH 1QSFE 4ONHA 1PG7X 4RGNC 4LLAA 3RWCB 3A6OA 1U8LB 5E08H 2HVJB 2Y9RT 5GSRB 3OB0H 2M2DA 4J23A 2VXVH 3Q0HA 3TA3C 3STLB 5DFVC 3VFSA 3MZGB 4LAQH 2A73B 1K4CA 3RDTC 4PIRF 5E2TH 5B8CC 5K93A 3PL6C 4W6WB 4HWZB 4OQTL 3WHXB 4P57A 2DLFL 3CFIC 3MLRL 1BJMA 4MCYB 3RVWC 2DDQH 3SO3C 4ETYA 2PN5A 4NSKB 1UXWA 4GW1B 4XC1L 3CZFB 3HI5H 4BK4A 1IAIM 5I75B 1IL1B 4JDVB 5F9OH 1WT5C 1A3QA 1QSEB 4QXUH 1VPOL 3OXSA 3F62A 3RGVB 1MAKA 3ORJA 4M48L 5IJKA 5F8QC 1BX2B 3QWRA 4RMVA 3WXWL 1ODAA 3JWDC 4MAUH 3V6BR 1PY4A 1DEDA 1KC5H 3CC5B 4KAQL 4HFUL 3DECA 2WBJC 1GXEA 4LVHB 2X70B 3INUH 3GJEA 2LV4A 3KJ4C 4ODBD 4WEMB 5FYKU 4K7FA 4U1NB 1T7VA 2OTPA 3P11H 5HHOA 4M7KH 5KSAA 4X5XB 4I18A 5FGSA 2DYPB 1N64H 4UNUA 4JM2A 1D7FA 4RQQA 3WLBA 1V3MA 4XWOC 1QFPA 2A6DB 4PFEA 3WEXA 3FQRB 4RDQF 2WP3O 5BV7C 3BE1H 2AKRA 1INDL 1MEXH 5ADPH 1XIWD 5DJCB 4JQVC 2QQQA 3IDJB 3SGEH 2AJSH 4K9EC 3MX0A 5D2LB 1KNOB 3HNTL 1K4DA 5CLWA 1DQTA 2JJVA 4JRYA 1CF8L 7FABH 4QTIH 1VB9A 2WMPA 1I3GL 2EDKA 3OGCA 1KELL 4UINL 4X0KB 2BVPB 4QNPF 5EU3A 1R3HA 5IB2A 4NHCL 2DQEH 1LHZA 1MH5A 5FO7B 4DGVH 4MA8H 3S3PA 5IROA 1UH4A 2EIBA 3K2MC 2VE6B 2ZNXA 3Q48A 1DQQB 1NBVH 1I3UA 3K2UL 1X3DA 3E3QC 4JZJB 3ARVA 2H32H 2FJGB 4NP4H 1ZLVK 2FX9L 5CJBA 2XZQH 3ETBF 4WWKD 2NY3B 4A6YB 4JEGB 1IAKA 1FLRL 2HJKB 4FQXC 4JFDE 1LNUB 1B4JL 5IQ7H 5IV2B 5F3BB 4WUUE 3AFLA 1F8TH 1BFVH 3G5VA 1I9EA 3VFNA 3MLVL 3R8QA 1J05A 3QUYB 4HGKC 4XXDB 3PP3K 4JGJA 1E4XH 5CJ5A 1JGEA 3G6AA 3MRIB 4R90L 3O81A 1F4XL 2CK0L 3T2NH 3RY6A 1RSFA 3TT3L 4F15B 2NY5H 1D6EA 3BH9B 3TH3T 3OAUL 1Y18B 2HFGH 3F6LA 1MFDL 1MJ8L 2DWEA 3HC4L 1KB5B 5GQBA 1JHKH 4OFVA 4ENED 3QHZH 4OZFG 2FDBP 1LP9E 2BSED 1TJIL 2RGSA 3JUZA 1S7UB 4YUEH 4ZFGH 4PRHA 2VKWA 5LJYH 5LQBH 4L8BB 3FMGL 2FEDD 3ZE1F 2XI9A 4LHUB 3W9DA 3NIGE 1P7KB 4Y7MA 4ISVA 4RRPG 2AI0L 1RZIB 2G75A 3CSGA 4FQCH 3NGBC 4Y5YC 4BELD 5DGRA 5EIVA 1IGJB 1ORSB 1R3LA 1BQHB 5DMJB 3LEXA 1QOKA 3QHFL 4U05A 3KPPB 3MJ7B 1DVFB 4S1DD 3CLEH 4KMLB 1S7WB 2P24B 1KCVL 3G5YB 3I85A 1HHHB 4NKQB 4TSBL 1JZ4A 4LGSB 4E42A 5SWZD 4W4OC 2PXYA 2UY6A 4M7ZC 4PJHE 4BFGA 3QPQD 2QSTA 1N2RB 2IAMD 4KU1A 5C6TH 3DRTB 1T3FA 5E9DB 1UQSB 2HT3C 3CFKB 2Z31C 4RAHA 2ESVE 2J2ZA 3DV4A 2H2SD 2OZ4A 4Z77A 2PYFB 4JM4H 4U1KA 1D5BB 3HR5A 4YWGL 4ZTPL 4CNIA 5L6YH 3MRMB 5TQ2L 1LDSA 1H3WM 4YXLH 4KI1A 4EI5B 1QO3B 2YC1B 1FL3A 3GK8L 4C56E 1U0QA 4YK4B 2R2EA 2VITA 4PGCB 5DC4B 5IM7A 4R97C 4KHXL 5GJSL 1FC1A 3SCMB 4Q2ZA 3EJYC 5BXFB 4WU7B 5BRZD 3WE6A 1HYSC 3U6RA 3D39A 2X9WA 3HUJE 1DR9A 2JIXD 3BP7A 2D7TL 2HKFL 4G9DA 5E8OA 4P46A 1J1OH 3TN0B 4AJ0A 4M4RA 4AZ8A 3KXFD 4ZDHB 2A83A 4L4TE 3F12A 5KSBA 5EN2A 1KJ2H 3D18A 2YBRB 3P4LA 3RBSA 2BJML 2VL4A 5DXWA 3SDYL 4APQD 1XF5B 4C83A 4DFIA 3RWJA 1NC2A 1IM3B 1XGPB 1CFNA 1IRAY 3PDDA 1UKQA 1WBXB 4LSTL 3ZTJH 2GAZA 3GSQA 2EDFA 2X40A 5C6PB 1U8NB 3MRLB 5AZ2L 3EOBA 2AAVA 2ZUVA 3X14A 1B3JA 2RR3A 3NCYP 1RIVH 3M17B 4QCIA 2I24N 1QR1B 1GZQB 4HDIB 3AY4A 1TCRB 3Q5YA 4NKMB 3GMNB 4JFDB 3E6FA 3QA3B 1QNZH 1JCKA 3OKKB 2AJZA 5J56B 1AI1H 4KDWA 4PRPE 5INCB 3RVVD 3IGAB 4UOW0 4JO3H 2R9HD 3BT2H 4YEFA 1F3JA 4RIRB 5C07B 1D6VL 1UVQB 4XRCA 3RA7L 4MD0B 2P42B 5I66A 1KLGA 4XP4H 4P49A 4XVUD 4RISH 4PRDA 4Z7OF 2BFVH 4NC0B 4AH2A 2LU7A 4XCEA 4BH7A 5D2LF 4CVXA 3OF6A 1U58A 3WNKA 3X12A 5E5RB 1MPAH 5H35A 5E2VH 4L29A 1AGBA 2VR5A 3NIFE 4QXGL 5T1LA 2D2OA 4X4ZA 3BW9A 3ARDC 2X5PA 3EFFB 4AL8H 4PJ8C 4ONFL 4W4NA 4O00A 2EDEA 5T5NF 3VD9A 1X5ZA 3V95A 3L3DA 4O2EA 2VH5H 2VLRE 1AXSB 1G7IB 4K3JH 3CMGA 3FFCA 1VGEL 3W0WA 3MTRA 4MJ6A 5F3HA 3QCUH 4RGMC 5KAQG 2COQA 4P2OA 5D71L 3MLXL 4NUJB 3FB6B 1RZKL 5JUEH 3KYAA 4PJHB 1HIMH 2EE2A 3DVGB 3NPZB 2J6EL 2Y72A 1A7QH 4G8IA 4G7VH 4DKAA 3PP4L 3BXNA 1MCPH 2HKHL 4Z7UA 3FQUA 1NKRA 5D96B 4BH8A 1R0AH 5IB1A 4HIEB 3O41A 2YMXL 3C6LC 1TZIA 4MJ5B 1OGTB 4L4VB 5EZLB 3NCCB 2BY2A 1QFWM 1I7ZA 3DXAB 1R5WB 2VAJA 5ANMA 4EVNB 1BREA 3RL2B 3B9DA 1DDHA 1FBIH 3WD5L 5I71C 4F8QA 3FQXA 1T04B 4ZXBA 1F00I 2HLFC 2V5MA 2DQUH 3S9DB 2C7UA 1JPSH 4Q9BA 3KJ6H 5HVGB 2C1OA 1M7IA 5GRYA 4DZBA 1JNLL 1P7QB 4LLDB 5IJVA 3HUJB 5CBAA 5C0JA 4PJEA 4PJDA 4U0RB 4XP9H 4FZ8L 1DBBL 1G1CA 4KDVA 5E24E 2I60L 4UQ3B 1LEIA 2XKNB 5E1AA 2EDXA 4OLWL 2Z35A 4L4TB 3OXRB 1B0RA 2LABA 32C2A 3QDMD 3GHEL 4WW2F 4PTTB 1RZJC 3QNXA 2QSCH 5ISZE 4FP8H 4PBXA 4RCAA 4H1LH 4KGJA 3HE6D 4POZD 4YAQA 4XAKD 2Q86B 2CIKB 5T3ZE 5ICZB 4NC1C 3O4LE 3L3JA 1A3RL 5GRXG 3DMMB 5AZEL 1CFVL 4FTVA 5F7UA 3FQTA 1LEKA 1H9VA 3QDJA 4FXKB 1M6OB 1F6AB 1QQDB 2OCFD 3NA9L 1MQ8A 3QDGD 1UEYA 1JRHH 4YBQC 3GGWB 5GJTL 1EA9C 1G9NL 2EC9T 1Q9WA 1H5BB 4LCWB 5D1QA 1U8PA 4RSVA 3MRNA 3S35X 4HUXA 4WV1A 3P9WB 3F7RA 3O9WD 4TSAH 1RZKC 1PJ9A 1OLZA 1CLZH 2WIIA 3EDJA 3DUUA 1JF5A 3MYJA 4KI5E 4XBEH 4PJGE 4Z18A 5GGRY 1Z9OA 3AVEA 5A2KH 4ONGL 1GC1L 3ECBB 5CS7A 4KK6C 2QQKL 1NGQL 1E28A 3OL2A 2NTFA 3KG5A 4NQEE 3CFBB 4JCMA 1U91B 1TPXC 4XVTL 2ED7A 2F8VA 4J8RB 4ZUSA 5E6ID 5TH2A 3QB7C 4DKFL 2I9TA 5EBMA 1KN4H 3U1SH 4IRSA 2PYEA 5IF0B 3GBMH 1EGJL 5MEQB 3T0DA 4HUVB 2FH6A 4U7MA 4I5BA 3WIHL 4XCCL 3UYPA 2W1NA 3OWEA 2V9QA 2QR0A 4M6OH 1J9CT 2Q76A 1XF3B 2Y36H 1A9EA 3OR6B 4PJIB 3MNVA 3DO7B 2EKSA 4OZ4A 3WHE1 4PGBA 5KVEH 1FO0H 1UT9A 5I1LA 3KVQA 1E27B 2IFFH 2BNRE 3TBWA 3O8XB 1NSNH 3U2SB 1QSFD 1ZSDB 5DJDA 4Q6IB 5I15H 3RZCC 5DRWA 2W0PA 4KRLB 3FFDB 3CDYA 1I1YB 1OTUD 4P5TB 5D7IE 1PEZA 4K2UH 2QADB 5MEOA 1VADA 1I85A 2R0KH 2CKBA 5MP6H 4IRJA 3ROOA 2NXZD 4TPRH 1OTSD 5E2WH 1MREL 4YHNB 4K3EL 3LZFH 2EXWC 4R4FH 4R4ND 4YR6A 2R56H 4WTXA 1RUML 2D9CA 5I1EH 3PJSB 1Z9LA 4BQ6A 1LP9F 4XHJC 4U6YB 1NL0L 3QIWB 1Z9MA 4MSWB 3BQUA 2VLJB 3BGAA 12E8H 3NIGF 4WU5B 2NX5B 4AIZB 1G84A 4YX2H 3DO3A 1N5YH 4FXGA 4QRSB 2R1XA 2PETA 1ITBB 3MNWA 4K71B 1Q9OA 4XAWH 5HGBA 1CD8A 3EFDL 4YHYB 1J7VR 4QWWC 4MXWL 2DLGA 2R1YA 2AEPL 1IFHH 4KKLD 4PV9B 3V0VA 5JR1L 4H88H 1T20B 1CGWA 2DTMH 3D5OF 5HYJE 1AIFB 4MJIE 5HGGS 3KYMB 1TITA 3VXMA 4J3TA 4PJHF 4L8DB 5D7SL 5FV1L 1MJ7H 3O4LB 3N1QC 4N0YH 3BKML 3BP5A 4LBEA 3E2HB 5JW3L 1D9KB 2HAZA 4ZQKA 4H26A 1AQDB 4Y89A 5JIPA 4NO2A 3O3EB 4P99A 3VXRE 2WQRA 1RAMA 4LSSH 4BSVA 1DFBH 4EDXB 3WDIA 4Q0XH 5GRUL 3VJ6B 3P9LB 4HT1H 2J5LC 4WI9A 4NZDA 4X7SH 2JTDA 3CUPB 3JXAA 4V2CB 4KVNH 1FSKB 3EO1A 3UJTH 3C5JA 3EYVA 4R4BB 4KUCF 2OJZL 5GGQL 3LKQB 2DLIA 4F58H 3NIDE 3F5WA 5F71A 3NFPB 4LF3B 2FX8H 2FCBA 4S1SL 5DR5L 1SM3H 4KQ4H 5IJKC 3ARBB 1HQ4B 4X6EB 4GOSA 1OAUL 4ODSH 2EDWA 2NY4B 2O5YL 4OZGE 3HUJF 4UI2A 3REVA 3U48A 4ZTOL 3I84A 4GMTL 3SE8H 1AE6H 4N0CD 3QHTC 3VFRB 3K1DA 4XBPA 3SE4C 1PEWA 2V7NB 4TNVF 3A6BL 4ZAKA 4KTYA 1IMHC 3FO1A 1E4WL 4XPBL 5JZ7D 4MJ4A 4PUBH 2IALA 4NJ9L 5DSCA 2NY6C 5ITBL 5D1XB 3VXUE 5KSAC 3IS0X 4I18C 2I5YL 4P23A 1F5WA 2NW3A 1SJHB 3NA4A 5KSUA 1XR8B 4JM2C 3REWA 1SJEA 3EO0B 4XBGA 4KZEL 4XPFL 5C0CB 3FT4B 4ZS7L 2R15A 4WUUD 1JGDB 4HUKB 3MLWL 4F7CA 5HHQA 3AREB 3RGHA 3C9NB 5IB4B 1NCDH 1EHLH 1KLUA 4IHOB 1KEGL 4JO1L 1AKJA 3C6SB 1OVZA 4JRWA 1BD2E 1F11A 1MUJB 3S8WA 3L5WB 1NCAL 2P5ED 1R3JB 2G5RA 3WN5A 2BNRB 4UQ2B 3KYOA 2AV1B 2ADIA 5FYLL 5E1HB 4F2MB 1Z2KA 4KROC 4LPTA 4LARL 4OSUL 1XGUB 2Z8WC 1KGCE 4IDLA 4PGEA 4I0PB 5DRZB 1KG0B 3KLHC 5GGRB 4FQ2L 5IROC 2H6PA 4WHYH 1R24A 2ENYA 3VI4E 1G6RA 4GW5A 3MROB 1NAKH 1CDYA 1T5XB 1QTYT 3MRQA 1RIHH 3U30B 3VXOA 3MRPB 1V7ML 1JP5A 2AK1H 5BS0A 5BVPH 1J5OH 1I7RA 2IQ9H 5C0RH 3LKRB 1PSKL 2VDKL 4YFEA 4Q9QL 4Y5XA 1NCBH 2O61B 3E1F1 3B5HA 4JKWA 3S37X 1NEZG 3EGSB 3NIFF 1BZ7A 4FFWD 2BVOA 2D7QA 3RY6C 4D0DB 2Q7YA 4P5KB 1A3LH 3ILQD 4E0RB 1BOGA 1CICD 1P4LB 1YECH 2OJEB 5B38B 2ESVD 2ZJSH 1G0XA 4PJIF 1KIQA 4GRLD 5ETUA 2NY1C 5JORB 1SMOA 4FG6C 3KLDA 4Z7VE 1VDGA 4E41E 5L2JB 3QUZA 3TNNB 3VWJD 4NRYA 2EXYD 1J8HB 2DQCL 3VDCA 3HG1A 4A6YL 4S0TD 1HILA 3PWPE 4PJ9A 5EPMB 4C56D 5F44A 3NH7L 3KPLA 4HZAA 3KPRA 2N7BA 2R2HA 1SBBA 1MHPL 2YD6A 2J4WH 3UTTD 4ODHH 3NCMA 4XVJL 2MHAA 3ZDZF 2DOCA 2XYCA 3CDGB 3NPSC 3O6FD 3MA7B 4RFEB 3KPMB 4LP5A 3SJVA 3MA9H 1KF9B 5IMLB 3WNNA 5IGXH 3FRUA 1KB5L 3GSXA 2PXYC 4KXZI 5TE7H 1Y0LB 1N8ZA 4RBPK 4EOWL 1K9TA 4K55A 2DIAA 4GRWH 4HBQA 4M93C 2ENSA 3BYTA 4OT1L 1LDPL 1HXYA 1K5NA 2IPTH 5HVHB 5E99L 3WFHB 4EDWH 1RQ5A 5IFHL 2YPLD 2LAGB 2BSSB 4XCNA 4LNVA 4JQIL 4CVZB 1YPZB 1DN0A 5INDA 5I74C 3T2PA 1XF2A 1VGKA 4GS7C 3UTSA 1HXMA 4DAGL 1TTFA 3VXNB 4GH7B 1T03L 1IKNA 1J0IA 3B5GA 5IBUG 3MLYH 3CFDB 4WW1A 3SKUD 1YNTB 2ID5A 2PTTA 1IGML 2EE9A 5HI4C 3UBXB 1VFAA 3JV6A 3U0PA 1MCEA 4ODTL 2NW2A 4PRPD 4PP1C 3L1OH 3OV6A 1UM5L 3BMWA 4P46C 3MOQA 1N3NB 1FYHB 4QEGA 1FFQA 5GGSY 1GRWA 4RA3A 3WKMH 2E5EA 2VO5A 1J11A 4OCSH 1BD2B 4KJQD 4LLVA 5D1ZB 1P6AB 4AG4H 1CS6A 3T65B 3H2WA 3WYRA 3T04D 1UGNA 4NNPH 3FTGA 2ZSWB 5GGVH 5C08A 1JHLL 4LIQH 3MRHB 1ZLSL 4X80H 2K7QA 3QRGL 4OCRL 3PWLA 5E2JA 3WS3A 2VLKA 4PJGF 4TSCH 4GAGL 5DD1H 1IZJA 2VDPL 4ZSOA 4X6FA 4KKAC 1FVCA 1QLEL 3HNSH 3FAWA 4KRPB 3AY4C 4MD5A 5ALCL 2R8SL 2HFEB 2LAAA 2VLRD 2XXMB 4XGZB 5I76B 1X5HA 1MRFL 1J1XL 1KJ2B 1UA6L 5I8KL 5DJ8B 4H25A 1T21A 2R0WL 2EC8A 4XMKH 2R2BB 5H2BB 4R7DB 2DJSA 3EZJB 4IIQA 1BOYA 5IEHA 4BKLA 2CSPA 3NCEB 4KY1L 3IFPA 3HMXH 1S7VB 5M95B 1N26A 3HI6H 3WBDA 4OUUA 4YIQB 1KJVB 1TJHH 4LNRB 3BIBX 5J1AA 4NKDA 4Z7VB 3TIDB 1B4RA 4RFOL 2A38A 5E2UH 4YE4L 2Q8BH 2C5DC 1A9BA 4ZNEE 3MRJB 3RU8H 4KTEL 3FO9A 2P5WE 5IR1A 1S7QA 1U2HA 3MV8A 3U0WL 4U1GB 2VN7A 5D7IF 3SKMA 3QYCA 1CTNA 3SDDB 4F3FB 1E6JL 4HF5L 4GKNA 3LQZB 1Q38A 4KMQA 4NUGL 5I18L 1ZHKB 4JO4L 3JTSA 3UPAA 4RWYL 4WNQB 2A6KB 4ELKB 5DJ6B 4DK3A 2AV7A 2F54E 4N9GB 4PPTA 2Y07H 3GO1L 4XMLL 3BIKA 4ODWB 4WWKA 1URLA 1ZEAL 1LO0H 4MX7B 5ISZD 3CJJA 4XNZC 1ZTXH 3X3GL 4PR5B 2UWEE 3GSUB 5T3ZD 3VH8B 2VXUH 3V6OC 2YPVH 4JZNA 1CL7L 2HG5B 4WGVB 1MFBL 4KPHL 4ZFZA 1FORH 4U6VL 4X83A 3BUTA 3PABB 3HC3H 1T66C 2VSCA 2G2RB 2ZUUA 3IFLH 4M6MH 3FHQA 5HYQB 1W72A 3DGGB 1FC2D 2F58L 5JHDE 4ZXBC 3LKSA 2FATH 2F8OA 4X98B 4M1CD 35C8H 2JB6B 4I2XE 3TIEB 2GUOA 3DLQR 4RWHA 3WS6A 2XWBA 3R06A 5J13C 3C2AL 4HK3J 2OXGA 1RZGA 3BRGC 3CFJB 1J0YA 5GS0C 4KI5D 5D7LE 3NABL 5I1AA 5FM4A 5FCUL 1BZ9B 1SJVA 2GTWA 5FKPA 1FFPB 5IMKB 5JXEC 2B1HL 3M45A 4DVBA 5IB3A 2APVA 1WC7B 2XV6B 1G9ML 3MRFB 4DN4L 5L8JB 4NQED 4HFWB 2Q87A 1YJDC 2NCMA 4U1IA 1BJ1J 3WFEL 5DFTA 1KPVB 1R5IB 5SWZA 2AXHA 3KYKH 3MRKB 1UYWL 3NIDF 1A6UH 4JRXE 2A9NL 2UZIH 4G6MH 4Z78B 5HHPA 2IAMA 2ZNWA 4NGHH 1WSST 3BZEB 4OZGF 3MLTA 2BDNH 5HD8D 5L2KE 4UV4H 4K7PX 5D1QC 5T3XE 5JQ6L 5ID1B 1GIGH 4YGVA 4KVCH 1IGIL 5DDHB 3RWHB 1VEOA 2GTZA 5EO1A 1FZOA 4M43H 2FIRT 3ULVE 2ICWA 4OB5L 3Q3GA 2VABA 3RVUD 4L3EE 4QGTA 4RGOH 1F4HA 4JFEE 1LE9A 4YZFE 4H1LB 4LEXH 4U6HB 3QUKA 3B6SB 3VXPB 1X5AA 1CGTA 4V1DB 5D7KE 5GZNC 4JAMB 4HBCH 4P2RE 5GGSB 3MCG1 2JIXA 2KKQA 4I4WA 5JLZA 4G80B 5CEYA 2VSDA 3VFTB 4TUOB 3KXFA 1S3KL 3O11B 2C26A 5EIIA 5GSVA 4K8RL 4IRSC 4LKXB 3ZT5A 1S7SB 3C09C 3VI3E 3BPNB 3D85B 4APQA 1CR9H 1DQJB 5K59E 1QVOA 4BFIA 1A5FL 4TTGA 1TVDA 1PZ5B 4IS6B 1IKFH 1NLBH 2QHLA 5J11B 1RJCA 1I9JH 1WBZB 3VI4F 1A7RL 4FZEL 1KEML 2B5IB