1KJMB

Tap-a-associated rat mhc class i molecule
Total Genus 13
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
13
sequence length
99
structure length
99
Chain Sequence
IQKTPQIQVYSRHPPENGKPNFLNCYVSQFHPPQIEIELLKNGKKIPNIEMSDLSFSKDWSFYILAHTEFTPTETDVYACRVKHVTLKEPKTVTWDRDM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Immune system
molecule keywords RT1 class I histocompatibility antigen, AA alpha chain, heav
publication title Crystal structures of two rat MHC class Ia (RT1-A) molecules that are associated differentially with peptide transporter alleles TAP-A and TAP-B.
pubmed doi rcsb
source organism Rattus norvegicus
total genus 13
structure length 99
sequence length 99
ec nomenclature
pdb deposition date 2001-12-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1kjmB00
2OL3H 2R8SL 2CKBL 4JFXA 5IHUL 3SE3C 1JPST 2VL5A 2ICCA 4HC1H 1BBJA 1MCWW 4KPHL 2VKWA 5JOFA 5CJBA 3QWOB 1CR9H 2HKHH 5DDHA 1BF2A 4AH2B 1A6ZA 4X6CE 3G6JA 1DBML 4D0CB 5FYJU 3UDWC 3P77B 3KPSA 4JG1H 4U1IA 5IFJA 1IEAA 4RISL 4IRSD 1YNTA 2ZPKL 4TULL 4NN5B 2XNAB 5EULV 5T5FL 4JGUA 1L7TH 1WFTA 5DRXA 3WFDH 2GJJA 1BLNB 3WFZA 4CVXB 2A1WH 3ZTJG 3MBEA 4EKXA 3BZ4A 3DV6A 1P1ZA 5ESQB 4CU6A 5I73B 2YPLA 1IAII 3GSNB 4Y16B 1IGCH 3NH7L 3QJFB 2ENYA 4R7NB 1LO4L 4HBQA 1YN7A 1C5DB 4ENEC 1JZ6A 2X4NA 1YYMH 3OF6A 5EZLA 5B39A 5CEXA 4NZRH 4Q0XH 4C4KT 1W8NA 5I30L 2CLRB 3P4MA 4PJXB 1OD9A 4XPBH 1UM4H 5D8JH 4JQXC 1AKJA 4KROC 4BFIA 1AD0A 5FGCE 2BY2A 2DS4A 4HCRA 1G0YR 1XF4A 3QWRA 4N8CL 3PWNA 1JHTB 3QUZD 4ZO9A 4Y4HA 4PJHF 3L1OH 5E8NB 1NLDL 4JDTH 1LE5A 4TUJA 3WLWC 1F6AB 1ETZB 1QTYT 2MPAH 3D48R 5HXMA 1EAJA 4KVNL 3BRGC 2FR4A 1MOEA 3F65A 4ZS7L 4OGYL 2EO9A 3MNWA 4K3JH 1RK1A 4DGVL 4GAJL 2BCKA 2ATKA 2Y7QA 4CMMA 3R0NA 4O00A 1FL3A 4KKBC 1YA5A 1FNEB 4DUXA 1T3FA 1M05B 4NRZB 4PJFF 3VXNA 4L8SA 4U1SA 4KK6D 4HBCH 3G04A 1KNOB 1WFOA 4Y4FC 3I3DA 2XZCL 4JHAL 4LPTA 5DRNA 4J6RH 3JV6A 4WHDA 5KSAC 4KHTH 2BMKA 5AEAA 3CPLB 5T3XL 5C70A 3L3GB 2BHUA 2EZ0C 3MOAL 4HUWB 3CFBA 1JNNL 3U4BH 5JHDE 1AJ7H 4HPYL 1YEGL 3HE6A 3BYYA 4L4TD 3DUUA 1NMCB 5DI8A 3KR3L 3MCLH 2AABL 3VXPB 5DYOA 4IDJH 1Q9KB 4GG6F 4OCWH 2YD7A 1KPUB 1IKFL 3QDJE 4Q6YA 1F6FB 4I3RL 3ARFA 4PV8A 3C5JA 4PB9L 4LHUG 4NKOA 2WUCL 4APQD 2C3WA 4AIOA 2B5IB 1AXSA 1T89A 2UZYB 3KWWB 1KCLA 1J86A 4HF5H 1D6VH 1F4XH 1FZOA 1V7NH 2VAAA 4PJ7F 2V5SA 5IR1B 2V7NB 3BP5B 4P2QD 5E7FA 3MREB 4IIQB 4QXTA 5I8OH 1ZT1A 2ZP0T 3V0VB 3ZT6A 4WCYL 1KCRH 3BKJH 3HUJE 5I0ZA 3EBAA 1BVZA 1MLCB 1Q9LA 3H2WA 3JWDH 2XTJE 5D7LD 4X7SL 4XGZA 3U7AA 3NIFF 2H3NA 4O58L 3Q3GA 1HHGB 3T2QA 3WJLA 4P5MA 2E7LC 4HS8H 1T22B 3OG6B 4OFDA 1OQOA 5IJKA 3TNNB 1CL7L 3RPIA 4XPAL 4C56E 2HT3D 1J5OL 4WU7B 4YXLH 1G9NH 4WTWA 5T1DL 1LP9F 2Y6SC 2DJ4A 2AK4E 3GO1H 5AYUH 3FQXB 2J88H 4FQ2L 1UYWL 4WW1B 4KJYB 1XGUB 4L3AA 3NZ8A 1CZ8L 5E8DH 3TO4C 3RIAF 2XPGA 4PP1D 4IOIB 4XP4H 3TZVC 4MJ5A 4UIMA 2NPLX 2R8SH 4UUJA 2CKBH 5IHUH 3P0VL 5EUOF 1NC4B 4OCYL 5DEGA 1L0QA 2CPCA 5F3HB 4PRAA 4KPHH 2QADB 4PJDA 5EZIL 1UACL 4JJ5A 4LEXL 1RPQA 2X5PA 3LKPA 3VFMB 1D3CA 2UVFA 3IRZA 1RD6A 4MX7B 5KSBF 3D0VB 3VW3L 2Q7YB 4JY4A 3A67L 5CJOL 1DBMH 2OZ4H 1RIVL 4MAYB 5DQ9A 1DJSA 2ZNWA 4JZJC 5DMKB 2A9ML 5FYKE 2GK0A 2IANE 1RZIB 3I3EA 4RISH 5D1QC 1YPZE 4LAQL 2ZPKH 4TULH 3D18B 4PLJD 5J7CC 3O3DA 3TVMC 5TDNA 3U83A 1P9MA 3DUHA 4I77H 3NPSC 5FUCE 4HIXL 4Q97A 5C0CE 4XH2A 1YQ2A 4G8GE 2NY0B 1D9KC 5DK2A 2EKSB 3A6BL 3WKML 1RJZA 1J8HD 5HDLA 5DQDL 4M9OA 5IEHA 4RMSA 1WCBA 3NH7H 4GRWH 5C9KA 1A1NA 4JKPL 1E28B 3BHBA 1RFDH 5IMKA 1BFTA 3FB8A 5ACZA 1LE9B 3VGBA 1KB9K 5I30H 3GSWA 4RDQF 5ERWA 4LLVA 4KI5F 4X6BB 2P45B 2LU3A 3D69A 4P4KA 5KTEL 3DSNA 5SV4A 4PJIB 4P3CL 4NOBA 4N8CH 4V1DD 1RULH 3IAGC 1TETL 1XGYL 5BRZA 3BEWB 3BX7C 3MFGB 4OZ4B 1FO0L 1KYOJ 1TQCB 2BHZA 2OTPA 2QKIB 4J3VA 5DD6B 5JPMA 1VESA 5B4MC 5T1KB 1MH5B 3BUYA 4XNQA 4ZS7H 3BDYL 4R97B 4OGYH 2FB4L 4X6DE 4P46A 3X11B 1UA6H 3OKEA 4L3EE 3PL6D 3HNTL 4OCRL 3EZ8A 2F5AH 3PQYB 4GAJH 5IB3B 4Z95L 2M2DA 3QEQD 4R0LC 4HPOH 1MWAL 4DZBB 4H0HB 3S37X 2DDQL 2CLVB 2C1OB 5DMJB 4EOWL 1KJ2H 2OJZL 1HNGA 4M03A 5I66A 1JBJA 1FNSL 2ARWA 2GSIA 5IVXA 2WINA 5T3XH 3AY4A 5TFSL 4JY6A 3QQ9D 4KAQH 4GXVH 5HGAA 4F7CA 4HPYH 4YHNB 4XP6L 5DUPH 4Y0GA 1P6FA 4PJHA 1WUNT 1CVSC 5JDSA 1IGFL 3KR3H 1N59B 2AABH 4XBPB 3RDTA 3EO0B 3GHEL 4Y19B 1J05A 2P46B 2QHRL 1IKFH 5CHNA 1HYSC 5F7MC 4I3RH 2VXTL 3RWCB 3PGFL 3P9MA 1DQJB 5A16B 4JR9L 3U7WL 4PB9H 2VSCA 2MSPA 2WUCH 4NZUL 5J6HA 2UZIL 4JY5L 4CJ1A 2E3VA 3V6OE 4LMQI 1I7UA 3G6AB 4PJBF 1A02N 2D7TL 3FT4A 3UTSE 3STBA 3HC0A 4ZS6C 4GOSA 4BUHA 2F19L 1EK3A 1DQTA 4FZ8L 4N8VA 5JXEC 5IQ7H 2ADIB 5F89A 4WRLA 5J56B 2P5WB 3GRWL 3KYNB 1NGXB 1FNHA 1XGQA 3JWOL 1QG3A 4WCYH 3VXTA 3V5HB 1RMFL 1FIGH 2NY1C 1W0WB 3ZKXB 3QI9A 4FFVC 4BFEA 3V9FA 2D03L 3T0BA 1NC2B 3H7LA 3BGFB 4S1DC 4X7SH 1RSFA 1ZMYA 1A6TA 1TLKA 4W4NA 2Z4QB 1RK0A 3C60A 4OGXL 5K59E 4QXWA 3O41A 3O4LD 4M1CC 1CL7H 3I6LD 5K33A 2CKBA 4NQSB 2R2EB 4XPAH 3AM8C 3DROB 3IDUA 4H0IA 1HHIB 3NCBB 1J5OH 1I7RA 3QFJB 5T1DH 4LCWE 4PJ7A 1BZ9A 1OT1A 4FQ2H 1AHWA 4P3DA 1UYWH 5GGUA 1OSPH 2X40A 1CZ8H 2ZUSA 1SJHB 5MERB 1J0YA 1U42A 5F9JA 5I74C 5SWZA 2EDNA 2IBGA 4X6FB 4PLOB 3S36L 2WK2A 1IZKA 3P0VH 2ED9A 3AREA 4P23B 1KCUL 3HCVA 4N9OB 4JE4B 5EZIH 4U6HA 1UACH 2A73B 4LEXH 2XKUA 4WV1C 4Y5XB 2HG5A 2ZUYA 3R1GL 2RAMA 3L3IA 3B83A 1M1SA 2O5YL 3VW3H 2H32B 3CFDB 2AXJA 3V2AR 1NCDL 4LPWA 4FN0A 4HKBB 5GZND 3LDBC 2A9MH 3L5XL 1HWGB 4U0QB 3PABB 4BSWB 4NM4L 5BJTB 2EYTA 5ETUB 3CLFL 1LP9A 2XT1B 4HIXH 4X5XA 4QLRA 3E2HC 2Z92B 5DQDH 3V4UL 4EQ2A 4JFOA 3VI3E 1T1YB 1IGIL 5HDBF 1JPGB 1N5YH 3CSYA 4JKPH 4G6ML 3OKMA 5F1KC 1A5FL 3ARXA 2VLRE 3NMEA 3MRCB 4FXGB 5CJXC 1NC4D 4DW2L 4FTVB 3RVTD 5KSBA 3SCMB 2BOBB 2QADD 2QQLH 3ARBB 5KTEH 2M26A 3WNNA 4LOUD 4L5FL 3UTTB 1OP9A 1XGYH 1N64L 1A1OA 4I0CC 1UWGH 4XAKD 4Z7QE 5JOPD 4P2CG 1I7ZB 5FDWA 1BFVL 1IAMA 3B2VH 2A74A 2W65A 3DNKA 5ALBL 1HXMA 2DQFB 3X12A 2J2ZA 4JAMA 3SGJA 3SO3B 2YA1A 2OTUB 3HNTH 4OCRH 4Z95H 1QHPA 3HG1D 4QHUB 4LSUL 5DEFB 5F88A 2P24A 1MCEA 2FSEA 3O2WH 4PGBA 1NFIA 2NY0D 4DEPB 5DUBB 4H25A 3EYOB 5LGKA 2DDQH 1WIUA 4LKCB 4EOWH 2OJZH 3C9NB 2HFTA 4NBYB 1AQDB 2J8UE 2VN4A 1FNSH 1BD2B 1LO5B 5E94B 5TFSH 3VCLA 5F96L 1KELL 1G7HA 1S7TB 4OKVA 5I1DB 3GSNL 2BY0A 1JRHL 4LCYA 3EOBA 4WW2B 1CGVA 4XP6H 4JN2B 1DLHB 5C0BB 1IGFH 1G7PA 2A6KB 3E3QE 3GHEH 4RAUA 1A47A 4TUOB 2HJFB 3Q6FA 2Y25A 4HK0A 3MOQA 3GKWL 5J11C 2VXTH 4OCXL 1U93A 3PGFH 4ZXBA 4YO0B 4OLWH 4JR9H 3HC4L 3MRGB 1MRCL 5FM5M 1MI5B 3QQ4A 5GIRB 2GTZB 4NO2A 3LEYL 4NZUH 5T1KD 4OM1L 4PRHE 4XZUA 1FZJA 1D5MA 5C08E 4J1UA 2I24N 1GYAA 5I9QB 1VEPA 4GS7C 4WO4B 1T20A 3PQYD 5ESAB 3UJTL 4IRJD 3N1MC 2JCCE 4FZ8H 2HRPH 3GUTA 3GRWH 2HT3C 3JWOH 2NY5C 5FYKU 1H8OA 1B9ZA 5GZOC 2VITA 1RMFH 1P6AB 4UQ3B 3HKFA 2NZIA 4OZIE 1FP5A 5EU4A 3HZVB 5H37H 4L4VB 1A6AB 3VFUB 4PP1C 4Q9RL 4K9EL 1H3UA 5CLWA 3MLVL 4LNVA 3LCYA 1RURL 1RVFL 4TSBH 1ZLVK 4QOKE 4WY7L 4OGXH 4FS0A 3WMSA 1ZT4A 1NMAL 3P0YL 2PETA 4TTDD 4Y19D 3B2UC 5ESVA 3GJEB 1JFQL 4NN6C 4DAGL 2JF1A 3TH4T 4JFEE 1MELA 4TNWK 4EJ1C 5JDJA 5M94B 2HVKA 4XVUC 3QJHA 5I17B 4LHQB 2XWBB 3CJJA 5E99H 1F11A 3WHXA 5JNYA 1JL8A 2N7AA 5JW4Q 1S3KH 4XVJL 4J4PD 2ZUVA 1NDMB 2IG2L 2NW2B 3S36H 2E7MA 1TZHB 4MNGA 1KCUH 3KLAA 1FORL 4U6XB 2P5WD 4M7JL 1RZ7L 1DBBL 3R1GH 3ME0A 4RIRB 4JM2D 3PHSA 5DTFA 2O5YH 4KZDL 4J3WA 1A6WH 5I2IA 4Z5RB 4QO1A 3QFDA 1NC2D 3MV7B 1QQDA 2QL1A 2IAMB 4B5EA 4EUPG 2OTWA 2RBLA 3L5XH 2YRLA 4YHMH 4P57B 3VFPB 1W0VB 4G43B 4FABL 3FFDA 5B38B 3CLFH 2XA8L 4NSKA 1HIML 4NCDA 3U36A 4NQXB 4NBZB 1G6RB 4MB4A 3IAPA 3QFJD 1A4KA 1MF2L 2BSTA 4YBLB 1WC7A 2GAZB 1FIEA 4N0YL 1IGIH 1PY9A 1QSFA 4G6MH 5JLZB 2XQBL 2WANA 1J7VR 2MTPA 3PL6C 3K0WA 1FO0A 4YDJA 1A5FH 1I9RL 1KFAH 1N0XH 4KDTA 4PJXF 4DW2H 1XIWC 5F1NA 3GMMB 4DQOL 2IF7A 2ED8A 3BAEL 4ZD3L 3QIWA 1X5HA 3IU3B 2FJHA 5C09A 1N64H 2R1XA 1B0WA 4MHHI 3U46A 1MWAA 2DKSA 4JPWL 4WFFD 1XCTB 1X5IA 1BFVH 3T0VA 4Y89A 4ALAL 4JVWA 3JV0A 4NQCD 1LVEA 1EDQA 1EA9C 1R3KA 4UOJA 4Y2OA 4P4RB 1CD8A 4AYFA 5JIIA 4LSUH 4WEMB 1ZGLA 2ICES 2G60L 3PV6A 1INQA 3BE1L 4PTTA 2PXYB 4G6AD 1KG0A 4HJJH 2ADGB 1KGCD 1BVLB 3ZYZA 1EH9A 1J9CT 2DYPD 1HSAB 3ZYJA 3DVFA 3EW3B 1UKQA 2X41A 2BNQE 3IDJB 4KDVA 1FZMB 3NZHL 3WL9B 1NAKH 2ADJB 1KELH 2HLFC 5F96H 5BS0B 2W9DL 1PDKA 2JJWA 2B4CL 3GSNH 4JO4L 4N90D 1DR9A 4XT1C 1JRHH 1OAUH 2H9GA 4JQVA 1INEL 2N4IA 1U36A 1FFPB 2YD1A 3QNYB 5SWSB 4FTVD 4XB7A 4I2XB 4Q6IA 2E9BA 3B5HA 3UBXA 3OTTA 3MUZ1 3HE7C 4BQCA 5A43C 3UTTD 3CVHH 4NNXA 3VFWB 5F9OL 3U48A 1Q9OB 3GKWH 4MDJA 4OCXH 5L8KB 3GRWA 5FA3B 3HC4H 1MRCH 5KVFL 4LPVA 2HFEA 4P2QA 3LEYH 3R0MA 4OM1H 4H26B 2L7JA 4OUOA 3X3FL 1VGKA 4MA3B 1X7QB 1RZGA 1LNUB 5E8EB 1WTLA 3U0WH 1K6QH 2CDFB 4GO6B 1RZKH 3A6CL 4YAQB 3UJTH 5EU5A 1BJ1J 4KXZI 3U7YL 1U3HD 4PJ5B 4TYUA 1CDYA 1DSFL 3P4NA 5TJWK 3NGBB 1MAJA 4FQ1L 1S7RB 1CGWA 2VNCA 3QDGA 1T1XA 1UB6A 3ZDZF 4F9LA 4OZFB 1A0QH 1BD2D 4XP9L 1FFOB 1G9EA 1DCLA 2EDTA 2R0WL 3MLVH 5BQ7B 4RWYL 4QT5B 1RVFH 3MPCA 3SY0A 3HMXL 1CFQA 4WY7H 1KUMA 1BWWA 4G6JL 4P5KA 3GIVB 1UQSA 4N0CD 2H2PD 2K7QA 3BMVA 3G5VB 5C0BD 3P0YH 1F8TH 4AIZB 1QSEE 1UGNA 1X4ZA 4DAGH 3O9WC 2EE2A 1FGVL 1XH3B 2V2WB 3O4OB 3WHE0 1UM6H 4HK3N 1KT2A 5GZNC 3VJ6A 5CUSH 3M8OL 4LEOB 1QFOA 3MJ8B 1EEUA 2DQUH 1ONQB 2GI7A 4WO4D 4QNPE 3QUYA 2HJKA 5D71L 4KU1A 1WVZA 2B7DT 4PGCA 4S0SD 1FORH 1ZWIA 5KVEL 4Z7WE 2YC1B 5IV2B 1JPSL 4U1GC 3JXAA 2A6IB 1CLCA 1N2RB 3VRIB 4KZDH 1FBIL 3VXUA 4HGWB 3U9UB 3BPNB 4L4VD 2MJWA 5D2NC 4IOFD 3MJ7A 1YJDC 3KDMA 2KQNA 2ESVD 1XF1A 1F2QA 4JQIL 4FABH 3RBGA 2LVCA 3B9EA 4G9DB 1A22B 3DRQB 3VGAB 3RUGB 2FL5B 1UWEL 1HOCB 4X0KB 3U1SL 5FOBB 4MB5A 4XVSL 3AB0C 1MF2H 2MKLC 1WZMA 4N0YH 3K8LA 4BQ8A 3SGEH 2XQBH 4UI2A 1VB9A 1I9RH 1XMWA 4MQ7B 3IS0X 4XPHL 3QWOA 4V1DA 1KV3A 3MRNB 5D7KD 3ZDXF 4CN1A 3EO1B 5B3JE 2HJLB 4Y4HC 4AH2A 4DQOH 1CXLA 3S34H 4MXQD 4D0CA 3BAEH 4ZD3H 4PJIF 4OTXL 4EDWL 5A2LH 4H8WC 1JF1B 1OCWH 4XMKL 2XNAA 4P9HC 3QNZB 1EHLL 4F7TB 3DV4B 2WV3A 3MV7D 1BLNA 2IAMD 4CVXA 1I3GL 5CBEB 1A7QL 4POZD 1Y18B 3IXAB 5ESQA 2H6PB 2FLRT 3BH8B 4FA8A 5I15L 2UWEF 3VXSE 2GY7B 4P2RE 3OBAA 3GSNA 1G9MC 4Y16A 3T08A 2C4FU 4GJTB 3QJFA 3BE1H 5FKPB 4R7NA 1WCQA 1C5DA 4NCC1 2YMXH 3PV7A 2CLRA 2BRQA 4PJXA 3REVB 5CJ8A 1K9TA 3HE6C 4YHZH 3NZHH 1KF9B 2OS7A 3FN0H 2B4CH 4OD1L 4KRMB 4ETQB 3DSFH 2APWA 4YDIH 1INEH 2D7MA 3RNQB 4M9PA 1JHTA 2WBKA 5E8NA 3RWFB 3QPQD 3SDAB 3GSXB 3NOIA 5JUEL 4ZUWA 3X13B 1F6AA 2F58H 2DI9A 3TT1L 4BZ1L 4UINH 5F9OH 5GRWA 5F7EL 4BQ9A 1K4CB 3OB0H 1T89C 3S5LB 1J1OL 2P4AB 5BXFB 3QIBD 1FYTE 1P4IL 1A7RL 3SKMB 3SDYL 5D5MF 4CNIB 5BVPL 1FNEA 2OMBA 1M05A 4NRZA 4G8EB 5HHXH 4U6VH 4XNUL 3A6CH 3GIZH 4YEEA 1KNOA 4UOW1 4XWGL 2NTFB 4U3XA 4LVOC 2APBA 4KRNA 3CPLA 3KXFE 4WIQA 1DSFH 3L3GA 5F71A 4H1LG 2YZ8A 4HUWA 4FQ1H 4XP9H 3WIIL 2H26B 2R0WH 4RWYH 5DHYB 1OTUC 2V2TA 5JIHA 1Q9KA 3QCTL 5C9JB 1KPUA 4K3HA 4P49A 5IJKC 1AE6L 4FFWC 3B8YA 4O02L 4AG4H 3S4SG 3CDGB 5DJ8B 1MJ8L 3GMLB 1FGVH 4GKNB 3KWWA 4IRZL 1PGRB 2GY5A 4HD9A 5IR1A 4KZEH 2V7NA 3BP5A 3H3PL 3MREA 4IIQA 3M8OH 3HS0B 2YD8A 5GRUL 4AJ0A 3V0VA 2PN5A 1NFDE 3ARZA 3F58H 5DT1H 3QXUA 5JMOC 5EFIB 1MLCA 3IYLW 4KY1L 1X6LA 4GBXC 2BHYA 4PJ5D 1JPSH 5IIEB 4WU5B 4R26L 2IADB 1FBIH 1HHGA 4X6EB 5JW4N 3OWEA 1RUAL 2AV1B 3SGKA 1MFCL 1T22A 1CICC 1EO7A 5DD0L 2I5YL 3VXOB 1P9MC 3TNNA 1DL7L 3MLUH 4LSRH 2XWTB 1I9EA 1QO3B 4JQIH 4WU7A 4CU8A 2VLKB 5I1GL 2XG4A 4OQTH 3UO1L 5FGSA 4FMKA 3FQXA 4NQUA 3O6FB 1UWEH 5FUOL 4WW1A 4KJYA 1XGUA 3U1SH 3O3BB 4IOIA 4C55A 2APVA 3LZFH 4JO2H 1NC4A 4X4YB 4KV5F 1BF8A 3VMOA 1RJCA 5F3HA 1HINL 5I18L 4J8RB 3EDKA 1BQHG 4KQ3L 3DYMA 1HH9B 3VFMA 4XPHH 1X5YA 3KLDA 4MX7A 3D0VA 3SEPA 2Q7YA 2VIRB 5TDOB 5KZCD 3PXHA 3GFUA 3FFCB 4EDWH 3CH1B 5DMKA 1RZIA 4RAVB 1T04B 4ZOEA 4MLSA 3K1DA 1EHLH 2WLZA 3R06B 4ZOBA 4MNQB 1I3GH 1A7QH 3WS6A 2EKSA 4G6FD 1NANI 2H32H 5F7YC 2ERJB 1MPAH 5ALCL 5HYSG 4D9RE 1T7XA 1IM9D 1AGFB 1ZVSB 4JREB 1M6OB 3QRFM 1LE9A 3K3QA 4HDIB 4I9WE 4NKMB 4XP1L 1NUGA 2X42A 3RU8L 1OGAE 1G6RL 5JIPA 3KYAA 2R4RL 2YUXA 4X6BA 2APFA 4OD1H 5IG7B 1T5WB 4PJIA 4Y5YB 4PJGF 3BEWA 5JUEH 4OZ4A 1CLYL 2QKIA 5DD6A 1QBAA 2ZKHL 3NTCL 5EC2B 3W2DH 1A2YB 2YA0A 1MH5A 2LAGB 5T1KA 1NUNB 4LCCC 1A4JB 3X11A 5IHBA 5EUKB 3ZTNH 4MJIE 2X4PB 5IB3A 3PQYA 5IMLB 4BZYA 2BZDA 3W0WD 3FZUD 1P4IH 1BIHA 4PP2B 2WBJD 3SDYH 4DZBA 5BVPH 4BYHA 3C2SA 3T0DA 4XNUH 2CLVA 1S5IH 2C1OA 3HMXA 4XWGH 3BI9X 1T83C 3H9SE 3QEGL 1IGTB 4ZTOL 5ILTH 3BFOA 5TF0A 4Y2DB 4YHYB 5EORH 5C1MB 3E6FB 4M7LL 3NAAH 4DWHA 1KIUA 4GMSL 3HB3D 4GLRH 4YHNA 1BJMA 2H45A 2DQCL 3C60C 1U8JB 3VH8B 2Z31B 1N59A 4XBPA 3VDBA 5JO5B 3QP3A 2B0SL 3EO0A 4CVUA 4PG9B 4Y19A 4NQEB 3CDYA 1IAIM 3U9PH 4DUVA 1UENA 3FHAA 1AE6H 3RWCA 1DQJA 3GNMH 3SDAD 3LQAL 2NY3B 3P9LB 3UJIL 5A16A 2OBGA 3CD4A 4KKAD 4R4NC 1MJ8H 3BXNB 3D3VE 4OAWB 3I3BA 5D7LE 5FCSH 5KS9E 2IFFH 4PFEA 4ZSOE 5F70A 1ITCA 3G6AA 4FXKB 4EIGB 1OAZL 4IRZH 1ORQB 4OZGE 4M1DL 4LLQB 1WFNA 5LXGH 3B43A 5J06A 4QRPE 4HH9B 3H3PH 3FMGL 4IOFC 3K4ZA 5BV7C 3PWVB 2ADIA 1FCGA 2P5WA 1JGDB 3KYNA 1NGXA 2HKFL 5HYEA 1CI5A 3MRPB 4GRLB 2R69L 4ISVB 3V5HA 3RZCB 1OAQL 4M6AA 4MJ2A 3C5ZB 3CFCH 3CAFA 3D2UB 1W0WA 4KJPD 2VZ3A 4KY1H 3BP4B 1K85A 2GJ6E 1NC2A 1UCBL 4NJ9H 3K2UL 4R26H 1WV7T 2EXYD 2NNAB 3WDIA 2Z4QA 4ODHH 2VDRL 1MFCH 2ILLA 2J5LB 1YY9D 2I5YH 2R56L 2GQHA 2VE6B 2DIJA 4FQJL 4NQSA 1QRNE 1BZQK 2R2EA 3DROA 5I1GH 1HHIA 3QFJA 1TPXC 3HI6L 4UBDD 3OPZH 3OG4B 3BQUB 3JSSA 1BWMA 1TVBB 5I1JH 3Q0HA 4KKLD 4I48B 1SJHA 5AAMA 2YPKA 4X6FA 5FHAH 1UC6A 5FYJD 3WFCL 3HN3A 3GM8A 4P23A 4POZC 5J0BA 1HINH 5I18H 2WWKO 1U95B 4PJ8C 1E0OB 4KQ3H 4Y5XA 4LQFL 2AJSL 4PRID 3OB8A 3H9HA 5I8KH 2H32A 3LB6C 3CFDA 1KLUB 3MXVL 4HKBA 2MNUA 1AGBA 5AZEH 3BPOC 3D6GA 3PABA 3IVKB 1RIHL 5ISZD 4BSWA 5BJTA 4GW1A 5ETUA 3PUCA 3VWJB 5FECB 5HYFA 3TM6A 5IB1B 1KB5B 4M93C 4JZOB 2Z92A 5E9DE 1XGTA 3RVWC 3L7FB 1DVFC 5ALCH 3IGAB 5E6IB 4PS4L 3ULVF 1MRFH 2A83B 1FSKB 5JIKA 3CFEB 4P5TB 1JPGA 4LIQE 2EDWA 1XR8B 4KI5C 3LD8C 3AXLB 3RU8H 3MRCA 3QIBC 1R5VB 2E27L 2EEDA 1HSBB 4FXGA 4I3SL 4FG6D 1RJLB 4WWKD 4FTVA 2R4RH 3L6FB 3SCMA 4D0DB 2BOBA 1PFCA 3ARBA 5TE4L 4OF3A 4WI2A 1IKNA 3UTTA 1LO3L 1GGCL 4XCFL 1TMCB 1ZLUH 2DTSA 3EYFB 3ULUF 1CLYH 3NTCH 1I7ZA 5HJ3B 5T33L 3PF2A 1QKZH 3BEVB 1HZHH 5HI3D 2DQFA 2UYLB 4XPGL 3KJ4B 3MROB 2OTUA 1BQSA 4DGIL 1WZ1L 4MAUH 3WIHL 4ZO6A 4QHUA 4MNQD 5DEFA 1CDHA 1G7MB 1MFNA 3TBSB 5DUBA 2EECA 4KH2A 2QQKL 3TGXA 3EYOA 5HHPB 4XWOD 1L0YA 4OZHF 2BJMH 1DBKL 1EVTC 3GJFB 2LU4A 4LKCA 3C9NA 4ZFZB 1AQDA 1U3JA 2HTLC 4ZTOH 2R2HB 2EIEA 1BD2A 1LO5A 3OAZH 5E94A 2XY2A 3AS3A 2X6MA 1FRGL 4M7LH 1S7TA 3FAWA 5BOPA 5I1DA 1WFUA 5FUZH 4WW2A 5FGCB 4YIQB 3V4VL 2DQCH 4JN2A 5ICYB 1DLHA 5C0BA 1B0RB 2A6KA 2B0SH 1I1AC 4TUOA 2HJFA 5AYQA 2VERN 4XB8A 2QEJA 3BP7B 4YO0A 3VG0H 2YD2A 3LQAH 3UJIH 3MRGA 5AUMB 1T03L 1MI5A 2VZOA 5GIRA 2GTZA 4LSVL 1S9KC 4NFDA 3AMKA 2Q8BL 4QGTA 1OAZH 3UX9B 3IFPB 1WAAE 1Q1JL 4WO4A 3O4LE 5ESAA 3FMGH 3C09B 1GL4B 1FYHB 2HKFH 1FC2D 3OKOB 2R69H 1CFSB 5HHVL 4RQQB 3V0AC 4UQ3A 2R4SL 3LIZL 2F54B 2MCG1 1AP2B 3HZVA 4Y2DD 4L4VA 1A6AA 3VFUA 1UJ3A 1UCBH 3K2UH 2PW2B 3DX8B 5JHDB 1J0HA 1UXWB 2BY1A 2ESVA 3NCYS 2F53E 4LHUD 3C6LC 5BVJB 2EO1A 2VDRH 4JZNB 1PYWB 3DVGB 5F9WC 1QLRB 2Z31D 5L8JB 5E2JA 1HI6B 2R56H 5IT2H 1IE5A 4FQJH 3QDJB 4URTB 4L4JA 4NQED 3W81A 3ABZA 3GJEA 2UV3A 2DL9A 2P43B 1FDLL 1MJUL 1P4BL 3HI6H 4M6OH 2NY3D 1T6VN 3ORJA 3L95B 1RV6X 2ORBL 3RUGF 3SPVB 2JIXB 5I17A 4NQTA 2XWBA 2ARJQ 3AU1B 3BPLC 1MEXL 1VEMA 2F74B 1A1MB 4KMTL 4XMLL 3HMWL 3QZWB 1NDMA 2XZQL 1X5JA 4HX1B 2NW2A 2VUOA 2GIYA 2Y06L 1TZHA 2FX8L 3QA3B 4KDTC 1L7IH 1GZQB 3IKKA 3ESUF 4U6XA 4G5ZL 1Q72H 1CIDA 3HUJB 4XTRC 5FYJL 2XQYG 4GRLD 4RIRA 2AJSH 5T1LB 3QIWC 3C5ZD 3GBML 1JUFB 1O7SA 2V17L 2XTJB 4PJ9B 5E8OB 3ILPB 4Z5RA 1MAML 2X9XA 1AC6A 4NM8L 1OB1B 3MXVH 2I9TB 1S78C 3MV7A 1WF5A 2AJYL 3CC5B 3K8MA 1GGIH 2FECL 2IAMA 5D2NE 4ETYA 1T80A 3E0GA 4PJEF 1RIHH 4P57A 5IWLA 1Q0YL 3K74B 3VFPA 1W0VA 3CMGA 3MFFB 4G43A 3ZHDA 2X9WA 5B38A 4JRXD 4PGZA 3VMNA 3O6ML 4WHCA 3IAQA 3V6FB 4NQXA 1G6RA 3UTOA 1T0MB 1YMMD 3Q5YA 2AK4B 3ELAT 5JOPE 4PS4H 2GAZA 1MQKL 1ACZA 2DQIL 4HJGB 4HXAL 2DD8L 5JLZA 5FB8B 2CQVA 2A9NH 1UEYA 2D0GA 3NIDE 3TT3H 1I8LC 4AM0B 4I3SH 4NHCH 4YBHA 3HG1E 1I3UA 3WN5B 5D7JD 8FABB 2WBJC 4RSVA 4LGRB 3GMMA 3OSKA 1MFDL 4LLWB 5FFLA 4Q6IC 4Z0BL 2R9HC 4TRPL 1LO3H 4XCFH 2PO6B 3IDIB 3IU3A 3EDDA 1GXEA 4JFDD 3AFLA 3H3BC 1XCTA 5FXCH 2IANB 1FPTH 5T33H 1WEJL 1GC1L 3RWEB 2FO1A 1YPZB 3KPNB 3CDFA 3LRGA 3RWDB 3H9ZA 2EDKA 4XPGH 3GSRB 1F97A 4DGIH 1WZ1H 5C0CB 4MJ4A 3WIHH 4G8GB 1UFUA 1F58H 3VWJD 3CU1A 4WHYH 2Q3ZA 1B90A 4YK4B 5EIIB 3QG7L 2QQKH 2PXYA 2ADGA 1BVLA 2VDKL 3W9DB 1HSAA 4ZNEA 4YH6A 1LDSA 2XN9E 3EUUA 3IDJA 2CJUL 4EZMA 3TJEL 3SE9L 4TSCL 4KTEL 1FZMA 5C6PB 3O3UN 1IAOB 3WL9A 1HILB 2ADJA 2WM0A 1FRGH 4F9LC 5BS0A 3HAEB 4YC2C 5A2JH 1LK3L 2R29L 3TN0B 1FFPA 3QNYA 5SWSA 3V4VH 5K9QG 2IBBA 1QFWI 4I2XA 3HC3H 5CEYB 3MMEB 3VFWA 1Q9OA 1RIUL 4U31A 1C5CL 2R39A 4UAOC 5FA3A 4JHWL 4FNLL 4YHLH 2VZSA 4X6DB 4H26A 2O61B 4L3EB 2Q8BH 4MA3A 1D5BB 1X7QA 4PGJA 5KN5B 3MV9E 5GS0D 5E8EA 2CDFA 1RUKL 4LK4A 2QV2A 4GW4B 3QUYC 2GK2A 4X99B 2F8XC 1A7NL 5D93C 4B53A 2VLLB 1W72B 3CCHA 4PJ5A 3MJ9L 1U92B 5HHVH 3MGOB 2X4TB 5C3TA 4PJAE 1S7RA 3H9YA 2NY2D 2Q76B 3UZQA 5HVGB 3B5TA 4RMWA 3GMNB 4OZFA 4HUVB 4AMKL 3ARGC 1FFOA 1ZS8B 2PYEE 5BQ7A 1JI2A 4QT5A 4ONOA 5JA8B 3RVXD 3I2CL 3CX5K 5LJYH 1M7IB 1BAFH 1WT5A 3GIVA 5I76B 3G5VA 2BXYA 2L4OA 4AIZA 1HEZB 2E8ZA 3AMLA 3IXTB 6CGTA 4EN3D 35C8L 3KYMA 1FDLH 1FV1B 1MJUH 4S1QL 1P4BH 1XH3A 2V2WA 3CIQA 4J3SA 2ORBH 3VI4E 4HUKB 3EIFA 1MJJB 3JV5A 4QXUL 1OTSC 4LEOA 2NY6B 2HAZA 3K46A 3UTSB 3MJ8A 4KMTH 4XMLH 1ONQA 2XZQH 3TBVB 1KJ3H 4K8RD 2Y06H 1OVZA 3SKNB 4Z7UB 4EUPB 3WXWL 2FWOB 4L8BB 4G5ZH 2YC1A 1IGYB 4KVCL 5IV2A 2A6IA 5FYJH 2D7QA 2ZCKL 4I0KA 1N2RA 3VRIA 2DKMA 2V17H 4HGWA 4L9LC 1MAMH 3LV3B 4WHTB 3U9UA 3FRPA 4N0FB 3VRLF 2AQ1A 5JHDD 5C7XH 4HAGA 4WWKC 4JEGB 5CIPB 5GSVB 4Y5VC 5D7IA 1DEDA 3EYQD 4G9DA 2NR6C 3DRQA 3O6MH 4O9HL 5I73C 4CL7A 2V9TA 3RUGA 2FL5A 3QDJD 3JTTB 3I6KB 1HOCA 1IL1B 2VLJD 4X0KA 4Y16C 5IFAH 4LCWB 5FOBA 5CILL 2RIKA 3RX7A 3PDGA 4PTUB 5H2BB 3AGVA 3SJVB 5CCKH 2LTQC 1MQKH 2VZUA 1VPOL 2DQIH 4R9HA 4RZCB 5HI3C 4NQCE 2DD8H 2A6JB 2AJVH 4LMQE 25C8L 1QD0A 4MQ7A 2AQ3A 1WBYB 3MGAA 3MRNA 1W0YT 3GJFK 3EO1A 2HJLA 1MFDH 4XWOC 3QUMH 4TRPH 3WIHA 5T1LD 4HG4J 3VGFA 3P2TA 1KJVB 3V7AE 9CGTA 4POUB 4PJ9D 5J12C 1OOAA 3QNZA 1QSZA 4JDVB 4F7TA 3DV4A 4YR6B 1WEJH 1GC1H 4XMPL 1FE8H 5CBEA 4WDIB 2VL5B 1Y18A 2WMPA 2CRZA 5I8EB 4U33A 3IXAA 2H6PA 2BSSB 3BH8A 3SDDC 4JO3L 3T77B 4C56D 1V3JA 2K3TA 3CSBA 4OFVA 3QG7H 1S9WB 4GAFB 4KK5C 5FKPA 1ZK9A 2VDKH 3I50H 4D0BB 3LMJL 4OBRA 3CK0L 1O0VA 3FQWB 1ZTXL 3GHBL 3OJVC 3UJJL 15C8L 3REVA 1NCBL 4WUUE 4JKLA 4MMXC 2P47B 2VLRB 2IGFH 1NMCC 4ETQA 1LK3H 1MSPA 4FQLL 4RFNC 3HPJB 3RNQA 3BZ4B 1QFUL 4MWFA 1NDGB 3RWFA 3SDAA 5SX4H 3GSXA 4JM4L 5B39G 3X13A 1J1PH 4QWWD 2BNRE 3LEXB 2PO6D 1T4KB 1RIUH 4Y4KD 2AEIT 1C5CH 1K4CA 2AEWA 5GRJL 3S5LA 5C3LD 1B2WL 5BXFA 5C0JB 5FYKD 2IAND 4PJFE 1J0JA 4OF7A 3MC0A 3SKMA 4IIQC 5I6XB 4CNIA 4LSPH 4G8EA 2DM7A 3EYVB 5C0CD 1PG7W 1PD6A 1RUKH 2PF6A 4G8GD 5FV2A 2AAVA 4KUZH 3RVVC 2NTFA 3F7QA 5DXWA 1Q0XL 2ICWB 4YFLI 3MJ9H 3AS1A 4WI3A 5GS0L 1PSKL 5DFVC 5E1AB 4U0RB 1FVDB 1QRKA 4IM8A 4GG6E 4FOMA 2YRPA 3WNLA 4AMKH 3AUVA 3DMMC 2H26A 5DHYA 2WQ8A 2ATKB 3I2CH 3O6LL 5C9JA 3TN0D 2H1PH 1RQ5A 2HVJB 1V05A 4OLZL 4XP5H 3CDGA 5EWIL 5DJ8A 5A2FA 3GMLA 4PJ7E 1F4YL 3JV6B 3RGVB 3B4NA 3LKSB 4BKLB 5T1MB 2D7OA 4HV8B 4NT6B 4YGAB 3Q1SL 2XQYK 4GKNA 1ZEAH 2X4UB 2EXWD 5E2WL 3BJLA 4PRHB 5GGVY 5SWZE 5IW1B 5I1IH 3MXWL 5HDOA 5C08B 3HS0A 4L3ED 4AEHL 4FQXD 4TSAL 2CK0L 1TITA 1IEBB 2JCCB 5ID1B 5DVMA 2N56A 5EFIA 3WXWH 3S36X 1OTTD 5D1XC 3MLXL 2NY4D 3NFPB 4K55A 2EDFA 5I1HL 5EOCL 5IIEA 4K8RL 4Z8FH 1I8KB 2ZCKH 2YSSB 4MAYC 2IADA 4WU5A 4X6EA 4GT7A 5ENWB 5DMIH 1QOKA 2AV1A 4LLAA 2FHFA 1PG7H 5FOJA 4KTDH 4QOKB 4U1HB 1FZOB 3DECA 1K8DB 4HK3J 4NJAL 3VXOA 2EH7L 4CN4A 5E5RB 4YDLB 3B9DA 1D7FA 5E70A 2XWTA 1QO3A 3LH2L 5D7JC 2VLKA 4JPIB 1Z9LA 3ARDB 2VDNH 4O9HH 1VEOA 4HIIB 3O6FA 1FZKB 4JFEB 4MA1C 4OF5A 1Q9LB 5CILH 1NCWH 1ZLVH 5EUOE 3O3BA 1CXKA 4RMVA 4XNZC 1JK8B 4OT1L 4GQ9H 4X4YA 1VPOH 3FB5B 1ZGLM 2NY6D 3WE6B 2B1HL 4J8RA 3J8F7 25C8H 5EB9A 1HH9A 4HQQH 4KRPB 2OL3B 3OR6B 3RRQA 2Q7NA 2VIRA 1UH3A 5TDOA 3T0WA 3T0ED 2RGSA 2Y1VA 3FFCA 1CE1L 3CH1A 1CLOL 1VFBB 4RAVA 2ZWLT 3FL7A 3PWPD 1T04A 2GCYB 1WLHA 5A3ID 5CZVL 1X5GA 5CWSB 2EDOA 3R06A 1TQBB 3BN3B 4UIMB 1NBYB 4MNQA 4D2NA 4HW6A 4B41A 1ADQL 2NY7L 2X4RB 5FGBA 1T5XB 3NCEB 4OFIA 2OM5A 4JO3H 4ODVL 3MZTA 4PRPE 1WGOA 1L9NA 4L1HA 1AGFA 1ZVSA 2ICEB 4LCWD 1M6OA 2JJSC 4C4KO 1PQZB 5FO9B 3CK0H 3JVGC 1EMTL 4HDIA 4KI5E 4WI8A 4F3FB 4NKMA 3CXHJ 3UJJH 3VFVB 4LSTL 2FHBA 4ZPVB 3LKNB 1RHFA 1NEZB 2K1MA 4OQ1A 4AT6B 1DLFL 1T5WA 5IG7A 3ZL4L 4FQLH 1DQML 4M48L 4Y5YA 1NCCL 1T1WB 1QFUH 4ONHB 1LEGB 3V95A 4K94C 4JM4H 4HHAB 4FFYL 1J0IA 5EC2A 1K4DB 1A2YA 2D3VA 3B8SA 1J10A 1HKLH 3EFDL 4ZAKD 1A4JA 3EJJX 1HHJB 5EUKA 1CGUA 3MJ9A 1W8OA 3O45B 5EO0B 2CGRL 2X4PA 1CQKA 4UOW0 4CDHA 5IMLA 1B4JL 5MEND 5HTSA 3GSWB 1LGVA 1IC5H 5HDQL 4Y8DC 4PP2A 4H1LB 1AO7B 1WWWX 5FYKL 4HMEA 1PEZA 4X8XA 1FLTX 1IGTA 1R5IB 3EOYG 2Y72A 5GS0H 4Y2DA 4HS6B 1PSKH 5IBUG 2BNQB 3E6FA 3BGFC 2I07B 3DRTB 1JNHB 4KKCD 3SBWC 4OCNC 1DN0B 4UMGA 4UU9B 4K94H 3PP3K 1TCRB 2Q8AL 3T4YA 1U8JA 3VH8A 2Z31A 1J1XH 5JO5A 1RU9H 2QHLA 4LBEB 5CKGA 4QHNB 4PG9A 4FP8L 1F90L 4NQEA 3IJYB 5KVGL 4PBWD 3P9LA 4NYLB 5JW4R 3RKDD 4PJBE 3N9GH 5EWIH 1N5AB 5FDYA 3BXNA 4OAWA 3B9KD 3CX2A 4FXKA 1KTDA 3Q1SH 3QDME 1ORQA 1IILE 4LLQA 1A7OH 4LVNC 5E2WH 3OXSB 4LGSB 1IQWL 4HH9A 2CMRH 3RX5A 4QF1B 3NIGF 1JV5B 3PWVA 4P23C 2Q87A 5LAXB 1JGDA 4TSAH 1OM3L 5E2TL 1CDUA 2CK0H 4EVNB 3MRPA 4GRLA 4ISVA 4Y4FB 3RZCA 2FBJL 2AJXL 3C5ZA 5DRWA 5KSAB 2PTTB 3D2UA 1E6JL 1XAUA 4PG2A 5LCVL 3BP4A 3MLXH 5CINL 4R8WL 5I1HH 4K8RH 4K71C 3IJSB 4N8VG 1Y6MR 4DGYL 3MZGB 2JE8A 2NNAA 4ZPTB 4NKIL 2DJUA 4F33B 1W72L 4YXKH 2P5EB 4JFZL 4PJCB 3VMPA 3MTRA 3FOLB 4NJAH 4YLQT 2VE6A 1NMBL 3MLSH 3MUJA 1QSEB 2FGWH 2IC2A 3MRQB 2F8OA 3FTGB 2CRYA 3VWKD 3BQUA 1MUJB 4MQTB 3RGVD 3WUWB 4DJMA 1TVBA 4I48A 3DIFB 3GI9L 3ZKMC 4O4YH 4JPKL 1WWBX 4PRHD 5C08D 2W0LA 2H41A 2B1HH 5E6ZA 4LQ1A 4F58H 1U95A 4O51B 1CQYA 1NKOA 5DZLA 4GAYB 3ARBC 3TYGH 3MO1B 3GEWB 1JWUB 3HPLB 1NGZB 4Z7WB 3HNSL 3MR9B 1KLUA 3WDHA 3I02B 4XHJC 5CZVH 3IVKA 2QTEA 3QBTB 5EZOL 4G80B 4QOKD 3VWJA 5C0EB 5FECA 1G6VK 3VXME 5IB1A 1KB5A 1X4YA 4JZOA 5GSRB 4DEPC 5K9KB 4W68A 5GJTL 4DN3H 5BZDB 5HDBE 2NX5E 3L7FA 1UXSB 2MFNA 3ARDD 3IGAA 2YPVL 4ODVH 4QRTB 5E6IA 4GQPH 3WXVH 5E4IA 2A83A 4JFED 2ZJSL 3CFEA 3QHTC 4P5TA 3QXDB 4Y4KC 3HTLX 3WD5H 3TZVB 1XR8A 5B22A 1EMTH 1MHHB 3AXLA 1R5VA 2LQRA 5D1ZB 1HSBA 1RJLA 3FKUS 3W0WE 5CP7A 3FB7B 4D0DA 2OQJB 4NUGL 1ZE3C 3W5MA 3ZL4H 1DQMH 4KRPD 3VE0B 2CUHA 1NCCH 4DKAA 3EYFA 5TPWL 4M3JA 1EZVY 4I18C 1M7XA 4JZJB 2VXQL 5D1QB 3BEVA 5A40E 3RBSA 3SDCB 5C0RL 3EFDH 3MRKB 2UYLA 4D8PB 5ICZB 5M95B 4U1MB 5DGQA 5EBWB 3TVMB 3MROA 2CGRH 2BK8A 5BMFL 2DAVA 3N1GC 2YEZB 4X6DF 5HDQH 3TBSA 1F13A 2I25N 6FABL 3QXTA 1JVKA 5HHPA 3IKCB 5CP3H 3VXSB 4P2RB 5FYKH 1YEEH 3BJ91 2YXFA 2PCPB 4GW5B 4ZFZA 4C59B 1OD7A 3G9VA 2R2HA 2ZUQC 2FHCA 3RAJL 3U79A 4OD3L 3MCG1 4B0MM 4N0UE 2AK1L 3QDGE 1M7DB 2DTMH 2VR9A 4LVHC 4N1EA 3VRJB 4X5WB 2HP4A 1KJ2B 2C4XA 2VUYA 4R2GB 4YIQA 2Q8AH 3GBNL 5ICYA 1B0RA 1F3DJ 4FQXC 4QHKI 1R5WB 5C0GB 2NXYC 4RDQG 3V79C 2IH1A 4FP8H 4G6KL 4L1DA 3FO2B 3SKJL 5JPNB 5KVGH 3BP7A 1ZHBB 2JB6B 3PGCB 2E6JA 2Q1EA 5AUMA 4ZUVB 5KAQF 1GGBH 3OAYH 4NZTH 4R3SB 3T3ME 2PW1B 3EO9L 3OKKB 1EFXB 3HRZB 2I60L 1FNGB 4JO1L 4XNYH 5I1EH 5IKCB 3IFPA 4RGOL 1P7KB 1AC0A 1FYTB 1YY8B 1HQ4B 4OKVB 4R0LB 1IQWH 3DGGB 3S97C 1NGYB 1DUYB 2HTKC 2O5ZH 4NZJA 2WIIB 3LOWA 5E2TH 3OKOA 4LSQH 1CFSA 1EHXA 2AJXH 1YYLL 4RQQA 5A1AA 4K23L 4RGMC 4G3YL 2P42B 4Z7UF 1E6JH 4K7PH 3KXFB 5LCVH 2F54A 1AP2A 4ENED 3FQRB 5CINH 1MCCA 2PW2A 3IJHB 3DX8A 5JHDA 1F42A 1UXWA 4KI1A 4YDVB 1W72H 2W0KA 5BVJA 4KROD 4JZNA 1PYWA 4OBSA 2WIMA 3DVGA 5GGTL 4K7FB 3V6ZB 4PREB 3QDJA 1NMBH 3VDAA 4PRIE 3GUTB 4HJ0C 3WFBH 4HKJB 3JV4B 3K81A 3WLWD 1I1RA 3T0EC 3L95A 1FH5L 3SPVA 4YBLC 2JIXA 3AU1A 3GI9H 5EOQH 5KVMC 2F74A 1A1MA 2F5BL 4Z7VE 5ISZE 3ILQC 2CKNA 4FMFA 2DQJH 4HX1A 4BZ2H 4JPKH 3IFNL 4OJFL 3QA3A 4KKBD 4POYA 1GZQA 3RFZC 3D39D 4MXWL 4L9DA 1FLRL 1NFDB 4P2YA 3HUJA 4ZODA 5T1LA 3ALXA 5CD3B 1DEEB 5KSAD 1JUFA 2FBOJ 3IFOA 4MHHG 4P9MH 5E8OA 4PJ9A 1ADQA 3HNSH 3ILPA 4TUKL 1KBGH 1QR1B 1OB1A 5D72L 1RUQL 1EAPB 1I7TB 3MNVB 2I9TA 3CC5A 2EZ0D 2HVKB 3ARPA 4EUPH 1E4KC 1MJ7H 1WTGT 1GPOH 2R0LH 5IHZB 2QSCH 4RGNC 5E4EC 3MFFA 3BP6B 1NL0L 5CSBA 4XRCB 4X4ME 4DVBB 4RAHA 2XXCB 4WGWB 3ULVC 5EBGA 3V6FA 1T0MA 5DSCB 5GJTH 1TJGL 2AK4A 1QSED 5IBLC 2O93L 4E41E 4JPVL 3K8KA 2X44D 1NFKA 2DLIA 5CIPH 4IRSB 5KVDL 5C71A 4HJGA 4QHMB 2ZG3A 5FB8A 5I74B 3VI3F 3IDNB 5LQBH 1IARB 4GKOA 4G7YL 1AGEB 4AM0A 1OGTB 4NUJB 3WN5A 3NABH 8FABA 2Q86B 3ULUC 4WV1B 4LLWA 4NUGH 1NLBL 2PO6A 3IDIA 1ZAGA 1T21B 1EPFA 1A4KB 5CP3A 2ADFH 3LDBB 5AD0B 2IANA 5C0AE 2VXQH 3RWEA 2OL3L 1YPZA 3KPNA 4KKCC 4QYOB 5FGRA 3RWDA 5C0RH 3GSRA 3DUSB 4MZ3A 3QWQB 5DO2C 1FVCB 3IDYC 4HC1L 5BMFH 5C0CA 4G8GA 3BD5A 1CF8H 2A77H 3B9AA 1RJYB 3E2HB 5F1SA 3QUZB 1RUMH 5EIIA 5IM7A 3W9DA 2Y6SD 3ARSA 2XYCA 3DXAD 3B9KC 4MA7H 1LQSR 5HHOD 3RAJH 3TO4D 5FM8A 1Q38A 4OD3H 1IAOA 2AK1H 1HILA 3TZVD 5F44A 4Q9CA 3HAEA 1VERA 5GRVK 3TN0A 1TDQA 5E0QA 3IDMB 1CVRA 5D70L 3GBNH 1G84A 1E4XI 4WEUD 5CEYA 3MMEA 4G6KH 5DQJB 3PJSB 3SKJH 2DQDH 4X9HA 1F00I 5E1HB 1NJ9B 5B8CC 4NZRL 3OGOE 1BFOB 3EO9H 2YR3A 4Q0XL 4X6DA 5D1QD 1SVZA 1BP3B 2O61A 4L3EA 2I60H 4MJIB 4XPBL 4JO1H 4L4TB 1UH2A 1D5BA 1X44A 5D8JL 3UBXG 2AJ3B 4RGOH 5KN5A 2P1YA 2X10A 4WFHE 4GW4A 1D9KD 4X99A 2FIKB 2VLLA 1W72A 1U92A 3VXSD 4P2RD 4F7MB 5GISL 3ZDZE 3NVQA 3TBWB 4YHOL 1YYLH 3H9SB 1L6XA 3MGOA 2JELL 2X4TA 4K23H 4ZO7A 1MCHA 3SE4A 1TNMA 3VWKC 4APQB 1F4HA 5E2VL 4Z7NF 2Q76A 5DC9B 1OP5K 4RBPH 4OUUB 5H37G 3P30L 3B3IB 3GMNA 2HT2C 4HUVA 3BPNC 1ZS8A 3S9DB 3RIFK 5I1KH 2G75B 2LVEA 3LN5B 1SQ2N 2J8HA 1M7IA 3IB4A 3OKYA 5I76A 3VFOB 1HEZA 5J3HC 1CU4H 1NBZB 3IXTA 5JQ6L 2Z35B 5TE6L 5J11B 3L5WB 3ARWA 5LGJB 1FV1A 4NQDE 1FH5H 4PY8I 5D7LB 5KS9B 1VFOA 2YS4A 5B4MD 1MJJA 1ZANL 4ZSOB 3UCRA 2QSQA 1UB6B 1VADB 2D2OA 3UTSA 1YMHB 2F5BH 4GS7B 2W38A 4XPTL 3MCLL 3TBVA 3DO7B 1H5BB 3SY0B 3IFNH 4OJFH 4J2XA 1S5HB 4Z7UA 4EUPA 1LEKB 2FWOA 4L8BA 1FLRH 1IGYA 1I9IL 3LKQB 2DLHA 2X4OB 5CD5C 2FEEI 2GJ6B 4PUBL 3KXFD 4TUKH 3LV3A 4WHTA 2GW5A 1MNUL 4N0FA 3ALWA 3BMWA 5ITBH 1NGWB 1MAKA 4RFOH 4DKEH 1TNNA 5CIPA 4HGMA 5GSVA 4OFYD 3QUXC 1NL0H 3HZYB 1YEDB 3LSOB 2DB8A 3RIAK 5L0QB 3GMQB 3BKJL 3JTTA 2CRIA 3I6KA 4NN6B 1HYSD 4LCWA 4UV7L 4PJDF 3JWDL 1K3IA 5H2BA 4JPVH 1G0XA 2DMKA 2VTFA 1MCIA 2EEAA 4WFED 3SJVA 2KKQA 5DD1L 4RA3A 1OF2B 3F5WB 5KVDH 4RZCA 1KN4H 2XIDA 2ZSWB 3LQMA 4ONFH 4OM0L 3ZDXE 2A6JA 2A0LC 4G7YH 1FAKT 4QY8B 2FGZA 3DX7A 5JZ7C 1WBYA 3M17B 5IHLB 5JXED 1KN2L 2RHEA 1J8HB 1MIEL 4LNRB 4YXLL 1U8IB 2DQGL 3VGEA 1NLBH 3GO1L 2NY1D 5AYUL 1KJVA 4FFVD 5E8DL 4S1DD 4JDVA 1A3QA 1P84K 4YR6A 5SX5H 1F3DH 3SDXE 4WDIA 4MVBC 2UWEE 3CX5J 2Q20A 4KK8C 4S2SA 1CK0H 5I8EA 5IROA 2BSSA 3R8BB 4M1CD 4N1HB 5IVOA 3T77A 5DJXB 2BVOB 3CU7A 3I75B 4F9PA 1A6PA 4V1DB 2IEPA 4HEPG 3MV01 5EU6E 1S9WA 3DI3B 1CD9B 1INDH 2ZSVB 3EYUH 4D0BA 3M45A 3FQWA 2OZ4L 3Q5TA 5GGQH 1ZV5A 2AQ2A 1BPVA 3PL6B 4ZUUB 5HYJD 2VLRA 5K9JL 2VXSL 4I77L 2VDPH 3QEQB 5EBLB 4QHKJ 4F7EB 3HPJA 5D70H 1NDGA 3MLTB 5AWNL 1CD1B 1MCBA 1ZHLB 1PX4A 3LEXA 3S35L 3TBTB 1T4KA 2CR3A 2RB8A 1JGEB 1RFDL 1LHZA 5CFHA 1I85A 5D5ME 5C0JA 3SE8H 1B6DA 2X1PA 3CVHB 3TNMB 4Y1AE 2RR3A 4HFUL 5IVXF 3EYVA 2M8XA 1H3TA 3UXFA 4LRNL 5DC0A 1RULL 3RWJB 2VR5A 2ICWA 4YBQD 4D9RD 4ZUWB 5IOPB 5FO8B 5GISH 1BEYL 5GGTA 4YHOH 5E1AA 3RQ3A 4U3CA 2JELH 1MHPL 4NC0B 3ARYA 3SQBA 1FVDA 1A7PL 4H1LH 3WDJA 5E2VH 4WJ5B 1NBVH 4KUCF 3P30H 3DYOA 1EV2E 1UA6L 4I9WD 3R8QA 4R7DB 5DA0B 5AG8A 1QFHA 5HBBA 2F5AL 1A3RH 1OGAD 5ADOL 1DN2A 1FCCA 3HR6A 3F6LA 5FIEA 3T65B 3QAZB 4YUEH 2HVJA 4HPOL 4PJCF 4ZMAT 3ZKNC 4J7RA 1AGCB 3HE7B 3VXRE 5JQ6H 4W6WB 1KJ2L 5TE6H 3RGVA 3F7PC 3LKSA 4BKLA 5T1MA 4HV8A 4NT6A 1TVDA 4KKNA 2X4UA 1C1EH 4KAQL 4GXVL 5IVZB 1ZANH 4B7IA 4PRHA 3TH2T 5IW1A 5C08A 1ZKAA 5I19L 4N5UA 1GIGH 4MJID 1XF2B 1B88A 1H3VA 5DUPL 4HMCA 1XF3B 4O2EA 2HA1A 3O4LB 1FGNH 5CSZB 1EBPA 3DX9B 1IEBA 1QFWM 4XPTH 2JCCA 4N9GB 4MGXA 5ID1A 2V2TB 4GAGL 4HIHB 3WJJC 3RY6C 3RIFF 2VLJE 2D31B 1V3LA 1CXEA 1I9IH 3NFPA 5AZ2H 3V6BR 1E27B 1I8KA 2YSSA 3H9SD 1FFRA 3JZ7A 4G9FE 4PUBH 5ENWA 4NFBA 1CFTB 4RMRA 2ITDB 1MNUH 4QOKA 4U1HA 2F53B 3C87A 1K8DA 3FONB 4E5XB 3BRFA 3MODH 5IQ7L 4JPIA 3ARDA 2ERJC 4X9FA 1EEYB 4HIIA 1FZKA 4JFEA 1FIGL 4XNMA 1R3HB 3O9WB 4UV7H 1A21A 1TIUA 5HI4C 3MLPA 3KLHC 1YZZA 3D3VD 1JK8A 5DD1H 5GS3A 3FB5A 3RTQC 4IOSD 1AR1C 4OM0H 5L8LB 3GBLA 3WE6A 5J13C 5EN2B 2YD4A 2X2YA 2JJVA 1T1ZB 1H3PH 1QA9B 4QRPD 1PBYA 2OL3A 3OR6A 1KN2H 4GRWF 2DIAA 1MIEH 1KEML 4I0PD 1L0XA 2DQGH 4HC1A 4J3UA 1MVFA 2Z8VC 5GZOD 1RZJC 4PPTA 2OYPA 5B3JF 4XVTL 1QEWB 5JXAL 1OSPL 1VFBA 2GJ6D 3TIEA 2GCYA 4NCC2 5D2NB 5CWSA 2VISB 1ZA6B 1NBYA 5DK0B 2ATPB 1UCTA 2X4RA 4P59L 3C6SB 1T5XA 3VFGL 1UG9A 3FO0H 3RVUC 3VD9A 1NCAH 3O81A 1QRND 3B2UD 1JI1A 1JF5A 1ORSB 3FCTB 2ICEA 1TZIB 3AB0B 4PY7B 4DUWA 3GKZA 5FO9A 1PQZA 1PKQE 5F9AC 4F3FA 2BRRL 3O2DL 4XVUD 3SE3A 3VFVA 4ZPVA 1YC8A 2CDGB 3LKNA 1NEZA 1RZJH 2VSDA 5K9JH 4KFZC 2VXSH 4PJGE 4AT6A 3HG1B 5I1AB 3MA7B 1FC1A 1T1WA 4LLYB 4ONHA 3TBYB 1LEGA 3ZE1F 5DEZA 5AWNH 3CZFB 4HHAA 3UDWA 1ED3B 1Z9OA 1K4DA 1QZ1A 4AQOA 3S35H 1P5UA 4RNRB 3ARRA 2RFXA 2EIZB 4DZ8B 1N5YL 1HHJA 4IMKA 1V8HA 1WZLA 3O45A 5EO0A 5BW7C 3TO2B 2VQ1B 5JW4M 4H1LA 4HFUH 3O8XC 1AO7A 4RA0C 4LSSH 2V9RA 4YEFA 2QQLL 1UKSA 4KC3B 4LRNH 3RZCC 1U58B 5IVNA 5E9DD 1OLLA 3F12B 2J1KA 2Y07L 1R5IA 2BVTA 1UWGL 2CXGA 4HS6A 3KPRE 2EE9A 1BEYH 2BNQA 2OMNA 2XN9B 1I1YB 5D7SH 1MHPH 2I07A 3DRTA 1JNHA 1A7PH 3B2VL 1DN0A 4UU9A 3IU4L 3ROLB 4JQXA 1TCRA 4HWEL 5DHVH 1N6VA 1I8IB 4LBEA 5ADOH 1VHPA 4QHNA 4IRJB 2IFGA 2J8OA 3IJYA 5J9PB 1XIWD 3O2WL 4JJHA 3HR5B 1X5ZA 4NYLA 2VAJA 1N5AA 4Y7MA 3ULSB 2P48B 1KPRB 4YWGL 4MS8C 3O6KL 3LPFA 5E24E 1S9XB 2IPTL 3OXSA 3QEHB 1KTLB 1PY4A 1VGEL 3MV8E 4QF1A 1JV5A 5I19H 3MV9B 2UUDK 5LAXA 3BSZL 2OI9C 4NFCA 4EVNA 4Y4FA 4NWUH 4GAGH 1JHKL 5KSAA 2PTTA 4RCAA 3L3DB 1I3VA 4ZUTB 5IBTL 1NFDF 4OLWL 2UVEA 2C3VB 3T2NL 4PJAB 3H42L 2VZ1A 3IJSA 4X9IA 4ZPTA 4F33A 2P5EA 2PYEB 4PJCA 2HLFD 1X4XA 1QBML 2VYRE 3OKNB 3FOLA 3H0TB 4KDWA 3PDOB 1GHFH 2A6DB 4ZYKA 2XG5A 4M61B 1DBJH 2HRPL 1T66C 4MJ6B 5GRYA 3F7VB 3FO1B 1QSEA 5EG6C 5L2KE 1H3GA 3MRQA 3FTGA 3HE7D 3T0EE 4JM2B 5E6IC 1MUJA 1FSKC 3WUWA 2YRZA 4TQEL 4P5TC 3DIFA 3BPCB 1C7TA 1I75A 3PNWB 3PWPE 1CGXA 4TVPD 5I71B 4TSBL 1L9MA 3NN8B 1JHLH 1JN6B 4P2OC 3CXDL 1Q8MA 4O51A 1S9VB 4GAYA 3WFHB 4JFFE 3MO1A 4J3XA 5D6CB 1JWUA 3HPLA 2Y23A 5EIVA 1NGZA 1JYVA 3WNOA 3T0AA 3MRRB 4Z7WA 2HYMA 1F02I 1WZKA 4GBXB 3MR9A 1KEMH 1U2HA 3I02A 3C8HA 4XVTH 5JXAH 3MV11 4OSUH 5IEKB 5E99L 3ZYIA 2NY5L 2MQ0A 2E7LA 1S3KL 4RGNE 1CICB 2YPKB 3BD4A 4G80A 3RHWK 2B2XL 3RP1A 2OZ4A 2F53D 4ZO8A 3D85D 5C0EA 1UJTA 3ULVE 4WI4A 4P59H 5GSRA 1DDHB 5K9KA 3VFGH 2Z91B 5BZDA 1UXSA 4RWHA 3RX8A 1HDMB 2HH0L 4QRTA 4LVEA 3PWLB 4HFWB 4KJQC 1YN6B 1UZ8B 3TO4A 1A6WL 3DOSA 3O9WD 3QXDA 1XGRB 2OP4L 4BQ6A 3H9HB 5TQ0H 3TZVA 2CD0A 1MHHA 1JGLH 2BRRH 3O2DH 5D1ZA 1AGBB 4NQCB 4ODTL 5E5MB 5MENE 2FJGB 3FB7A 2OR7A 4YHML 4OGAC 4WTZA 5SWSE 1TVHB 4GW1B 3ULUE 2OQJA 4IEFB 1SYSB 2JJTC 5ELIA 3OR7B 3VE0A 2IPUK 3QCUL 5F7LB 1OT2A 1BOYA 1XGTB 3VFNB 3Q6GH 3QIUC 2DYPB 4YBQC 3G6DH 3FQTB 4JZJA 1WBZB 3MYJB 4IBLT 5FCUH 1CFBA 5D1QA 5HD8C 4ORZC 1U8QB 5D4QA 4BSJA 3SDCA 4D8PA 3MRKA 5ICZA 4U1MA 2C3XA 5EBWA 3TVMA 3O11A 3OJMB 1LDPH 3STZB 1U6AL 1ODAA 2YEZA 4OZHE 3T3PF 1KFAL 5I75B 1N0XL 3MBED 3C09C 3UC0H 3VD3A 3IKCA 3VXSA 3EOTL 4P2RA 2YPLD 4QHLB 4A2MA 5DJ2A 2PCPA 4GW5A 1AY1H 2DLTA 1OP3H 2Y07H 3QT2A 4LLUB 1BBDL 5EBMB 1HN1A 3L5HA 1X9QA 1M7DA 5ADPL 3ISWA 4MLIA 4F37F 3CFKB 3VRJA 4WUUB 4X5WA 1JZ2A 1KJ2A 3IU4H 5D6DC 3V5KB 4UDTB 4HWEH 1NUDA 3IETB 4C83B 3PIQB 5C0GA 1R5WA 1B6UA 1QPXA 1UT9A 4LIQL 5H94B 3FO2A 1U3HB 2N1KA 5JPNA 4M4PA 4ELKB 4Y4HD 1ZHBA 4HJJL 2JB6A 5DWUH 3PGCA 2BNRB 1YEKH 4ZUVA 3VD5A 4XXDB 4R3SA 3WO4B 2PW1A 3OKKA 1EFXA 4LCCB 1IEHA 3HRZA 2XV6B 1FNGA 4DTGL 5IKCA 5D2LB 4YWGH 5BCAA 4PJFB 1NAKL 1P7KA 3O6KH 4CADB 1FYTA 1YY8A 2IPTH 5TE7H 1HQ4A 4R0LA 4G42B 4OLUL 1VGEH 1OAUL 3DGGA 3EDFA 4MYWB 1NGYA 3RL1B 1DUYA 1U8NB 4NIKB 4XCYB 3BSZH 2WIIA 1QACA 4MCZB 1P5VA 2EICA 3D5OF 2R1YB 4ERSL 1JHKH 2X4SB 3TC9A 3TWCH 3CVHL 1EEZB 3KXFA 1NKRA 5IBTH 2YOCA 3FQRA 3IT8D 5J4MA 3T2NH 3H42H 3IJHA 4PIRF 1QNZL 2XN9D 5ICXB 1FG2B 1FVEB 4YDVA 3VA6A 3HE6D 5E00B 1QBMH 3HHRB 4K7FA 1J88A 1K6QL 2XI9A 4PREA 4Y8AA 3U0WL 1RZKL 3V6ZA 3X14B 3BO8B 2DQTH 2I27N 3WFEH 3U6RB 1EO8H 3RUGE 1M71A 4PYGA 4HKJA 3JV4A 3ARFD 3T1WA 4S1RL 4X9BA 4I0PC 3P40A 1KEGH 2WZPD 5GGSB 1PJ9A 2J6EH 4TQEH 1C16A 2BSRB 3T1FB 1UJ3B 1A0QL 2NYYC 1DANU 5BV7B 1UWXH 5JXEA 2ESVB 3CXDH 3MV9D 1NFDA 1CGTA 1MFBL 1F8TL 4EQ3A 1SVCP 1DE4B 5CD3A 3QUKB 1DEEA 1FL6B 1W2KT 2AXGB 2VZVA 2UY6A 2YD6A 2I9LB 3BOVA 3N50A 2FATL 1QR1A 2DOCA 4PJEE 2DN7A 1EAPA 1I7TA 3MNVA 4EI5C 1UM6L 4QRRE 2FEDC 2E9JA 4GKZB 5CUSL 5IHZA 2NY5H 2PYED 3BP6A 2DQUL 1IAIL 2B2XH 1OTUD 4XRCA 5CZXC 5CJ5A 4DVBA 3AM8A 2GSGB 3DLQR 3MUHL 3KPTA 4YK4C 4FFWD 5DSCA 1TPXB 3MJGX 3NCJH 4ZQKB 4MQSB 3E6HB 2HH0H 2WQRA 4LFHG 1UH4A 4L3CB 4U6YB 5EUOB 1H8NA 4IRSA 2AEPH 2OP4H 5B38G 2OCFD 4QHMA 5CMAB 2LV4A 2C7UB 4A6YB 3IDNA 1T0NB 3LKOB 3OB0K 4R96B 1AGEA 2X09A 1KSRA 4ODTH 1OGTA 5DJ0B 4NUJA 1FJ1B 4CMHC 5EO1B 2Q86A 5DMGC 4HH8A 4PJ8B 4D3CH 1EJ6A 4WV1A 4W70A 4KJWC 3Q48A 1U41A 5C86A 1NAMB 1CL7I 4S1SL 1O5DT 3QCUH 1T21A 3QEUB 3RHWF 4NKDB 4GBXD 2YD9A 1CIUA 5B21A 4NPYB 3OX8B 5FF6B 5AD0A 5DFTA 2I26N 3BPOB 1N8ZB 3FQUB 3A6OA 4OF6A 4RMQA 4QYOA 4QRQB 1IQDB 1ZOXA 3DUSA 1FVCA 1REIA 3BUTA 5CEZE 1CICD 1U6AH 5DGRA 1RJYA 5GS1B 3MRJB 3QUZA 4U2YA 1UVQB 2VZTA 2CDEA 3EOTH 1U8KB 4X8JB 3S34L 1SJVA 4PRPB 2VKXA 5K9OB 1I8MB 2EDDA 4UDUB 3KNBB 3TIDB 1OCWL 1BBDH 1GGUA 3LD8B 4C57C 5ADPH 3QIBB 1G7LB 5IMMB 3IDMA 2CIIB 3SN6N 1S7SB 5F97E 2CK2A 1BJ8A 1NBQA 4LIQH 4TN9A 4UTAL 5DQJA 5CJQL 3TPKA 3PJSA 3GMOB 4Z9KB 1FFQA 1R3IH 3I9GL 4CVWA 1T2QL 3EJYC 1XR9B 4RRPA 1NJ9A 4IJ3B 1BFOA 2YMXL 4MJIA 1OAYH 4L4TA 4DTGH 4YHZL 2P44B 2AJ3A 4LDLB 4H8WL 3FN0L 3DO3A 1VACB 4OLUH 2GITB 3DSFL 4K3DH 4YDIL 1U8LB 2FIKA 5HGBB 2JK5B 4F7MA 4ERSH 2V7HB 2F58L 3TBWA 1F3JA 1HQRB 3H9SA 4NO3B 3LVEA 4UINL 4APQA 2FNBA 4NRXB 5ANMB 3S8WA 4XCEB 3N0PB 4OUUA 4U3HA 1RHHB 4WI9A 1XFPA 3B3IA 4MQXD 3SO5A 4TPRH 5HHME 1QNZH 2G75A 3KS0J 3LN5A 3KG5A 4WUUD 4YHPB 3VFOA 3T2PA 2G2RB 3D39E 5HHXL 1I1AB 4U6VL 2VLKE 1TENA 1NBZA 4PD4J 3GIZL 4NO0D 1AQKL 2Z35A 4MNHA 5DJYB 3L5WA 4OZFG 1JPTL 5LGJA 4PJBB 1S7UB 3CCHB 4S1RH 2BNRD 2YK1H 5D7LA 5KS9A 3MRLB 5I8CB 4ZSOA 1A14L 1IC7H 3QDMB 7CGTA 5IMOB 1VADA 3GSVB 4YX2L 1YMHA 4QRPA 3TA3C 4XC1L 3DO7A 1H5BA 5HVHC 3RWGB 4RFEB 4WTXA 3S3SA 1K2DB 1S5HA 4J12A 4ACPA 4AQ1B 1LEKA 4JVPA 1MFBH 4TVPH 4AG4L 3IF1A 1CXFA 1S7WB 3UYRL 3LKQA 3VRLE 2X4OA 3KYMB 2GJ6A 3HZMA 1HWHB 3BN9C 3ARUA 2FATH 3P3YA 5LBSL 1EHAA 5JTWA 1NGWA 3HI5H 5L7XL 3ZO0A 3C6LB 3DGCR 4KZEL 3KPQB 2AS5M 5KBNC 3C60D 5F9WB 5IROC 1I1CA 1IAIH 3ET9F 3UBXI 2QJDA 1F5WA 3HZYA 5D96C 5INCB 1YEDA 3LSOA 3SKUD 3F58L 5DT1L 3GMQA 4AZ8A 4F9PC 3FRPG 4PGEB 4J3OC 5KZCB 3SKOB 3ZKQD 4ELMB 3VG9C 3ARTA 4R4ND 3O3EB 4CJ0A 3BPLB 1OF2A 3F5WA 1FNFA 4YGVB 2ZSWA 4TNVK 5I1LB 2X9YA 2DBLL 4L8DB 1QPPA 4HLZG 4M8QB 5SWZD 2WP3O 3N06B 2EDYA 4QY8A 3AS0A 1CBVL 3M17A 3VGGA 3BRDA 4G6FB 3MLUL 3MBEC 3MLYH 1J8HA 3KPMB 5LKNA 1UZ6F 4LSRL 4LNRA 5D7IB 1U8IA 1YEFH 4OQTL 5HPOA 1IM9B 3QQNA 3DXAE 4S1SH 3EHBC 4KK9D 2VDMH 2HT4C 4M5YH 2FH6A 2L7UA 5HHOE 3LZFL 1I85C 2EIDA 1A9EB 5HY9B 4JO2L 1GAFL 1T2XA 1UM5H 1N4XH 1GOGA 1JWSB 2W1NA 3VXMB 3GMRB 1OAXL 5DJXA 2BVOA 3I75A 1E6OH 4U1KB 1KXTB 2IQAB 4E9LA 2ZSVA 3FJTA 5GHWL 3RWHB 1YJDH 3J7HA 1KJMB 1OQXA 3PL6A 4ZUUA 5T3ZE 4Z76B 5F1OB 4OI8A 3W0WB 3QEQA 1MRDL 1B0GB 5EBLA 4F7EA 1KXQE 2W91A 4Q9BA 2WBJB 1XIWA 5TQ2H 5DF0A 3EGSB 4JRYE 3MLTA 4PJ8D 1CD1A 1MPAL 1ZHLA 3N1FC 4L8SC 4LP5A 4UTAH 5CJQH 3TBTA 4YZFF 1DZBA 3I84A 4Q7DA 3LB6D 3I9GH 1Z5LB 3HI1B 1T2QH 1JGEA 4LARL 5F7KC 3L9RB 3UPRB 4JN1H 5L88H 3CVHA 3TNMA 4QCIB 1O7VA 5KJRL 3B6SB 3CVIH 3QHZL 3OV6A 4H8WH 2FD6L 1SMAA 2W07A 3G5ZB 4D9LH 4P9HH 3RWJA 3K4DA 3S5LG 5ID0B 4MWFB 3RVWD 1DVFD 5IOPA 3ARFC 5FO8A 1MCLA 4PRPD 3W2DL 1E4JA 2WSKA 4WJ5A 4N0UB 4HWBL 1R3LB 1T7YA 1VFUA 4KI5D 1GOHA 3ZTNL 4R7DA 1G9MH 4YC2B 1PLGL 5JW3L 2DIBA 3T65A 1ROWA 1E4WL 3AAZB 3NCFB 5HYQB 3KJ6L 1G7QB 4ONGH 4QKXB 5GGSY 3JTSB 1HHKB 2ZUXA 4ODSL 4YHKH 1AGCA 3HE7A 3PWUB 1S5IL 4LRIA 4PLKC 1AQKH 4UAOB 1JPTH 5ILTL 4GRMB 1JZ8A 2VL4A 5EORL 2EYSB 3S88H 4JM2F 1IJ9A 1C08B 5IVZA 3NAAL 1A14H 2IBZY 4HIJB 2H2SC 1WAAA 3ZHKA 3WJLC 1XF2A 1GZPB 4OI7A 4YX2H 1XF3A 1MY7A 4CVZB 3O4LA 5CSZA 3DX9A 4XC1H 4N9GA 4HIHA 1JRHI 4NNYB 3U9PL 5F3BB 3F8UB 4O5LL 2D31A 2W92A 5JA9A 5J6GA 2CO7B 3GNML 3EAKA 3UYRH 1E27A 4WFEE 2HTLD 5I0DA 2IFFL 1CFTA 4E0RB 3ARGB 1VCAA 2ITDA 5LBSH 1L6ZA 1LMKA 5F9DC 5GRXG 2F53A 5LXGL 5FO7B 3FONA 4JDZB 5KG9B 5L7XH 4E5XA 3MX0A 4ODXB 3TPUB 4EIZC 1ZLWH 1EEYA 2W9EL 1I1AD 3WIFB 4PRIB 2R0KL 5DR5H 5C0NC 3CFCL 2VDQL 1R3HA 3O9WA 1QSVA 1KULA 4CW1B 4JG0L 4NJ9L 1ZLUK 2GT9B 5F7HA 3L3OB 3QDMD 4Z7VB 3U82B 2DBLH 4ODHL 5ISZB 5EN2A 3KGRA 1DQLH 1T1ZA 1QA9A 1CBVH 1DQDL 3LS5H 4JGJA 2XRAH 4OB5L 3BYTA 3OPZL 5BV7L 1QBLL 3P9WB 3N85L 4MXVE 1QEWA 4L9LB 1B3JA 5FKAB 5FM5O 5I1JL 3S3PA 4FQHB 3O2VH 3ROOB 5D2NA 4IMKC 2VISA 5HYJE 1QUNA 1ZA6A 3QUMB 5FHAL 5DK0A 2ATPA 2HRLA 1GAFH 3OAZK 4WWKB 3C6LD 1R0AH 4P99A 3ZDYF 4Y5VB 5E5UB 4GUPB 3C6SA 4HT1L 3D25B 4LPYA 5KOVC 1MCSA 1OAXH 4P4KC 4QXGL 4TNVF 1ORSA 4BH7B 3FCTA 3OGCB 4GFTB 3QO0B 4E41B 4PY7A 1TZIA 4HSQA 5I8KL 5GHWH 4QRSB 4CKVX 3EDJA 2LTQB 2HLAB 2ZCHH 5AZEL 4JFQB 2CDGA 5C0IB 1QSFD 3DVNB 4P46C 3MRIB 2YWZA 3HG1A 3L3KB 4MDIB 1MRDH 3GB7A 5I1AA 4NKQB 3MA7A 4LLYA 4F15C 3TBYA 5DJ6B 2XZZA 5LG1A 1OL0A 4A6YL 3CZFA 4XTRD 3VD4A 1ED3A 5JW5B 2B20A 1TJIH 3QIWD 1H3WM 4RNRA 1MRFL 5C09D 3UTQB 1BZ7B 2EIZA 4DZ8A 3KS0H 5J12B 1FFNB 4LARH 5C0AB 4MQXC 1S78D 2LU7A 3UZVB 3AY4C 3TO2A 2VQ1A 1NAML 4X7DC 2NMSA 5KJRH 3QHZH 1BJ1H 3SGEI 1EJOH 5D2LF 5JHLH 3SDDB 2Z93B 2EH8L 4FFZL 3VXMD 4ZTPL 2FD6H 3MYZA 3RDTC 1U58A 4R90L 4WW2F 4X80L 3EJZC 3F12A 1BHGA 2NX5D 3FT3B 1AH1A 2F54E 2VABB 2HFGL 2P8LB 2XN9A 1I1YA 3OKDB 3MA9L 4U1JB 1QKZL 3ROLA 1HZHL 4WGVB 4HWBH 4OCSL 4XNXL 2ZNXA 1IC4H 1PLGH 1Z9MA 1PKOA 5JW3H 1EZVX 5CGYC 3INUL 3C2AL 1I8IA 3JWDC 1VFMA 4M6NH 4MAUL 4WI5A 4IRJA 4RFNB 1E4WH 4NNPL 5J9PA 3KJ6H 3LHPL 3HR5A 4ODSH 1YUHB 2BJML 2R9HD 4TVSa 3ULSA 5AAWA 1I3RB 3W5NA 3VH8G 1CG9B 3QI9C 1KPRA 3NIGE 1S9XA 4UQ2A 1CGYA 1G9NC 3QEHA 1KTLA 4EEEA 5FUZL 1SYVB 4LHUB 2AV7B 3MV9A 3T4YB 3TJHC 1F4WH 5EU3B 3D87B 4O5LH 3L3DA 2GHWB 3RWIB 1BREA 4ZUTA 1HHHB 3VG0L 4H20H 1OY3B 2XICA 2C3VA 4O2FB 4PJAA 1NGPL 1AHWC 5C6TH 3QDGD 3DMMB 3QYCA 1KTDB 2PYEA 3TYFB 4J4PA 1J12A 3OKNA 3H0TA 3PDOA 2A6DA 4M61A 4MJ6A 3AREC 1DANT 3F7VA 3FO1A 1OP5H 5MEQB 2W9EH 2EE3A 2R0KH 4JM2A 2NXZC 5TH2B 2VMFA 1TTFA 2VDQH 5DRWB 2ZG1A 4NQDB 1JNLH 4PB0H 1KIQB 2BXZA 3BPCA 4KK9C 4MA8L 3PNWA 4JG0H 1N3NB 3MRHB 4OQTA 1XF5B 1KB9J 1T2JA 3NN8A 5D1ZC 1JN6A 1KPVB 5F8RC 4JRXB 3TEUA 3RNKB 1S9VA 3WFHA 2OX5A 1DQDH 2X70A 5IT2L 5D6CA 2KH2B 1KLGB 3QUYD 2VXUL 1CTNA 1QLEL 3MRRA 2OK0L 5D1XB 4GBXA 1YMMB 1CE6B 1BECA 4LASL 4M6OL 4OB5H 2B1AL 2E7BA 4AEEA 4U1NB 5BV7H 1QBLH 3N85H 1ZA3B 3VXUD 5IEKA 3SDCC 2XZAL 3ARGD 3QH3B 3LN4B 1CICA 1OHQA 5T5FH 5JOEA 2GUOB 3LS4L 3UTPE 1AFVL 4R6UA 3TP4A 5D7JB 1L7IL 3VD7A 1DDHA 3X3GL 4HT1H 2W59A 2Z91A 1Q72L 2IH3B 4L8CB 1HDMA 5IW6B 4QXGH 3WNKA 4MA1B 3PWLA 4HFWA 1YN6A 1NCUA 1UZ8A 5DLML 4JFDB 1XGRA 1LO4H 1OAKL 4XNZB 4X83A 3FB6B 2AKRB 1GGIL 1LK2B 4NQCA 3S98A 1KIRB 5E5MA 1OTSD 3PHQB 2FJGA 1J87A 4R2GC 5E2UL 1TVHA 3SGJC 4HUUB 4XCNB 1I9JL 1SYSA 3OR7A 5JQHC 2NZ9C 5J8OA 2DQHL 4R4FL 4XPFL 3FT2B 4JRWA 3VFNA 4A6YH 1NLDH 2DYPA 5LVEA 3FQTA 5KSUB 1WBZA 3MYJA 4KVNH 2AI0L 5CAYB 1U8QA 5MEPB 5FM4A 2C5DC 5CSGA 4DGVH 3SDXB 1AR2A 3STZA 2UWEB 2A9NL 4KHXL 2GJZB 3TT3L 1NAMH 3EFFB 3F7YB 4NHCL 3AC0A 4HS3B 3QG6B 5CP7B 5MI0B 4GMTL 4JANA 4HWBA 4FFZH 2EH8H 2NR6D 4JB9L 4ZTPH 4QHLA 2XZCH 4JHAH 5EU6B 4R90H 4Y16D 4X80H 5TDPB 4D9QE 4P3WA 3PWJB 4LLUA 4QTHB 4X6CB 5EBMA 1ACYL 4E41D 5C2BL 2HFGH 4ZXBC 2MQ3A 1Z0MA 3MOAH 1FPTL 1JNNH 3CFKA 3MA9H 4WUUA 3C5SB 1K5NB 3TFKC 3V5KA 1YEGH 4UDTA 5GJSL 4OCSH 3IETA 4XNXH 3KPOB 4C83A 3PIQA 2B8OT 3INUH 3C2AH 4NO0A 2WWMC 3U0TB 1F58L 5H94A 4NNPH 1U3HA 3LHPH 4ELKA 4U49A 2XFXA 1T7WA 1OARL 2XOTA 2BNRA 4YPGB 2ZUTA 4XXDA 1GJIA 3DWTA 3CSGA 4OFPA 3CFIC 5EOTB 5ECJE 4LCCA 2NY2B 1TTUA 5D5MB 1VFAB 5D2LA 4PJFA 5C0AD 4CADA 5HHQB 2DMBA 2G9HB 4G42A 2XXMB 4Y1AB 1IM3B 3RL1A 4M7LT 1U8NA 2K7PA 4XCYA 4Z7UE 4MCZA 4OF0A 3SDDD 2OSLB 2R1YA 3HC3L 2IH1B 1T83A 2X4SA 4EN3B 4AY0A 1EEZA 5F72S 4KK5D 3BISA 1PW3A 5KANG 1GSMA 5ICXA 2CRMA 4YHLL 5J1AB 1NGPH 4O58H 1FG2A 4GG6A 3ZHLA 1FVEA 4TVPE 5DJAB 5E00A 3BVNB 3G9AB 3KHQA 5KSVB 3ETBF 3X14A 1WBXB 5C07E 3BO8A 4XXCA 3V0WL 3U6RA 1DQQB 2H8PB 5L6YL 1MFEL 4ODBD 3VXRB 1A3LL 4H0GA 4LGPB 2XWJB 1JIBA 4YHIB 3SJVE 5GGSA 4IMLB 4IRSC 1Z0NA 2BSRA 4KWUA 3T1FA 4MA8H 4ELMF 1Z9SA 4LVNB 1TXKA 4OCYH 4G7VL 2DRUA 2D0HA 1X5KA 4GLRI 1BAFL 2CLZB 3AROA 4WFHD 1JMXA 1DE4A 4LU5L 3QUKA 2VLJB 2VXUH 1FL6A 3RVVD 1QLEH 2OK0H 2AXGA 2I9LA 3A67H 3QZWG 5CJOH 5D7IF 4XI5D 4LASH 5DFVD 2B1AH 1RIVH 2Y5TB 1BX2B 4K71B 4Q9QL 5FYLE 4F7PB 4L29B 1U2CA 4G9FB 2ED7A 4GKZA 4LAQH 3S96B</