1KJMB

Tap-a-associated rat mhc class i molecule
Total Genus 13
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
13
sequence length
99
structure length
99
Chain Sequence
IQKTPQIQVYSRHPPENGKPNFLNCYVSQFHPPQIEIELLKNGKKIPNIEMSDLSFSKDWSFYILAHTEFTPTETDVYACRVKHVTLKEPKTVTWDRDM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords RT1 class I histocompatibility antigen, AA alpha chain, heav
publication title Crystal structures of two rat MHC class Ia (RT1-A) molecules that are associated differentially with peptide transporter alleles TAP-A and TAP-B.
pubmed doi rcsb
source organism Rattus norvegicus
molecule tags Immune system
total genus 13
structure length 99
sequence length 99
ec nomenclature
pdb deposition date 2001-12-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1kjmB00
3T1WA 5IF0A 4QXTB 5GHWH 5BQ7B 3B2VL 5E4IA 1RZJH 3EOTH 5I6XC 1CICA 1J18A 1DZBA 1MPAL 1Z9MA 2DWEB 1NGXA 1R3JB 3TC9A 2XTJC 1CDUA 5L2JA 4S1SL 3SEPA 2YPLA 1EFXB 4G7VH 1I1RA 1R5IB 2Q8AL 1C7TA 3GJFH 4P9HH 4HBCH 3C60A 3EOYG 1MI5B 4M5YL 4OFIA 1CBVL 1FNSL 1KBGL 2R1YA 4HJJH 4BELD 4I3GA 4XHJD 2FATL 5CMAA 4MSWB 4X4MA 2H9GA 2KPNA 2NXZD 4N0YH 4XP4H 3OKMB 4Y2DA 3ABZA 5C0ND 1V05A 2J8HA 4P46A 5K9KA 1X5XA 1F4XH 1A0QH 3HNTL 5IFHL 1U8KB 3TN0D 4CJ0A 2ITDA 5IKCB 1PG7L 4IMLA 2BC4B 5I16A 3C5ZC 1SBBA 3PHQA 4V1DD 3EO1B 1NAMA 1WAAF 3VI3E 4PJDE 4ONOA 5J4MA 1EUTA 3RY5A 4LFHG 4XNUH 5CSBA 2Y9RT 5T3ZH 4EZMA 4XGZA 4DCQA 4PJ7B 4JPIB 1OCWH 4PJ5E 5KVFH 2KBGA 3DO3A 5CZKA 3QWOA 4ZSOB 3H3PH 2YPKA 2PW1B 3FRPG 4F7CA 3KLAA 4WFFD 5F1SA 5CJ5A 4PJEA 1NEZG 4N1CA 3AM8C 3DURA 1J12A 1PQZB 3Q3GA 5I74C 1L0XA 4JCLA 1W0VA 4QGYA 4I2XA 4R2GD 1YY8B 2E7LC 2OLDA 3PL6D 2GYSA 3LEYL 4NZTL 1I9IL 3EFFB 3GRWA 1AE6L 4Y16D 2BFVL 1GRWA 5I1JL 4MZ2A 4KJQD 3ZKXC 3T2NL 4WI6A 3EO9L 1RZ8A 1YNLH 2BSED 1RIHH 5ECJE 3JWOC 1F3RB 1T5XA 2B1HL 4ZFZB 1WF5A 1TNNA 4NPYA 1T0NA 3G6AB 4KVCL 2X4OB 4KHXL 1FZMA 3CVHB 3FO9B 4DJMA 4QRQB 3RTQB 1HOCB 4HKZB 4GXVL 1IQDB 4UDTB 3VFWA 2XZZA 4KKAD 1TJHL 4FTVA 4MX7B 2BDNH 3CFJA 1KEML 2Y23A 1CICC 3C6LB 4UOW0 4FMKA 4XPHL 2YWYA 2LE9A 1X4YA 5DUMH 2MPAL 1HXMB 5FYKL 4OQTH 3U82B 2OR9H 3C60C 1CD1B 4K7FB 4XBEL 5CSZA 4QXGH 3D0VA 1UXSA 2NTFA 1UC6A 4H0HB 4K7PY 4DK3A 3TBSA 5ANMA 4YAQB 3DROA 4JE4B 1A6VL 1JP5A 4QRPA 4OCSH 1YEEL 3BT2H 1L0YA 3MJ7B 3O9WD 4Y2DC 4P46C 5JHDB 3N9GL 4YJZL 3LKPA 3BOVA 1MEXH 1KCUL 4MA3A 5FIEA 4LLVB 5D1QD 1A7PH 2D31A 2VXTH 4G6AD 2NY4C 1SBSL 5C0EA 4JFPB 4WFED 2A6IB 2DQJH 1BEYL 4WDIA 4QCIB 3V6OA 2WBWB 3ROLB 1IEHA 4LBEA 1HI6B 4UBDD 3L5WB 3RNKA 2FX8H 3BPCA 1FCGA 2CMRH 2VDOL 5D4QA 3UPCA 1VKXA 3CVIL 4P5MA 3IDYC 3ARDD 2R2HA 4JFEB 3TA3D 1QACA 4S1DC 1QZ1A 3BW9A 5I76A 4AJ0A 5KSBB 2FH8A 1DEEB 4QHKJ 4X5XA 1J1PL 3HZMB 4Z77A 1FNHA 1P2CA 4JZJB 1G9NC 1ETZB 4KROC 2X70B 4NQSA 2M26A 4GQ9L 5E56A 4BZ1L 3TIEB 4PRDB 1OPGL 2JCCE 3QFJA 4G80A 3IETB 4L4TE 3TFKC 3A6CL 3SGJA 3O3UN 4BK4A 5JORB 2EZ0D 43C9B 3G9AB 2FIRT 4ALAH 5E4EC 2HT2C 5L7XH 3S4SB 1U8HA 3JWOH 4KKLC 3TN0A 1SMOA 2APVA 2Q3ZA 3OG4B 4V1DA 4OB5L 1MHHA 1S7RB 3IDNB 4R26L 3T4YB 4UQ3A 4OD2B 5BZDA 3N1MC 3GSNL 3MLXL 4YO0B 4R6UA 3MOAH 4OLUH 1TTUA 2GI7A 1ZV5A 3KYNA 1GZQB 2EECA 1FN4B 1K2DB 3PWPE 3MFFA 2K1MA 3VG0L 1W72L 3QIUD 3QNYA 1MHCA 4NC0B 5EC2B 3LVEA 1F90H 5DXWA 4X6BB 5GXBB 1IAKB 2CDEB 2V5TA 4G9DB 4DVRH 4GLRI 1NC4D 3E0GA 4ONHB 3QDGD 4BZ2L 4PJIE 4OZFB 1YEJL 2VIRA 4OF3A 3EAKA 5LBSL 1U8PB 4YDKL 1BBJA 1QRNE 4HIJA 5J6HA 4QF1A 3PL6A 4AG4H 1WZKA 5KW9H 3GSOA 4ODVL 5MP6L 1MAMH 1FORH 3X3GL 3NA9H 2LVCA 5KZCD 4F33B 1FVDB 2V5RA 3CPLA 3WL9A 2ESVB 5F6IC 3JXAA 3OX8B 2V7NA 4QYOA 3MV7D 5BS0E 1RAMA 4ZOCA 3K74B 1NAMH 4XPFH 3V6OC 2OSLB 1EMTL 4LCWB 1W0YT 2AEWA 4ZMAT 1RUPL 1AGFA 5F7EH 4TUOB 1XF2B 5HDQL 4HUXB 4NO3A 5LWYH 4PBVC 1PY4A 1HZHH 2BNQD 4NQED 4OZHA 3HE7D 1D5IL 3NCJH 4FXKA 1K3ZA 4JHZA 2E8ZA 2J8UA 1LD9A 4CAGA 1IGIH 4XBPB 1WWCA 1J88A 1NL0L 1ZHBA 1OAZH 4MD4B 2VQ1B 4ZUVA 1MJUL 3O11B 1QNZL 3ZKQD 3GMNA 5IK3B 4P5TA 1ZS8A 1RV6X 1HHJB 3RL1B 4X5LA 5HI3D 1G9NH 1OF2A 1I1FB 1YPZF 4WGVB 4YXHL 3H9HB 5JR1H 3KAAA 4XHJC 4X7SL 3GRWH 3SGJC 5CEZL 4RWYH 1JVKA 5D7KD 4NYLB 5INCB 4J2XA 5DHVA 4XVTL 2KUTA 3FZUD 1HCFX 3ARQA 5C0NC 3MXVH 3DARA 1MELA 3TWCL 5E0QA 1G7PA 3TN0C 1N26A 4PJ8B 4X99A 4ZS7L 4NQCE 2BVPB 5C09E 5E1AA 4Y5XA 3OKEB 1AGBA 4RISH 4Z7VE 3MRJA 4ZYKA 4NQCD 1QLFA 4OLWH 4U1NB 2EE6A 1OP3K 4ZUTA 4HMEA 1UVQA 4MNQB 4X6EB 3OZ9H 4DOHE 2FJGA 1DN0A 5F89B 1W0WB 4OKDA 3MO1B 4NIKB 1Y18A 4JLRB 4Y8DC 1WZLA 1A7NL 1L9MA 1WBXB 5DWUH 1CFQB 5C6TH 5HJ3A 3ETBF 1ERNA 1CTOA 3BP6B 3C2AL 1Y6NR 1NBYA 3TA3A 5JA8B 1IVLA 3G9VA 1CGTA 4IS6B 4XCYB 4KU1A 2F5AH 4DKEL 4J3TA 2P8MB 2A9ML 3J8F7 3LKNA 2VDRL 5J11B 2D7TL 3PL6C 5FGRA 2ZJSL 2R4RL 3FQRA 4YX2L 4LK4A 3MV01 4Y16C 4E42B 2EDBA 2W0FA 1ZLVH 3QG6B 2GSGA 2ADFL 3QDHA 4RCAA 4F9PA 3U46A 3SBWA 5ICZA 1T1ZA 2R0WH 3ZMRA 3FFDA 1FIGL 1JV5B 3MUGA 3TP4A 1UGNA 1P5VA 5JXED 3K81A 1WFNA 2VDNH 3IS1X 5B39G 3B3IB 4K7PH 4NC2B 4WO4A 1IKFL 2X2YA 1HIML 3FONA 1E4XH 4KKAC 1MLCB 1KNOA 1CFVH 2IH1B 3DUSB 2B2XL 5TDNA 3V4UL 1BREA 3HRZA 5FKAA 1SY6L 1JNNH 2C1PB 3A67L 1UM5H 2PTUA 5F9OH 4MLSA 4JFOA 1TNMA 2ED8A 3KG5A 3QIUA 4NKMB 1JE6A 1L9NA 3BE1H 4QGTA 5C6PB 3DRTB 4LKXB 5CBAA 3S4SG 2F54B 1T7ZA 5ID1A 1N5AB 2QR0A 1JRHL 1NC4A 3BJLA 1MFNA 3ULUE 3ZL4H 5FM5M 2KQMA 5EULV 3UDWC 2P8LA 2XZQH 3TM6A 3Q1SL 4O58H 3O9WC 1G1YA 4EUPA 2CRIA 4IRZL 1NLDH 4ODHH 3CCHB 1INEH 4NKDB 1MVUA 5K9QI 3NFNB 1U95B 1UKQA 5D1QC 2A9NH 2XNAB 5GSRA 2AK4A 2EDKA 4G6AC 1KLUA 3HC0B 1OT1A 3R4DA 3SOBH 1WTLA 4L8BB 4Y5XC 3ARYA 5E03A 3VFOA 4MQ7B 3RA7L 3MLYH 1QFPA 4DN3L 2NTSP 3H2WA 4X7TB 2IC2A 3N1FC 1S9WA 4BM7A 3WN5B 2A74B 4ZOAA 3VWKB 1B4JL 4LP5A 2BNQA 4NQEA 5HPMA 5DJ6B 4OZFG 3HE7A 1J10A 1NSNH 1LK3L 3OXRB 3IJHB 4GW4A 1TTGA 1ZVHA 1CL7I 4WFHE 1RZKC 2FDBP 3CUPB 1S7VA 3CXDL 2BVYA 5ILTL 3TA3C 1TQCC 4Z7WE 1G7MB 3HI1B 3NPSC 4BSWA 5GJTH 4WFHD 3RWCB 4GMSL 3HPLB 3T3PE 4JHWH 3WFBL 3BSZL 3PQYA 5AZ2L 2VLLA 1S9KC 5BXFB 4ZO8A 5DQJA 3NN8A 3MCKB 4HT1L 5CKAA 3MOQA 1RHHA 4OV6F 4YE4L 1FE8L 1JRHI 1FL5A 4PTTA 1CDYA 4YQXL 2X05A 4F9PC 1E6JH 2EZ0C 1F2QA 5D93C 4LCYA 1MIEL 1NFDF 2EXYD 1KIUA 3OG6B 3H9YA 4MQTB 1XGQA 3SBWC 2OCFD 2ZUQC 5C0CA 5KVMC 1NFDB 3ARVA 1J9CT 1KEGH 5DRNB 2NXYC 3SDYL 2X09A 3WFCL 3O3EB 2NY2B 1VSCA 3D85D 4PGBA 5J7CC 5JOEA 3QUZA 2X44D 3VXUD 1S7SB 1OAYL 1UCBH 5AYQA 2VLJD 4WO4C 5JDSA 2G75B 3QULA 3QIBA 4YZFF 3T04D 4UNUA 3V6ZA 2B39A 2CKBA 1IC7H 4X4YA 1KT2B 5A2JH 5ID0A 3QIUC 4OGZA 4YHLH 1NDGA 1SYVA 4HGKC 1DFBH 4JO1L 4RAVB 3DVGB 1LO2H 3UPRA 5E24E 1WTGT 2AJ3B 4GBXD 4PREA 3WV0A 1KTLB 1T1WA 4J8RB 1ZVSB 4OLXL 4D94A 3RHWK 2ICES 2XA8L 4UIKH 3MBXH 1CLCA 4KV5F 5C0IB 4X80H 4L8SB 1CVSC 1KJ3L 1U3JA 3AC0A 3L5HA 3ZE2E 5DHVH 5ICYB 2W07A 4FABH 4YEFA 4U31A 4RDQG 3GSNB 1XIWB 3GUTB 4FQ1H 3TZVD 4NRYB 3S96A 1W72B 1IL1B 3PIQA 1YEIL 2KL6A 4HWBL 3DPBA 5JXEA 4N0UB 2V2TA 4RIRA 3RWGA 5C0GB 1G6RA 3V2AR 3KLHD 5C71A 1Y6KR 3HE7C 1LNUB 4RMSA 2OJEA 2OTWB 3D3VB 4HUWB 2D7NA 4HPOL 4AH2A 3WDHA 2NY0B 2ZUTA 3NCYP 1C8PA 5D7JB 4MNHB 2EKJA 1CF8L 3MLRH 2J3SA 4JFDE 1CE6B 1BAFL 4C4KT 2PO6B 4UMGA 5C07A 5TPWL 4WW1A 4ZO6A 1B90A 2CDFA 4R7NB 2DLFL 5HI3C 4YUEH 1YECH 3OXSB 3PWNA 2WLZA 1KB5L 5FOBA 1MSPA 4HFWB 3AB0B 4U6YA 4KAQL 1ZSDB 1GGYA 2OX5A 2XFXA 4OIIH 3QJFA 3FZUC 1U3ZA 5HHQB 1CIUA 3E6FB 4P2RD 1H3TA 3NA4A 5IV2B 2OJZL 2FYYA 3WCYA 4X8JA 3S35H 5DD5H 4Z5RA 1C16A 3C87A 4O51B 2EE3A 2I5YL 3QUZC 1MHEB 5DJYA 3EDDA 4WY7H 3SPVB 4G8EA 5DUBB 2L7JA 1MWAA 3ECBB 3LPGA 1LP9F 5DMIL 1T22A 5DT1L 2P45B 1LP9B 4L4VE 4NDMA 4JHBA 5IWLA 2IADB 1FDLH 3O3BB 1ZEAL 2DN7A 1HH6B 1TJGH 3CSBA 4P3CH 4GSDL 4P99A 5F1NB 3FB7A 3RY4A 4X0KA 1I1AD 2VAAB 4L4VD 3OPZL 1VENA 5DK2A 5TJWK 1IE5A 4O4YL 4U1JA 5ISZD 1IEAB 3O6LL 5GHWL 4YGVB 3B9KA 3NABH 3OKNA 3EOTL 4NCC2 4DGIH 1JGEA 1KLGA 1IGFH 4KJYB 5J9PA 1I1YA 4P9HL 3QI9D 4HBCL 2MJWA 3KXFD 4HIHB 5T1KA 1XF3A 3VXSE 4LARH 1V8HA 4R7DA 4HJJL 3LDBC 1A21A 3U2SB 4Y88A 1KN4H 1KJMB 1XF5B 4PJ9D 5C0BB 1KIPA 1BZ7A 5IB3B 1XFPA 2ICWA 3VXSD 4N0YL 2F8VA 4B7IA 5K33A 5EO9B 5JXEC 5E2VH 5D1ZD 4HK0A 1F4XL 1A0QL 4AIZA 3D85A 4KZEH 4ETQB 3PWUA 1BD2B 5FM4A 3VXUA 1EAJA 2YBRA 3F58L 3U4BH 2VLJA 4H8WC 3I6KA 4KRNA 2VXSH 3HMXA 3WIFB 2YD6A 3GSWB 4OSUH 5DJ0B 4XNUL 2X4SA 4LAQH 2V2XA 5T3ZL 3VGBA 4FQQA 1JPTH 4YFDB 4Z7UE 4GKSB 1OCWL 3LKSA 5TDPB 5KVFL 1LE9B 3H3PL 1HKLH 3OAUH 1R5VA 3UTTB 3KPQA 4OBSA 1P6AB 4YHMH 5JW4Q 1XAUA 4LSSH 2ICEA 4LAJH 3T77B 1KOAA 1R3KB 4P2OD 4TSAH 4LHUD 3PG2A 4HCRA 5DGQA 1MCWM 1FZJB 4GAJH 1S7WA 3QXUA 5EBWA 2KKQA 1AHWA 4E0RA 2P44B 3K4AA 2C4FT 3V5HB 3O3AB 4N9GB 4GAYB 5GJSH 5IR1B 4P2CG 5D7IF 1NCNA 1YNLL 4ONFH 1RIHL 5CHNB 1QSEB 1BF8A 2FL5B 1FNAA 5IWLC 1QOKA 2VLKE 1G7JB 2CKBH 2WBKA 1RJZB 1CDBA 2H6PA 1T0MB 4PJXA 4Q9QH 1DUZB 3RIAF 2BDNL 1X44A 5ETUA 4CVXA 2ATPA 3B9KC 1B3JA 3CX2A 3IKCA 4MJIA 5MHSD 2B5IC 4MJ6A 1GVIA 1ZXQA 3FTGA 2R56H 3GMPB 1HKFA 4TTGA 1KC5H 1XGTB 1ZA6A 5DUML 2UY6A 3BX7C 3HPJB 1U93A 3KYAA 5AG9A 2XKSA 4OQTL 2ZSWA 2OR9L 1X3DA 3GBLA 5CGTA 4QXGL 3I3BA 4B41A 1GOFA 3LEXB 3CMGA 4WJ5A 4DEPB 5FKPA 1FFOA 4ZDHB 1DVFD 3IYLW 3T0BA 4H26B 2CDGA 2EXYC 3DETC 2OTUA 4OCSL 4P2RA 4PJAF 4BH8B 2ZNXA 2DD8L 4LHQB 4JDVB 4NZJA 1MEXL 4UILH 3QHTC 6FABH 1A7PL 3HFMH 2VXTL 1E4KA 5ICXA 5CBEA 3BEVA 5D1XA 1XGPA 5IBUB 4H8WH 5IEHB 4X4ME 3FQNB 1J8KA 1VHPA 2IWGA 4WUUB 2Y72A 3T3ME 4H1LB 3T4AB 4LLYA 5I1KH 5K9OB 1U3HB 2X1OA 2FX8L 1U8LB 3GSUA 2ZUWA 2X42A 4HULB 2CMRL 4JKMA 1BJ8A 1YN6A 4HKXA 3K1KC 3DWTA 4X6FB 5D9SA 5ISZA 4QXUH 2G9HB 2XA3A 2GCYA 4URTB 5GGUA 4FQXB 4RX4A 5IEKA 3WE6A 5I30H 2Y7QA 3ZTJG 1QLRA 4ZPTB 4YR6A 3QRFM 3I85A 5D5MA 1A4KA 2HLAB 2ZKHH 3MODH 3VXTB 1HHIB 3KXFA 5IVOA 4X7DC 4PJEE 2A73B 3U7YH 5B8CB 3MRQB 3KPPB 1H3PH 4HH9A 5DEGB 4PJ9A 4PRPA 4MJ5B 1WISA 3F65A 1PFCA 2AJYH 2NY3D 4LMQE 5FF6B 5GGQH 3KPSD 4ALAL 3GFUA 1AO7E 3TCXA 5L7XL 1G7IA 3JWOL 4BSVA 3PJSA 1MNUH 5KN5B 1YY9D 2PYED 4OF0A 5E9DD 3KLHC 3S97C 5I1IH 5F7WC 3RL2A 2EEDA 2G2RA 3IF1B 4DZ8A 1I8IB 3OV6A 1VGEH 5J12C 1Q9OA 1EGJA 3CMOH 3QHFH 2AV7A 4LLWA 3MOAL 4OLUL 3ZTNL 1KXTB 5GS2D 4MAYD 3BP4B 1TZIA 5T1LD 5I17B 3W82A 4P4KA 4PJGF 3VXRE 3N1PC 5ACLA 1OWRM 3D1MC 3MRKA 1F90L 5A16B 4PJGB 2J12B 5DZLA 1BZQK 4YBLC 3VWJD 3VXRD 5KG9A 2P43B 4JDZB 3GEWB 1DQJA 4LHUA 4Y4FD 2BOBB 3BKCH 3SDAB 3IDXL 4CKVX 3RPKA 4MA8H 3IDJB 3MRCB 1KLFA 4CW1A 5IP4A 1MCDA 4OI8A 2W65B 4AG4L 5FAAA 1CYGA 5K9QG 3O8XD 2A1WH 1FORL 3SKMA 1L4IA 5EIIB 4HXBH 1F6AA 1IM9B 3SQOH 2F53D 3V52H 4N90D 2E7MA 1E4KC 2X1PA 4IJ3B 1B6DA 5FUCC 3FO2A 1PSKH 3CFEA 4I48B 5D1XC 1CR9H 3GGWA 4NC1E 5I8EA 3HMXH 5DO2D 1NAML 4XPFL 2FJHA 1YUHA 4GKNA 4NM4H 5F7EL 2Y25A 1KB5B 1H8SA 4WV1B 5LWYL 3DYOA 3STBA 1PEZA 2VDPH 3CFKA 5IB2A 4JFHE 5JOFA 1M7IB 3NCJL 1I7RA 3B5HA 2XKNA 2APTA 2OP4H 4CADA 4UU9A 5HDLA 1I8KA 4ZAKB 4JFHD 2XXMB 5ESVA 2Q6WA 3MRDA 4X6DA 4MYWB 3QDMB 3TPUA 2GFBA 5F8QC 4HCRH 3QI9C 3MRGA 1A1NA 1JZ6A 1IC4H 1FL3B 3DSFH 1J1XH 1G9NL 1JTOA 3QUXB 5IW6B 1DVFA 5JR1L 3GRWL 4PJ9C 3SY0A 4RWYL 4PG9B 1M7DA 4MHHI 1N0XL 1U92A 5HGDA 1ZLUK 4G6JH 1ZWIA 2G5BA 3UEZA 2YD1A 3MXVL 1JI1A 5EU5B 4X9FA 2EYSB 4RBPH 3TCLA 1S9YB 4QEGA 3CFIC 5EFIA 2EE9A 2F5BH 5DJZB 4L3EB 3RIAK 1V7NH 3IFOA 1EX0A 5E2WL 1NGWB 5DMYA 4OLWL 1JNJA 4E5XB 5AZEH 1FV1B 5C1MB 3GJFB 1QSVA 2KDGA 3OZ9L 5T5NF 3O4LB 2HT3D 4PJBF 4XPGH 4L8CB 4KI5E 1MFEH 4P4KC 3BWAB 5FYLD 5ADOH 3NFSH 3QQ3A 4EXKA 3V0AC 3I84A 5D7LD 4M43H 5BJTA 5DWUL 5HDBE 4NSKA 5C6TL 3U4AA 3QA3B 3L5XH 4EJ1C 2ATKB 3MGOA 4BFEA 4NT6A 1N3NB 3WNNA 1KYOK 4XCNA 4U6XA 1YJDC 1IJ9A 1PBYA 2F5AL 1ES0B 5IBUG 1K8DA 3MA9H 4BQ8A 1Q8MA 3BD5A 3SCMD 5DTFA 4P23D 2MQCA 2WLYA 1F11A 2HVJA 3VJ6A 1UWXH 3UTPD 4JM4H 3QP3A 2BNRB 1MCNA 1X5FA 3OJDA 3QDAA 4XPTH 1PKQB 5GS0D 5CGMA 4YLQT 5MEND 3KPSA 3RWFA 2R0WL 5ELIA 4KK5D 1S3KL 2PYEA 5FO8A 5E9DA 2FR4B 2XWBA 2QBWA 3D39E 1UYWH 1EIBA 2VDNL 3UC0H 2V2WB 3L7FB 4MD5B 1WBYA 2YKLH 4RGNE 3D39D 4J4PD 1E4XL 4UDUB 4F15B 3U36A 2I9TB 3GMLB 1QFWM 4TRPH 1RZIA 3RUGE 3E2HC 4IOIA 4MAYA 2HYMA 1UM5L 5F9OL 5I1EH 5T1LA 5CP3A 2H26A 5BRZD 4QRRB 2BNUA 3VXMB 2DQGH 2VL5A 3BE1L 3PV7A 4R96B 5HYJB 1SJEB 2DJUA 2FBJH 2HTKC 5DMJB 5ALBH 1S9VB 1FYTB 4PB0H 4YDJA 4Y4FA 3U4EB 1DVFC 2C3VA 2GY7B 4F7EA 3ZL4L 5LQBH 4KXZH 3UO1H 2XZQL 4Q6IA 5C0JA 4O58L 1HQRB 4Y7MA 2VXVH 1NLDL 3D6GA 2VXUH 4ODHL 1H3XA 4MCZA 1INEL 3O8XA 3IXTB 4BQBA 2A9NL 2R4SH 1RJYA 2XQBH 4XCEA 5HYSB 3QWQB 5CZVH 1WFUA 5I6XB 1A6UH 4OM0H 4HS3A 4N0FB 4X5WA 3MLYL 3DXAE 2XTJB 5EUKB 4QHNA 2XN9E 1H5BA 4JEGB 3BIBX 3LQZA 3TYGH 2DLTA 1QHOA 1RULH 2QQQA 2XN9D 4I0PA 3MBED 1NSNL 3T0EA 4ZFFB 3D2UD 2FX9H 4NO0A 1E4XI 3SDXA 1SYSA 4YHZH 1Z0MA 2PYFB 3IDGB 4I0CC 2AXJA 5GJTL 2DTMH 4OLYH 1F2XK 1OQOA 4JHWL 3EJJX 5E5UB 1YJDH 3L95B 3GM0A 3BPOB 3IFNH 4UB0H 2AERT 3BPNB 3QH3A 3C5ZB 2P5WB 5IVZB 1TETH 3IGAB 3BGMB 2BXYA 3QUML 2YD7A 1L7IH 1MCPH 3MV9B 4YHNB 1E6JL 2AVGA 2NY3C 1EAPB 2XZAH 3G5XA 4PBXA 2E3VA 1CD8A 2FHFA 1Q0YH 1BVZA 1YY9C 4JRXB 4Z0BH 1KEGL 3H7BA 5T1DH 4ELME 3C8KA 1UCBL 3LD8C 3EOBA 4C54A 1X5JA 2HN7B 5I74B 2QHRH 3RI5F 5EU4B 2UZIH 1PY9A 1QUNA 2V7HA 1IC7L 4MAYC 4LPCA 3JSSA 1IGCH 2EYRB 3BDXA 4PJFE 5FM5O 4IM8A 4YHLL 1MJJB 5EUOA 4LF3A 3ULSB 1DFBL 2CLRB 1ND0A 3F7PC 3QJHB 2AV1B 1OGAB 5F93C 1LO2L 4Z6AT 2VZTA 3VWJC 4WFGD 4OBRA 5TDOA 3VRJA 4BQCA 4CJ1A 1FJ1B 4Y4FC 4LLMB 4PJCE 5DHYB 1JZ3A 4UIKL 2R2BA 2A83B 2HJFA 3I75A 3MBXL 5E7BA 3SCMA 2R1XB 5GGTA 4YFEA 4P23A 4Q6IC 1KPVA 4X80L 1NGPH 5DVNA 3EW3B 4PYGA 3QT2A 1U8OA 4LRNH 1FG2A 4NNPH 5DD6B 2R0KH 2O5XH 3O8XC 4FABL 1PZUB 4CN6A 4M6AA 4PV9A 1NKOA 2JIXB 4POUB 5T5NG 5IF0B 1QEWA 5DA4A 2VLRB 5MENA 4HFUH 4FQ1L 1CICB 5DO2C 3MA7A 5JOPD 1NGXB 2V17H 5ABDE 5L2JB 4QY8A 1MOEA 1H5BC 4R4ND 1HQ4A 4JM2F 4UINH 3C60B 5DD1H 2GK2A 4R97C 4GRLA 1NCWL 1QA9A 1RUAH 3LEVH 3RQ3A 2BMKA 4J4PA 2SEBB 4XMLL 2Z4QA 1CGXA 2D7QA 1OGTB 5JPMA 3C8DA 5TQ0H 3O6MH 2IANE 1AD0A 1M4KA 3FQWB 4F3FB 3MLRL 3X17A 3QZWA 4OZIF 3LOWA 4HUMB 4Y2DB 4HDIB 1MRFH 5BRZA 4P46B 5K9KB 4OZIB 3MRMA 2X4NA 2W0LA 2ITDB 5I16B 2NY4B 4YUEL 5DZNA 1YECL 2NW3A 3PV6A 4BKLB 2IFGA 4QXTA 5BQ7A 1NAMB 1IARB 2EKSA 3PABA 1EEZB 4YWGH 1MREH 4C58B 4LCIH 4JJHA 4XGZB 5E08H 4OIIL 1EFXA 3ARXA 1V3LA 2YR3A 1UZ6F 1CGUA 5H94A 5EZJA 2MQ3A 3JBG7 2YPKB 3BXNB 1MI5A 3X3FH 4F7CB 5DD5L 4E41E 1G7QB 3EDJA 2HFGH 3HC3H 5T33H 3IDYB 3KWWB 3DURB 4WY7L 1M7XA 2UZYB 4DGVH 1C7SA 4HKBB 4PGEB 3U7WH 2DJSA 4PRHD 3V0VA 1U8KA 1WJ3A 1FDLL 2HT3C 3H9ZA 5KOMC 4KROB 4G8GE 4P3CL 5IKCA 5GS2H 2BC4A 2D2OA 5CP3H 3D2UA 3NOIA 1JIBA 4C56D 1WAAA 5CD5D 4XWOD 1RZ8B 4JPIA 3ILQD 2ADJA 3NABL 5E4EB 3TF7C 4DGIL 5HYSG 2UYLA 4ZSOA 4NPYB 5DVOA 1T0NB 3SCMC 5FHBH 4P23C 1LDPH 1IGFL 3GI8L 2OR8A 1FZMB 3FFCE 4W4OC 2NW2B 1CN4A 2DI8A 3B8SA 3RGHA 3BUYA 3BRFA 2AJZA 4FTVB 4LARL 2O5ZL 5GS3A 3CFJB 5GS0C 2ADGB 1KN4L 5GZND 5L0QC 2QQKL 4KK5C 1N7MH 3K1DA 3MX0A 1CLZH 1JL8A 1PX3A 1X5KA 5CILH 4KGLA 4KZEL 3CGTA 3FKUS 4JZNB 5DC9B 3RRQA 3D0VB 1LMKA 4GRLC 3U4BL 2NTFB 1FGNH 3H8NA 4J4PC 3TBSB 2VXSL 3RIFF 2F74B 1EVTC 3NFPB 4OSUL 4MQSB 4OCXH 2C9AA 3DROB 1N6UA 5IHBA 5E2TH 4MNGE 2X4OA 3CH1A 1N8ZA 1JPTL 1GYAA 2VWEC 3LKPB 4MA3B 1HKLL 3RTQA 4P57A 1HOCA 4HKZA 5CIPB 5F6IB 3GKZA 4Q0XL 1U91A 4Z7OE 5BV7C 4X6CF 4YHML 1ORSA 4LSSL 4NN5C 4X6CB 2F15A 4LBEB 4WWKB 2WMPA 4AYFA 5MEPB 2Q3AA 2X4RB 1Q0XH 1HXMA 4GAJL 1WZ1H 3BPCB 4I1NB 5JUEH 3OJ2C 1CD1A 4K7FA 1OTTC 3VA6A 2PCPB 4M9OA 3TIDA 1INDL 1FSKB 3KNBA 4JFYA 3U9PH 5FOJA 1A6AA 1W8NA 4RMVA 4YAQA 1VKXB 1MQKH 1OAUH 4UIMA 3RI5K 4XCCL 4NWUH 3MJ7A 4ONFL 1MJ8H 4OI9A 2CLZB 4X5XB 5HGAB 5BCAA 4LLVA 2CKBL 1I7UA 4A6YA 3JUYA 1TXKA 4NQSB 1NBZB 3HNVH 1AQDA 1WLHA 3E1F1 5FYLH 1VEMA 4EIGB 5IMLB 4WTXA 4X4ZA 4KTYA 4JPWH 4Q9QL 4XC3H 2NXZB 3WD5H 1AP2B 1M1SA 3REVB 3L5WA 1NGQH 1U8HB 1OLZA 4NQDD 2R56L 3TN0B 1KC5L 2VITB 5GGTH 4V1DB 5L2KE 2DF3A 3FRUA 5KS9E 1UH2A 1V7ML 4UQ3B 1KENH 3J7HA 4P48A 4ERSH 5BZDB 4M7ZB 3KPOB 3UJJH 3VI3F 4QTHB 4PJDF 5B39A 1DBBL 5GS0H 3HZMA 4GXUN 1RFDH 3FQUB 4ESKA 2HLFD 2F9BT 4KDTA 4JZJA 4MHHG 1ETZA 3MFFB 2X70A 5DF0A 1E28A 3HC4L 3G6DH 3QNYB 3TIEA 4PRDA 3IETA 5EBLB 4UILL 6FABL 3BGAA 3L3GA 3HFML 3GSXB 1MUJA 2JLLA 4PRNA 3GJEB 5F1KC 3EJZD 2ZG3A 1Q9LA 2Q7YB 3G5VB 4KJPD 3S4SA 4R2GB 4PRHA 1BBJB 5F9DC 2ADIA 4QF1B 3PL6B 2X7LA 3BESR 2AW2A 4NQTA 5M95B 4ZQKA 4Y16B 1S7RA 4C56A 3IDNA 5F7DB 3WIHA 3VXOA 3CPLB 4S0SD 4OD2A 3QDJD 4XBGA 1QSZA 2V7NB 4YO0A 4QYOB 4QXUL 3V79C 4R90L 1EERB 3RBGA 5DMGD 3S5LG 3WNPA 2H1PH 5BV7H 4MDJB 1G9EA 1WCQA 5I30L 1AGFB 3O6FD 5EC2A 1ZE3C 2CR6A 1WFTA 3DX8B 1QYGH 2ZKHL 5DJ2A 3MODL 4OZHB 4FXKB 1IZJA 1IAKA 5GRVL 3TH4T 3U7YL 4ONHA 1H3PL 1LD9B 1E4WH 4OZFA 3GKWH 1U8PA 2AJYL 2FEEL 4TOYH 3U79A 4YDVA 5GGQL 4GUPB 3GMNB 2VDMH 4R4NC 1IM3B 4WI8A 1BOYA 1ZS8B 5KVEH 1MNUL 1A02N 1EA9C 4F33A 3GSQB 4O02H 2K3TA 2ESVA 4KK9C 3Q48A 1SJHB 2VMFA 4KKBD 1Q72H 1OF2B 2PXYD 3MJGX 3MREA 3ARRA 1A6TA 2OSLA 4LCWA 3HUJE 2N4IA 3CMOL 4GMTH 5IJKA 5EO1A 5DHVB 3O9WB 3QHFL 1DDHB 4HUXA 3MRBB 1A3LH 1NCCH 3RWJB 3UBXA 1GGIH 1OTUD 1G7PB 4OF5A 4M3JA 5D1QB 5J0BA 3T2QA 4YFLI 3CU7A 4DZBA 4I9WE 5JZ7D 4Y5XB 2I24N 3U83A 1AGBB 4XBPA 2Q76A 3DVNA 3MRJB 1QLFB 1X4XA 3C08H 3LH2H 1K8IA 4ZUTB 5IK3A 1ZGLB 1DN0B 4XP9H 2H45A 2LTQC 4HPYH 4MA8L 4TQEH 4PTUB 4JVWA 4JZJC 2MTPA 1YEHH 4YH6A 5DJCA 1TFHA 1KPUA 3HR6A 2CUMA 1OL0A 1I1FA 2A1WL 3NAAH 3HKFA 3H9HA 5HJ3B 4HXBL 3SQOL 3ARDB 1YPZA 3V52L 4PJHE 3TA3B 1NBYB 1TQCB 4NYLA 3NPSB 3RIFK 5INCA 1BM3H 3E8UL 1CR9L 3H9SD 5MEOA 4Y19D 3HMXL 4LPWA 3RX7A 5C0AE 3LKNB 4NM4L 2BRQA 2HAZA 4W70A 2VDPL 3OKEA 2W0FB 2D03H 1T4KA 4R0LC 4D2NA 4IMKA 2GSGB 4N0RA 5CD5C 2OP4L 4XWOC 2VR9A 5GGRY 5D93B 3ZHDA 2B0SH 3P30H 2EDWA 3ILQC 2FNBA 4FQPA 1T1ZB 2E7CA 2ZUQB 4NHCH 4G7YH 4WI9A 3MUGB 4NQDA 4QLRA 1N6QL 3VGDA 4JLRA 1CCZA 4DKDC 4G42A 1OP3H 3PWLA 4HCRL 1CFQA 2FECL 1VFOA 5C7XH 1IC4L 4HC1H 3BP6A 4HXAL 2XOTA 3DSFL 3FONB 4QRUA 1A6WH 1J1XL 1CK0H 1F3JA 5EU6D 4GT7A 1KNOB 4LLDB 2I27N 5HGGS 4IS6A 4XCYA 4PUBL 4X7FC 5TDNB 3HRZB 4EDWH 5GZNC 1A64A 5FKAB 3SE4A 3IDMA 4FOMA 4JFOB 5HI4C 5I8CA 2GK0A 3SHSA 5I75C 1EZVX 4G6JL 3QIUB 5GGRA 5I1DB 1HYSD 1CFBA 1URLA 2E7HA 2YD3A 5CBAB 1A9BB 1MCJA 3QG6A 1N4XH 4HK3J 5ID1B 4A6YH 2NX5D 3FN0H 1NC4B 1RK0A 3KYMA 3QDGB 1V7NL 2HJKB 1GGUA 4WI4A 5AZEL 1AY1H 4PJIF 3ZYJA 2BSRA 1KIRB 4LSRL 1MVUB 4XPGL 1T7XA 4PLNC 5KZCB 3HS0B 7FABL 1MFEL 5ADOL 3NFSL 3QDJA 1KLUB 4M43L 1MLCA 2IH1A 5ENWB 2QV2A 3VFOB 3QEUB 1S7XB 3MV7B 3BD3A 5FYKU 3L5XL 2VZSA 4NFBA 1BFTA 1S9WB 5C0RL 3MA9L 2FHCA 4CU7A 3QWRD 4MB5A 2BNQB 4NQEB 2FECI 3VFUA 2UZXB 3HE7B 4GW4B 2JTDA 1S7VB 4JM4L 3MGTB 3AFLA 4BSWB 3OB8A 4XPTL 2C26A 5BZWB 4CMMA 5LXGH 3CCHA 4ZTPH 32C2A 3WEXB 4FZ8H 2G60L 3QCTH 5DQJB 3NN8B 3UC0L 4ODUA 2YKLL 5CGYD 1RHHB 1G0YR 5B3JE 1F8TH 3VFTB 1IAIL 3QEGH 1FL5B 4PTTB 3UAJC 4IMKC 5FEBA 3X11A 4PG2A 5SWSE 4X7TA 5B4MD 1TENA 2WZPD 4TRPL 3PNWB 2FEDD 2VL4A 3CFCH 4S0TD 4XHQA 3WN5A 2NY7H 5I1EL 3GMOA 5SWSD 3IJHA 4AIXA 2XYCA 3GK8H 2DQGL 5SWZD 3VFGH 4LIQH 4XNQB 2FBJL 5JDSB 5ALBL 4NQCB 1G7MA 1IZKA 3HI1A 4PB0L 5EPMA 1VEPA 1INQA 4Z7VF 3RWCA 3HPLA 2CKBB 2LQRA 4RWHA 4X4YB 5C6WH 5LQBL 5GIRA 2HLFC 4Z7VB 1DBAH 3SE4C 3UO1L 3ME0A 1YN7A 4RFEA 2UWEE 4DOHB 3QXAB 1NDGB 2VXUL 3UTSD 1PZ5A 2DM4A 3W5MA 4UT9H 2Z8SA 3UPRB 2R4SL 2CIIA 4UNVA 4PREB 2XQBL 1NJ9A 4GG6E 3H9SA 5CZVL 3AS0A 4IIQA 4Y19A 1OAKH 4KJPC 4GRMA 3VFSA 1A6UL 5HHXL 5FXCH 1NFDA 4HX1A 1XH3A 1NMBH 4IOFD 3TGXA 4FXGB 3O3EA 5DR5H 3TYGL 1RULL 5IW3A 1S7SA 5C9KA 1I3VA 5D70H 1OB1B 3EYFA 3NCMA 3NTCH 5E7FA 2BRRH 3ZT7A 2FX9L 1S78D 3K8MA 3LDBB 2EO1A 1D5ZA 4TTDD 5DMGC 3O6KH 5DK0B 1KT2A 4TYUA 2EDEA 3O6FC 4U0RC 3IU4H 4OLYL 4G9FE 4RIRB 3RWGB 3F7YB 1B9ZA 1YJDL 4RA3A 3W9EB 1CE1L 4RAVA 3IFNL 4UB0L 5CJBA 1G6VK 4JKLA 2CRZA 4WTWA 2H32H 5EU6A 1KTLA 3V9FA 4J8RA 3EDKA 3T0XA 1JGLH 1MCCA 2OL3A 1X7QA 3SKOB 1L7IL 2Q8BH 1MCPL 5HHME 1CGWA 2GT9B 5C08D 2WNGA 4N8CH 1RVFH 2NLJA 4KXZI 3KR3H 5C0IA 4L8SA 4YFLF 2XZAL 4LP4A 1Q0YL 1GIGH 2NCMA 4Q74A 4WW1B 4QNPE 2CDFB 1VCAA 5F1IB 4Z0BL 3GUTA 5FCSH 5T1DL 3LN9A 4KKBC 4UV4L 3B2VH 3NCBB 2PXYC 5FOBB 4NUGH 3TVMD 4NRYA 5E8NB 4ZUWB 1IL1A 2XFXB 4S1SH 2QHRL 3QJFB 4N0UA 2UZIL 4M6MH 1J0IA 5C0GA 5F97E 3WN5C 3D25B 2BOCA 5DHXB 1OTUC 1R0AH 3IXAA 4M5YH 2IF7A 4X8JB 1LNUA 2OTWA 3D3VA 1IGCL 4HUWA 4P2QE 4Z5RB 1C16B 3LS5H 3BEWA 1TZHA 4LL9A 2GJ6E 2VZ3A 5JZ7C 4AK1A 5D7JA 2EYTA 1KF9B 4MNHA 2XI9A 4OFVA 1CE6A 4ZNEE 4GAFB 4KRLB 4HLJA 1JZ2A 3Q5TA 1T22B 4WW2F 2DBJA 4TUKH 1IRAY 4NDMB 3HNTH 3MOBH 3QWRA 5IJVA 3BZFA 4NBZB 1NGPL 3P2TA 4UTBL 4NNPL 1ACZA 4LRNL 2H8PB 5IB1B 5SV4A 2R0KL 2O5XL 1X6NA 1ZSDA 4U1JB 5LGJA 1AGCB 3F8UB 4FFWD 4N68A 4HFUL 4IIQC 3ELAT 4L3CB 2B5IB 4Z7WF 1R6VA 1WBZA 1OM3L 1ULVA 5IV2A 2V17L 1A8JH 3TJEH 3CZJA 1KLGB 3WNKA 3T3PF 3CX5J 1T21B 1F3DH 5J9PB 3WDJA 4UINL 1I1YB 3K46A 3BDYH 4S1RH 1MHEA 3MUY1 5DD1L 4DUWA 1RUAL 1XF3B 3LEVL 1H8OA 1OHQA 3DI2B 3JV6B 2AK1H 1JZ5A 4H5SA 4RFNC 3O6ML 3FN9A 1LP9A 5D6CA 1TITA 3R0NA 2IADA 1BZ7B 1HH6A 4NZTH 1MRFL 3VDAA 3P11H 1RMFL 4J12A 3G6JE 4HK0B 5I71C 1AE6H 3D85B 4XPAH 3VXUB 1XCQA 5JO5B 3T0EE 2DQIH 1IEAA 2VLJB 2J7LA 3SDCD 4YGVA 4K3GA 3L3HB 4MLIA 3X13A 2Y07H 1IMHC 4N0CD 3NCCB 1MREL 1UWEH 2JK5B 3H3BC 4LCIL 5E08L 3UZEA 4L8SC 4KJYA 3LKSB 2NY6D 1F58H 1HYSC 4HIHA 3X3FL 4JG0H 3KPQB 4BSJA 5E99H 4A2MA 5FB8A 4M48H 2QSVA 2HFGL 3HC3L 4FQHA 4FQLH 4GBXB 2A6DB 3U2SA 5T33L 1BOGA 1KJMA 2ICEB 5C0BA 1BPVA 1I4FA 3LMJL 1AKJD 4DGVL 4CL7A 5D6DA 4ZTOH 5EO9A 1I1CA 2LVEA 4XB8A 4ELKA 3U7WL 5EBWB 3W81A 4NRXB 2EDNA 1BD2A 1ZVYA 3Q0HA 4E0RB 3ZE2F 3AY4A 2ZP0T 2MCG1 3BN9D 2VH5H 3WIFA 2APBA 2B1AL 3KPRE 1T6VN 3GSWA 3BDBA 4ZXBD 3FHAA 2EIDA 3TZVB 1KB9J 4TVPE 5GGSY 1JZ8A 1LE9A 4JO4H 2KZWA 3W0WE 2FB4H 2R15A 5FHBL 3UTTA 4PY7B 3PDGA 1AFVH 1S5HB 3EBAA 1T04B 5H35B 2A77H 3T77A 4PJXB 2BHUA 1R3KA 5C08A 3ZO0A 5J12B 3OQ3B 3EOAB 3MZGB 1FZJA 5D2NA 3I3DA 3ES6A 4CDGC 3FTGB 1N7ML 1CLZL 1ZA6B 1GGBH 4KC3B 3V5HA 3QQNA 2ZSWB 5CILL 4N9GA 1FAKT 1SY6A 4GAYA 4YBLB 4D0BB 1FGNL 1FFOB 1OD9A 2Z31D 3MV8E 5D7IA 1ZT1A 5B4MC 2FL5A 1BQSA 3NIDE 4OCXL 2EC9U 2FEDC 5AYUH 1CXIA 4TULH 2AJVL 2OTUB 4P2RB 5E2TL 4QHKI 4M9PA 2OYPA 1YC8A 1JNHB 2AEIT 3WS6A 3VCLA 4OCNC 5IOPB 4JRYE 2W0PA 5GSVA 5ICXB 3G04A 4M8VA 5CBEB 1XGPB 1S7QB 3V7AE 3OKLB 1PJ9A 1K3IA 2OL3H 2N7BA 4CN1A 3RY6C 4U1GB 3FT4A 2BSTA 4QOKD 3LPWA 1Q0XL 3HPJA 1I1AB 1WZ1L 3GSUB 4XNYH 2VJXA 5FYJU 4L4VB 3LEXA 4HKXB 3OWEA 5HHOD 4LSTH 1Q1JH 2ERJB 3U9PL 5ISZB 2QSTA 1PG7W 4LSVH 3ROOA 4ZDHA 3CSPA 4U1MA 5IVNA 2GJZB 1T83A 4HEME 4NNXA 3DO7A 3DYPA 4H26A 1A7QH 1OAUL 1CI5A 5F9JA 5GGUB 5IEKB 3WE6B 4NWUL 2Y7QB 1QLRB 1QQDB 5D6DC 3T8XB 4PJAA 4YR6B 4IOFC 1FLRL 4TSCH 3MRLA 3QI9B 5D5MB 1A4KB 2BY1A 3L7EB 4L8DA 5IVXE 2D7MA 3KXFB 3E3QC 3AY4C 3HNVL 4JY6A 1E0OB 3GSRA 3PE9A 2DL2A 5FYLL 1S78C 4Y5YB 4WIQA 3FQNA 8CGTA 4PJ9B 4PRPB 4TTDC 1VDGA 4JPWL 5LBSH 4KUCD 1DQQB 5TE4H 1G0XA 4XC3L 3VXSB 4O5LH 3IJSB 1NGQL 1IGML 5D1ZB 2JKXA 3V4PH 3B9EA 2P5EE 2ILLA 2N1KA 4Y8AA 4F8QA 5GGTL 3GHBH 1KFAH 4PRAB 3RL2B 3ZKND 3WLBB 4YHYC 2G2RB 4DZ8B 2P5ED 3QEHA 4NFDA 3WNOA 4ERSL 1KENL 3PGCB 4PJ7E 3UJJL 1UACH 2AV7B 4LNRA 1PKOA 3I02B 5D2NC 4ZSOE 4GRWE 5GS0L 1JTPA 1RFDL 3SDDD 2IEPA 1TZIB 3MXWH 4Z7UF 3IKKA 1X5LA 1HHIA 3G6DL 4XAKD 2ITCA 3FOLA 3MRQA 3KPPA 1P4LB 5DEGA 3ULVE 4PY8J 3TVMC 1QSFE 3EGSA 1DQJB 4LHUB 5FF6A 2C4FU 3GMRA 4CW1B 5IB5A 1QSFD 2JB6A 2F8XC 3T0VA 2XACC 2ZUVA 3WS6C 2EDRA 3IF1A 1F6AB 1I8IA 5DC0A 4TN9A 1QFWH 1KJ2H 3MCG1 3GGWB 2E6PA 4XVTH 3ZDXE 1HK6A 1BWMA 4J6RH 2H1PL 5BV7L 1EHNA 4M00A 1YUHB 3BP4A 3TBTB 3V95A 4MD0B 1O5DT 4PJGA 3BI9X 3MNZA 3R0MA 3CFKB 1QYGL 5IB2B 1OY3B 5JOFB 5LJYH 1NCAH 1NCTA 4HS8H 1I7RB 3MRHB 4OD3H 1EJOH 1HN1A 2AXFA 2BOBA 1T83C 2MWCA 3B9DA 4FFWC 4CADB 4UU9B 1E4WL 4RZCB 2RB8A 3IDJA 3MRCA 2HFFB 1V3JA 3E2HB 3GKWL 1UB5B 1RK1A 5ESVB 2OK0H 2W65A 4G6FD 4TOYL 1A7NH 2Q6WB 3MRDB 4X6DB 3QEQD 2VDML 4OZGF 2YD5A 5D2LE 5KVEL 3ZHLA 5EIIA 3MRGB 1A1NB 3DV4A 4O02L 4OZGB 1V5JA 4M93C 1BVKB 1MIMH 4W6YB 4JFZH 2Z31A 1Q72L 4WHYH 1DVFB 2ZUUA 3D0LA 5HBBA 1FZOA 1M7DB 3VD7A 5EN2A 1WWWX 5HGDB 1KB5A 5JHDE 2ZJSH 2R4RH 4XTRD 5MERB 1NCCL 4NNYA 1GGIL 3U0WH 1M7IA 1L6XA 1H3VA 1KTDB 1FG9C 5T3XE 3QSKB 1BFVH 2W60B 5EFIB 2HFEA 3K2MC 5GGVY 5CEXB 3IFOB 3BO8A 1AGDB 2C3WA 4N0CC 5LAXA 1FFNA 3C08L 3LH2L 4QOKA 2CGRH 1SEQH 3OGCA 4HIEA 3S3PA 3QDMA 1W8OA 2NY6C 4XP9L 3T3MF 4CU6A 1KXVC 4HPYL 4KRPD 2EC8A 4TQEL 4KHTH 1PLGH 1FL3A 1JHKH 4DTGH 3MRFA 5HD8C 3NAAL 1R3IL 4JFEE 4WVRA 4X83A 1AIFA 4NCC1 5KSBE 1ONQA 2IAMD 1BM3L 5HYQB 3KYKH 4XWGH 4WNQB 2C3HA 3OB0K 1A2YB 3KLSA 1K8DB 5EH1A 1LQSR 2DLIA 5DTFB 2EYSA 1ZLUH 2HVJB 3VJ6B 3BN9C 2XRAH 3RZCD 3HR5B 4L3EA 2D03L 4BK5A 2XICA 1NGWA 1NH6A 4E5XA 2NY3B 2B0SL 2E6JA 3P30L 5CLWA 3KPSB 3RWFB 2KH2B 3DGCR 4NHCL 4G7YL 2PYEB 5E9DB 4YC2C 4L8CA 3BWAA 5JW4N 1WBYB 2N7AA 4D0CA 5C7XL 3HG1D 4HC1L 2ATKA 1NCDL 3MRPB 3CC5B 4KRMB 1A6WL 1CK0L 1EZVY 1N3NA 4F57H 1VEOA 3U36B 3GIVB 1RZIB 4EDWL 4WI2A 5F3BB 2VZOA 1ZHNB 4MAYB 1DE4A 3O2DH 4X9IA 5T1LB 5DJDB 2H26B 1KGCD 2BNUB 2VISA 3CD4A 2YD2A 2VL5B 1Y6MR 2JJWA 3QUYD 3VWJB 1N4XL 3VXRB 3SKNB 2Z31C 4YIQA 2DI7A 4Y4FB 3FN0L 1FVCA 2C3VB 2JJUA 1T1YA 4GMSH 3WFBH 5DQDH 2CO6B 1EO7A 5T1MB 4Q6IB 2FR4A 5C0JB 1AY1L 2V2WA 1U2HA 2EIEA 2DQCH 4MD5A 3O8XB 1AH1A 4JM2D 2XQYG 3SJVE 4YE4H 1FE8H 2Q20A 3SKJH 2F53B 2BVTA 4XCEB 4XNMA 2I9TA 3GMLA 2AS5M 3O4OC 3SJVD 1GZPB 2VB5A 4OIBA 3T0WA 3ZZ1A 4XZUB 3EYQD 1U8IA 1H5BB 4ETYA 1YMMD 4LVNC 1JPFA 3QPXH 4LHUG 5EZIH 3VGHA 1NFIA 3WS3B 4HMCA 4R97B 1SJEA 1IGYB 3VFPA 1S9VA 1FYTA 4YDLC 1MCFA 3U4EA 1REIA 1UA6H 1WWAX 3FCTA 5T5FH 1FZKA 3VFNB 3WFDH 4EBQH 1SYSB 2Z8WC 2VZ1A 4M5ZH 1HQRA 1T2QL 3QEQA 3LKRB 1D3CA 3CDYA 2IPUG 4ZD3H 5LXGL 4ZTPL 4JO1H 2B8OT 3IXTA 1KPRA 5IBLD 4FZ8L 3QH3B 12E8H 1DBKH 3QCTL 2Q87A 4RA0C 5D96B 4NO2A 5HYSA 2AXHA 2IPUK 1GPOH 1F8TL 3QEGL 4HGMA 3LN4A 3NCEB 4LCUB 4JCMA 2BCKB 4BH7B 1KJ3H 3G5XB 1T80A 3THML 3F7RA 2R8SH 3CFCL 3NH7H 1BMGA 3QXTA 2NY7L 3PP3K 3G5YB 5I8KH 1BP3B 2YD9A 2X4PB 5CJXA 4JPVH 3PWJA 3NIFE 3GK8L 4AEFA 3ZKNC 4FQ2H 3VFGL 4LIQL 3FMGH 3C8KB 4PPTA 1P7QD 2PYFA 4MNQE 3IDGA 1EO8H 1X5HA 3LCYA 4M1DH 4F7PA 1T5WB 2FJFA 5FECA 2XWTA 3L95A 4Z7NE 2ICCA 1DBAL 1YQ2A 3TO2B 1SEBB 3GBNH 3HA0A 4OJFL 5D7LB 3W9DA 4KI5F 4JREB 3MV9A 4UT9L 5CJOH 5HDBF 4YHNA 5TDOB 3VRJB 1SMAA 3L3IB 3Q2CA 1EAPA 2H2PD 1OAKL 3HNSL 5TPWH 5J3HD 1J1OH 3I75B 4PD4J 3SCMB 4P23B 4JRXA 1KPVB 1NMBL 1P1ZB 3QXWA 4I0KA 1U8OB 5DR5L 2EE2A 4PV9B 1NBQA 3I6GB 2HN7A 2RQ8A 5DC4B 2BRRL 4Y4KD 5MENB 4JG1L 1QBAA 3G5ZA 5L0QB 3MA7B 1T3FB 4WUKH 4PRID 4NQUA 2GAZB 4M3KB 1HQ4B 3IU4L 3TBVB 2EYRA 2VSDA 1YYMH 2E7BA 2AV1A 1I3UA 4LVEA 3D39B 3O3DA 5GRZA 4LQ1A 1DLFH 1FLTX 3EYUH 1OLLA 1FJ1A 3R8BB 1IAIM 4LLMA 1JGLL 2DBLH 5DHYA 2Q8BL 4ORZC 1ZEAH 3QZWB 1KV3A 2R1XA 4N8CL 1RVFL 3KR3L 3RUGF 4MS8D 5BRZB 3B2UD 1HDMB 4M7LH 1TMCB 3MRMB 1GIGL 2F54E 2YRLA 3BHBA 2DIAA 1I7TA 3QUYA 5GGVH 1IAMA 2JIXA 2NW3B 3PV6B 4AL8H 3IAPA 5BV7B 2VLRA 2EKSB 3PABB 3HTLX 4JPKH 4MB4A 4NN5B 4JFFD 4NUGL 3UTQA 1NANH 3AU1B 5E6ID 2IPKA 3KPLB 1NUDA 4ODSH 4XTRC 4EKXA 5H94B 4XAWH 3ZDZE 4M6ML 5EZJB 3FB5A 2P49B 4JM2A 1R0AL 4NHUB 1WK0A 2DKMA 1U36A 1QO3A 1MCEA 3UBXI 3OR6A 1RJCA 5CJXC 3LS5L 2SEBA 5BVPH 1G7LA 3U1SH 1OGTA 4LDEB 3SE9H 3FQWA 4F3FA 5FYKE 1IKNA 4HDIA 2CSPA 4JANA 3DECA 2A6JB 1YMMA 1XEDA 4OZIA 4TUKL 3WO4C 4DFHA 3V0VB 3MOBL 2XY1A 3BPOC 2YUWA 3BPNC 3CDGB 2KQNA 1CGVA 3F58H 2XN9B 4JN2B 3MBEB 1JWSB 4NQXA 4BKLA 3D2UB 3BP7A 4HUNB 2OI9C 4Y4HD 4GRWH 2YHGA 1EEZA 1U42A 5JMRA 3QCUH 4ODXB 4IRJD 3F62A 5I0ZA 2ADJB 2VC2H 4LLUA 5ERWA 4EDXA 2AJXL 2UYLB 3BXNA 1Q94B 3ALWA 3TJEL 1KSRA 4XMKH 4PJ5D 2DRUA 3S5LA 1G7QA 3LRSB 3BDYL 4S1RL 4YPGB 5F7MC 3RZCC 3KWWA 2GW5A 4BFIB 2BERA 2V5MA 4P3DB 3BUYB 2AK1L 2V9TA 2AJZB 3S37X 2Q86A 4HKBA 4PGEA 3BQUD 1NFDE 3V5DA 1HILB 3P11L 3TEUA 2NQCA 4NFCA 4E9LA 1WFOA 1MCHA 1Z5LA 4XPAL 3UYRH 3ZE0F 4ELMF 3MCLH 2DQIL 5IQ9B 1BLNB 3NCYS 1P7QA 2HH0H 4XVUD 5C8JB 4ELMB 1MY5A 3BKYH 1K85A 4HS6A 1S7TA 5EBGA 2DICA 2Y07L 4HF5H 1UWEL 2OMNA 5AUMB 4FFVD 1PAMA 3CH1B 3AS3A 1H3WM 1N8ZB 1JF5A 1F58L 3F6IA 2NW2A 4KGJA 4ZFOL 3LSOB 1FBIH 3QUYC 4P57B 4PJFF 4JG0L 3BYYA 5E99L 4M48L 4PJFB 1U91B 4FQLL 1SJXA 2ADGA 1ORSB 4PIRF 4FQCH 1LE5B 4PJCF 5EU7C 4ZTOL 3FT3B 2PTVA 4CGTA 4JM2C 4RAHA 4JZNA 3TIDB 2UVFA 4JHAH 4QHUB 5GRJH 1ZHLB 3KNBB 3MRRA 5E2UL 4JFYB 2VLME 1NQBA 1A6AB 1CDJA 2VH5L 4Y4KA 2F74A 3NFPA 1LEGB 4UIMB 4L5FH 5JQHC 1IKNC 2C7UB 2CD0A 4JJ5B 4WHTA 4N0UE 3EYQC 4PRIA 1U8NA 4JO4L 2DD8H 5A3ID 4QKXB 2FB4L 2V9RA 3CFBA 1I7UB 2YN3A 4A6YB 1UFUA 4BYHA 5CIPA 4ODWA 1AFVL 1O0VA 1AQDB 1PEWA 5FA4A 2YC1B 1FPTH 2IH3A 1FO0L 4ODTH 2A77L 3ZYZA 4X6CA 2ARJB 1ZA3B 2R23A 1FL6A 3VI4E 3H0TB 2EIBA 4WWKA 5MEPA 2X4RA 3P9MB 3W2DH 3QCVL 3HB3D 2PCPA 4LNVA 1D7FA 5IBLC 3L3JB 3MNVB 1GGBL 4HG4K 3FRUB 4OCWH 4NJ9H 4JFFA 4O00A 2X9XA 1Z9LA 5IGXH 5B39B 3OTTA 3UJTH 3U30C 1GCFA 2CLZA 2LTQB 5HGAA 2Z93B 5AYUL 4TULL 3VDCA 3CZFB 1E28B 4YGAB 1TVDA 1NBZA 3QZWG 1NCBH 2X1QA 4HKJA 5AD0A 1BX2A 3H7LA 5IMLA 3L3GB 1MUJB 2A0LD 2FGWH 4PRNB 1AP2A 3REVA 3ARED 1Q9LB 4L4TD 1FQ9C 3MUHL 1CXEA 3ARSA 2HVKA 1G9MC 2OL3L 4PRHB 2A38A 4W81A 4D0DB 2ADIB 1S9XB 2X7LB 2VITA 5CEZE 1I85A 5D8JH 5HDOA 1QLEH 4XNYL 3LRHA 4ZQKB 1UWGH 3O2VH 3RZWA 4C56B 5F9WB 3VXOB 3VMOA 3MJ6A 1OWWA 4YHPB 3KPOA 4LSTL 1U41A 1Q1JL 4QTHA 4R0LB 4LSVL 4XBGB 2HKHH 3ARUA 4N8PA 4PJDA 4DGYH 1A7QL 3ZTNH 2H2PC 3FQUA 5J3HC 3UZQA 2OQJB 1HWGB 2EH8H 3HI5H 4R4BA 4TSCL 3P3YA 2WP3T 5DJ2B 5EBLA 3PWPD 4HWZA 1K9TA 3RWEB 3GSXA 1GGTA 4FS0A 4TPRH 5HGBA 4RGOH 3GJEA 4U1HB 5LCVH 4WTZA 4Y4KC 2Q7YA 4LDLB 3IDXH 3RKDD 3G5VA 5FGCB 3BQUA 4MA7H 1EEYB 5TE4L 3MLSH 4YDVB 3OL2A 3WXVH 2VABB 4KKCD 4O5LL 5I75B 3QUMA 4L9LB 5HHNB 1U8MB 3V4PL 4Y16A 4OZ4B 2A6KB 5F7DA 2VR4A 2WQRA 1QRND 4S10A 3VG9C 3GHBL 1KFAL 1VACA 4MVBC 4I3SL 1U9KA 2GHWB 1H8NA 3MREB 2PKDA 1A6TB 4MDJA 4OQ1A 3PHOA 1BHGA 4WWKC 1UACL 5EO1B 2J88H 2D9QB 3CDCA 5BS0D 5DZOA 3B2UC 4JFXB 5IMMA 3DX8A 3UBXB 1QBLH 3MXWL 2C1OB 1SVZA 1R3HA 4NBXB 1FSKC 4FQIH 4DZBB 3X14A 1RY7B 4OF8A 2Q76B 3DVNB 5SWQA 1F00I 1RHFA 4Z7OF 5E6IC 1K8IB 4I5BB 4RGMB 3HN3A 4GUPA 1MH5B 1IM3A 2X1XR 3CIQA 1JMZA 5DJCB 5ACMA 3GSQA 2H32B 1KPUB 5F3HA 1SJHA 4QT5A 2RFXA 1QFWL 1YPZB 3RHWF 1KJ2L 3OHXA 3UDWA 2NXZC 1QSEE 4RMQA 1N0XH 3JWDC 3O9WA 1XT5A 3QG7H 1DDHA 5MEOB 3MRBA 4U6TA 4J6RL 3RWJA 3WHXA 5D1QA 3SE8H 1FNEA 1G9MH 4GXUM 1I85C 2ZCKH 5CP7B 1J5OH 2GUOA 3RDTD 1NCAL 4HS8L 5E2WH 1T4KB 4M7ZC 1C5DA 4OD3L 4OKVB 1EJOL 2MHAA 4HG4J 4KY1H 5C09D 1ZGLA 3MYJB 1F4AA 4O2CB 4PTUA 5I73C 4NQDB 2OK0L 4OM1H 4BA8A 1NKRA 2CQVA 4G42B 4EVNB 4OCYL 2W9DL 3PWLB 4HSQA 3ARDA 4QRUB 3ARPA 1F3JB 1MIML 5KS9F 3B6SA 4JFZL 5KS9B 1JJUA 3K4ZA 4R2GC 3BQUC 2ZPKH 4M6NH 3IDMB 5I8CB 2GK0B 4BUHA 5GGRB 3WFZA 3GHEH 3U0WL 4F37F 1JF1B 5HHPB 4LVOC 3DHJA 4KJQC 2W0KA 1BFVL 4O9HH 1QFWI 4XVUC 5CIPH 4DWHA 5DRXB 3LB6D 1RK0B 4WUUE 3KYMB 4L4TA 3BIAX 1U58A 1A47A 1S3KH 1IGTB 4FFVC 2CGRL 1SEQL 1P84K 1LO5B 2BSRB 1ACYH 2J4WH 2FWOB 1P9MA 1ITBB 1A14H 4KHTL 1PLGL 5FYJE 1EBAA 1JHKL 5KVDH 5E1HB 4DTGL 4KJWD 3QDJB 4LLDA 4UAOB 3EZ8A 3N50A 5FYJD 3PXHA 3FAXA 3GB7B 3QIWD 3EO0A 4H88H 2QL1A 1GC1H 4J3OC 4U7SA 4XRCB 3O6FB 4U0RB 5F70A 3KYKL 4XWGL 1GOHA 4PP1D 5I1DA 1ROWA 1JGVH 3PWPA 1A9BA 4XP5H 3VFUB 1LWRA 3D48R 3GDBA 5BVJA 2XRAL 3ZKSD 2D3VA 3QDGA 2CRMA 2HJKA 4JR9H 5DFTA 4LEOA 4ZFOB 2DMCA 3O45B 4MZ3A 4CMMB 3JWDH 3ULUD 5A3IC 1KIRA 1AR1D 32C2B 4ISVB 4PJIA 3S3JA 4AEIH 3P73A 3HS0A 5DJXB 1C08A 5ENWA 3LKOA 4DUVA 2PXYB 4ODUB 4HIXH 3QEUA 1S7XA 3MV7A 1WT5A 3X11B 4F57L 5C2UB 4UBDC 5FO7B 1JGDA 4AM0B 3HUJF 3ILPA 3B9AA 1RJLA 3HB3C 4HJ0D 3O2DL 3GMOB 4K7PX 3O0RH 4NQVB 2Z8VC 2P42B 4TVSa 5J13C 1HINH 4QHMB 3VRLE 3ARDC 3MGTA 3QNZB 3QYCA 5FHAH 5EPMB 1INQB 5BZWA 5IIEA 3MJ9A 3WEXA 5GIRB 1D6EA 4LU5H 5DQDL 4I18A 4ORGA 1YN7B 3A6BH 4RFEB 1J0HA 4OTXH 1QFOA 1CLYH 2DQCL 3TNNA 1PZ5B 2WUBH 3QUMH 3VFTA 3UBXG 3SKJL 1ODAA 2CIIB 2A0LC 2F19H 1NBVH 1NJ9B 1PX4A 3H9SB 3PNWA 4IIQB 4J23A 4Y19B 4PJHF 2X4TA 5J89A 3KPMB 1HHKA 4GRMB 2I9LB 3RP1A 3VFSB 5D72H 4MWFA 4PJHB 4HX1B 3UTZB 1XH3B 1P9MC 3QPXL 4KZDH 5EZIL 4UV7H 4XNQA 4U1SB 3MJ8B 2XPGB 4K9EC 4NQCA 4NBYB 1S5IH 3EYFB 3VD4A 1J8HE 1N59B 4KDVA 4RFNB 1UA6L 5C09A 3WFDL 5T5FL 1D5ZB 1EHXA 4RFOH 2XG4A 4EBQL 3STLB 4Z7VA 3QUKB 2L7UA 4GKZB 1F5WA 4KH2A 4M5ZL 2DM7A 2ZG1A 1J8HD 2D0FA 5F44A 1HHHB 3QXAA 5BO1H 1DQDH 4ZD3L 5I71B 4OV5B 5F7YC 1NUFA 4U4BA 4CBPA 12E8L 1DBKL 3AS1A 3PWVB 2PF6A 1DQMH 5EU6B 1GPOL 2OL3B 1X7QB 4XX1E 3RKDC 25C8H 2YPVH 5DRWA 3QUXD 5F21B 2NLJB 4FXGA 3RFZC 2R8SL 3NH7L 5I8KL 4AMKH 4LOUD 1P84J 2MQ0A 3TO4D 3WDIA 1OB1A 4JPVL 1N6VA 5ITFA 2NX5B 5I1GH 4FQ2L 3FMGL 4OUOA 5DK0A 5DLMH 1WT5C 1NGZA 1EO8L 4M1DL 2YRZA 3O4LE 3G08A 3F7YA 3DRQB 3W9EA 2BOCB 5FDWA 3IXAB 4XB7A 3B4NA 3GBNL 1NCWH 3KYOA 3BEWB 4XMLH 1TZHB 4KMLB 3GNMH 3SKOA 2EYTB 5LGKA 2GT9A 5CJOL 5TGBA 5E5RB 4M4PA 4YXLH 1UCTA 4F9LC 3S8WA 4ZO7A 5A43C 1DCLA 1UXWB 4JFDD 1J1OL 3VE0A 5A2KH 5IJVB 4I18C 3BZFB 5F1IA 3EJYD 4XMPH 4F37K 2QADD 4HLZG 5T3ZE 2BNRE 2E8YA 1JZ4A 4U2ZA 5E8NA 4M7KH 1PKQE 1UH3A 5LGJB 4ZUWA 5F6HJ 1BJ1J 4R4FH 5J56B 4BZYA 3FO1A 3B43A 4GOSA 1WBZB 2OR7A 3D25A 3K8KA 4N5ED 1BIHA 2WBJD 5FK9A 4WUKL 3K8LA 2YD4A 5IW1A 5AAWA 2PN5A 3CU1A 1YYML 5HVFB 4Z8FH 3RDTC 5HYFA 4DAGH 2AI0H 4CVZA 1DLFL 4K9EH 5E6YA 2DQFA 3EYUL 4H5SB 5B3JF 4YPJA 1T2JA 1LEIA 3UJIH 3JV5A 2DBLL 4JAMA 5D6CB 5F9AC 4WW2A 3UMTA 4QRRE 4Q9RH 2EDTA 3VXME 3LKQB 4YXKH 2EO9A 4M7LL 2H8PA 2L0DA 5IB1A 5HYJE 5SWZB 4P3WA 1FHGA 1KJ2B 1XCQB 3LN5A 5GGVL 2XWJB 4D9QE 3VXMD 4O2EA 1AGCA 2VQUA 4G8FA 4AL8L 1YNKH 3X13B 3WXWH 2W38A 4JPKL 4L3CA 4Y1AE 3ZSTA 3FL7A 4S1QH 2W9EH 3VDBA 4Z7WA 4NRZA 3U9UA 3VXPA 2W92A 3TESA 3GI8H 1T21A 3QNXB 4ODSL 3ARBD 4KQ4H 4XAWL 4X9GA 4Y1AD 3ARGD 5JW3H 3UTSB 4KUZL 3WUZA 1F13A 4JFQB 1CDHA 2UWEF 1XGYH 1C5CH 3JV6A 5FB8B 3WUWB 2O5ZH 2UWEB 4I77H 5TF0A 3DMMD 4FQHB 5BVPL 5HHVL 3Q6GL 3U1SL 3QFDB 1VADA 3MUJA 2WM0A 3LB6C 1BOGB 3SE9L 2EEAA 4HAFA 2QQKH 2XTJE 1ZMYA 1I4FB 4GG6F 1A9EB 1EHLH 1Z9OA 5I0DA 5I1LB 1NMCC 4TSBH 4Q7DA 4MCYA 4ELKB 1YDPA 4GW1A 3RWHB 5E2JA 5JO5A 1NUNB 4PLJD 5I2IB 4B50A 2X9WA 3RGVD 3STZB 2RGSA 3VFVA 4MXWL 3L3HA 3UYPA 3C09B 1GGCH 3PDDA 4AT6A 3LQAC 4M6OH 1QPPA 3QIWC 4Z95H 2JK5A 3QCUL 1OAXH 3OKYA 5DUPH 3BH8B 2VC2L 5D71H 3GO1H 2PW2B 3V4VH 3MJ9H 1S7UB 4OUUA 2P5WE 4XMKL 5C3TA 4Q0XH 1T1XA 4GBXA 5KBNC 3ET9F 4YHYB 2BVEA 2A6DA 5DMKB 2QKIA 5E8PA 5FV2A 3IU3A 1UM4H 5C08B 4OFPA 3ZYOA 1NANI 5K9JH 5D2NB 3HRPA 3MQIA 3ES6B 5DSCB 3ULUC 5DRZA 4JRXE 2V5SA 4NRXA 1UG9A 3SQBA 1INDH 4B7LA 4OFKA 4QNPF 4U1LB 3B9VA 5GGSB 2J2ZA 4Q9BA 3UYRL 3TZVA 3TVMB 3MCLL 4XCCH 2HH0L 2ARWA 3WYRA 5D7IB 4EN3D 3BKYL 1ZT1B 2BHZA 2IALB 3CVHL 3HHRB 4HF5L 1ZTXH 4WW2C 3B5GA 1KTKE 2P7TA 4HJ0C 4LHJB 5LKNA 4PY7A 5KJRH 2CIKB 3MV11 1P7HL 2DQTH 1NUGA 1S5HA 1BZ9A 5C70A 1T04A 1GH7A 5H35A 1OGAE 3K2UL 2WUCH 4L29B 3VCLB 1FBIL 1TTFA 2VLKD 4LPUA 5GSVB 3G04B 5IT2H 3EOAA 2RAMA 1AGEB 3GZKA 1CU4L 5E8EA 4FQCL 2WINB 3FT4B 2BSTB 1F3DJ 1T20B 1QFUL 5EG6C 5IG7A 1V7MH 4JHAL 4D0BA 5GRJL 4C83A 3M45A 3ROOB 2YK1H 2GSIB 4U1MB 4K3EH 4NNXB 5F8RC 1DBBH 4GW5A 3DO7B 4RMRA 1MJ7H 4L5FL 5F9JB 2YPLE 4KTEH 3QO1A 3HC4H 4PJAB 5T3XL 4CVWA 1JNHA 1RQ5A 4M7LT 3MRLB 1PW3A 1P53A 4L8DB 1MLBB 2YPLD 4Q97A 4M93B 3ZKMD 5IOPA 4JY6B 2MKLC 2CO7B 3GSRB 4M02A 4JKWA 1FPTL 1S7QA 4ODTL 3OKLA 2YXMA 1AXTH 3P4NA 1JYNA 4M1GH 5FYJH 3B5TA 3LQAH 4OZIE 3RPIB 4EI5D 1I1AA 3W2DL 5EU3A 3VXQB 1EJ6A 4L4VA 1N2RA 2R9HD 1DQTA 3G6JF 1DR9A 3KJ4B 3P9LA 5A40E 5IM7A 4GBXC 2BVOB 5GZOD 3SDCB 2GJZA 4R90H 3NPZB 3QEHB 4OCWL 4NJ9L 1CXHA 1JWMB 5IGXL 1BJMA 5F96L 1QQDA 3T8XA 3UJTL 4LNRB 2NY6B 3ARBA 3QI9A 3L7EA 4F58H 3ULUH 3FOMA 4LOUC 1WSST 2ITCB 1NCBL 2ORBH 2JJVA 2BY3A 3FOLB 4XC1H 3SGEH 4Y5YA 1I8MB 4P5KB 2V9QA 5E94B 3TZVC 3MRIA 1JPSH 3EGSB 1DQQA 1II4E 2CPCA 2FGWL 3VXSA 4P49A 4D9LH 1AKJB 4JQVA 1XF4B 1BQUA 3IJSA 4I2XE 4TNVF 3GMRB 5D1ZA 5IB5B 4WU7A 2JB6B 5H37G 5CUSH 3RGVA 4PRAA 1AO7D 5D8JL 1QLEL 1A22B 1FH5L 4U7MA 3WLBA 1UWGL 3O2VL 5EZLB 1RURH 4G5ZH 4ZXBB 3PGCA 3DX7B 1NMAH 1QP1A 2HKHL 3DLQR 1TCMA 1B6UA 3IDIA 3WUWG 4HUVB 3I02A 4NM8H 4DGYL 1WQVT 4YC2B 2HT2D 3EJYC 2EH8L 4XVSH 4Z7UA 3HI5L 4KKLD 2FZ3B 2YUVA 3MNZB 1P4LA 5TF1H 4FTVE 1HSAA 1UEYA 3HLAA 4TPRL 4RGOL 4P2OA 2AXFB 4QTIH 3TBYB 5LCVL 4WHYG 2H2SD 2EDHA 3FQTB 3TH3T 2AGJH 1V3KA 1XZ0B 3AVEA 4MA7L 1J0KA 1B0GB 1RK1B 4N5EC 4U7KA 2WBJC 4Q58C 3MLSL 3DX9A 3DI3B 2Y36H 3WXVL 3QXVA 2X4UA 3CK0H 2GITA 3GSVA 3DV4B 3VA2C 1OW0A 4PYHA 5ANME 3E8UH 2Z31B 3HZVA 3D0LB 4OAWB 4QRPE 3VH8B 4WEMB 4DKFH 1FZOB 4U1GC 1AXSB 5EN2B 1M6OA 2Z9TA 3TBTA 2J88L 5EOTB 1I1AC 2WIIB 4MD0A 4QRPD 1K4CB 4NNYB 1D9KD 1QR4A 3BVNB 1QBLL 2VLKA 3P4MA 3MRHA 4FQIL 2ERJC 1X4ZA 4K71B 4D9RE 2HFEB 1EHAA 3O4OB 4M7JH 3V6OE 4RZCA 4FZEH 2HFFA 3BO8B 1UB5A 3VFRA 5LAXB 1N6QH 1FFNB 1UENA 3F5WB 3O41B 4QOKB 4D9RD 4HIEB 3OGCB 2VSCA 4LVNB 3S3SA 1QR1B 3ARBC 1RSFA 3BP5A 4OZGA 5K93A 4HXAH 1I3RA 1BVKA 5HHOB 3ISWA 3MRFB 5CEYB 3BRGC 1W2KT 4YDLB 4F7MA 4G8IA 2DQHL 3MACH 4PUBH 4Y5YC 5GQBA 2LFGA 1AIFB 3S7GA 1YEGH 3P77B 2DAVA 1ONQB 3QBTB 4JQVC 2D0HA 3QG7L 3S37H 5MERA 5D1ZC 4ZS6D 3RWDB 2W59A 3LHPL 4MXVE 4JVPA 5C0DB 3QQ4B 2M8XA 4PLJC 1G9ML 3SE8L 1PD6A 1KTDA 2AJSH 3QFJE 3RGVC 2W60A 2ZCKL 5IVXF 2IMNA 5K59E 4RQQB 2F58L 1J5OL 3I3EA 4KUCF 5CEXA 5IVXB 1WIUA 1AGDA 2Q7NA 3QFJD 1I9RH 5ADPH 1A1MB 1KIQB 4KY1L 4EI5A 4LSRH 1WZMA 3ARTA 2WWMD 4OM1L 7FABH 4V1DE 4PJBB 1UH4A 4U0QB 2EH7H 1CG9A 1A1OA 3AUVA 3CH8A 3ZE1E 2Y5TB 2P5EB 4D0CB 1TVBA 5J06A 4KI5D 2DJ4A 2VTFA 2HJLA 4P2OC 2X4QA 4XP1H 4FP8H 5I18L 5HYQA 4WNQA 4PJ7F 1A2YA 5C0RH 1UKTA 4K23H 3SDDB 2ZPKL 1DE4B 4M6NL 3S6CA 4WFFE 4GRWF 2VISB 2M2DA 3BMVA 4GRWB 3OB0H 2QSCH 3GHEL 4NUJA 1IQWH 3M17B 5DYOB 4D8PA 3HR5A 1CQYA 1MCSA 4GKOA 5JNYB 1OW0C 1LO3H 4O9HL 2NNAA 4YIQB 1FVCB 1TQBC 5EC1B 4EN3C 1T1YB 3ULVF 2J6EH 3DIFB 1QSFB 3P4OA 1LO4H 3WJLC 2G60H 1FVEB 1ACYL 2J4WL 2OXHA 1AO7A 3ZDYE 3RWIB 1A14L 4X9BA 1IAIH 5KVDL 3MRPA 1MF2H 3CC5A 1NGYA 4WEBH 5EORH 3F6LA 3REWA 4XNMB 2AABH 3GIVA 1JWUA 4RGND 1P4IH 4P2YA 3ZYIA 5F3BA 4H88L 1ZHNA 3ZDXF 1GC1L 5DJDA 1U8IB 1K4DA 2GTWA 1JPFB 1IGJB 1PDKA 1NFIB 2VKXA 4OZHE 1JGVL 2R1WA 2BY2A 1EPFA 4XP5L 2EDYA 2FH6A 3VFPB 2JJSA 5SV3A 3VWJA 3VXRA 4MJ2A 3SKNA 2J8UE 3QB7C 3MNWB 2ZCHH 3ZHKA 4IBLT 3FCTB 1FZKB 3IVKA 4U3XA 2VUYA 4JR9L 4TNVK 5T1MA 2QJDA 4L3AA 4FFYH 4G6FB 2OZ4H 3QEQB 3JWDL 4AEIL 4PS4H 1KPRB 5KVGH 2F53A 1CD9B 4P5TD 3ZKMC 3BYTA 5D2LF 3JTSB 5FM8A 3RVXD 4L1DA 4NO2B 5D2LB 4HIXL 3K3QA 2Y06H 4PRBA 4UNTA 1GZPA 1AXIB 4V2BA 1XGRA 3LN4B 1EV2E 5HHXH 1U3YA 3C6SA 1ZLSH 4WU5B 4XZUA 5E95B 5CJ8A 4JN1H 4EI5C 1TIUA 1IC5H 1D9KA 5LGHH 5B21A 3WS3A 2JB5H 3DXAD 4LSQH 2ARJQ 2R9HC 1IGYA 4GG8B 3O0RL 4LKCB 4RRPG 3OAYK 2KZ1B 3PWJB 4WFEE 2VN7A 1HINL 5GZOC 1RI8A 3VFNA 1LGVA 3GIZL 3MLZH 5FHAL 1MVFA 2CK2A 3V8OA 4F7PB 4FA8A 2FJFB 2YOCA 3LKRA 2O5YH 5FECB 2XWTB 3WO4B 4KRPB 4MQXD 1CE1H 4TUJB 2JELH 4LU5L 1CWVA 5L6YH 3A6BL 3T2PA 3VH8G 4OTXL 4DVBB 2CR3A 4JGUA 1CLYL 4LCCA 2OI9B 2OM5A 3N1QC 3P4LA 3W9DB 2WUBL 4IDLA 5FUOH 4U3CA 4LCUA 1DTUA 1KJVB 5JW4M 2BCKA 2F19L 5M7QA 1D5MA 2XT1B 1NBVL 2IAMB 4BH7A 2HTLD 5BMFH 3ZT6A 2XXCB 5KSBF 1MCQA 1IAOB 1VFBB 5D72L 3UPAA 3G5YA 4U1IA 4APQD 2X4PA 3MPCA 5CKGA 1BQLH 4UV4H 5IMKA 1FC2D 4KZDL 4UV7L 2CXGA 3V7AG 2EDFA 3RZCB 1CXLA 4POYA 5KAQF 2WIMA 3PP3H 2MFNA 1WEJH 5IESH 1S5IL 3JWNC 1T5WA 3NVQA 1VERA 3G5ZB 4RFOL 4EXPX 1J0YA 1NEUA 1F6LL 3TO2A 1SEBA 1KYOJ 5IMOA 5D7LA 5BO1L 1DQDL 2NXYD 3HG1B 2JJSC 3O3DB 1QVOA 1DQML 3L3IA 4FFZH 2H2SC 4WO4D 25C8L 2YPVL 3UP1A 4HIIB 4ACPA 4G3YH 1HXYB 5HY9B 3NZHH 1Z9SA 4UTBH 3OBAA 4W4OA 1P1ZA 4MXQD 3UXFA 1OSZA 2DYPD 1ZAGA 1NLBH 3BHBB 8FABA 1I7TB 2EDLA 4LVHC 3QUYB 2X40A 4AMKL 3I6GA 1XCTA 1UQSB 4HMDA 5I1GL 1BBDH 3QDGE 1ZLWK 1JNLH 2IBBA 4KPHH 3UTQB 1T3FA 5DLML 1OM3H 1RIUH 4KQ3H 2FCBA 2IPKB 5ITBH 1T6WA 2GAZA 3TBVA 4NC1C 2FSEA 3FB5B 1D9KC 4JM2B 5AWNH 5L8LB 4R9HA 2AK4E 1O7VA 3I9GH 5AAMA 1QO3B 3OR6B 5I66B 3D39A 4JVUA 1G7LB 3MV7E 2X41A 5HVHB 1QG3A 4HUUB 3GNML 3SJVB 2AK4D 2P8PB 1GXEA 3DV6B 2NZIA 5JIHA 4YXLL 2QSQA 1EO5A 1H3UA 4JANB 1YMMB 1RMFH 1HDMA 2IAND 3DSNA 3RUGA 2BNQE 1VGKB 4NQEE 5ACZA 1JYXA 2HWZH 3JTTA 4XMPL 4NQXB 5D96C 4RNRA 3BP7B 4LCCC 3NBNA 1BQHB 3VW3L 1NDMA 3GBMH 4J3WA 2J5LC 3OR7B 3D9AL 3AU1A 3NGBC 4M7KL 1XGUA 3HCVA 2ZSVB 3KPNA 4R4FL 3KPLA 1DUYB 4LLUB 5ERWB 4EDXB 5EDXA 3PQYE 4ZS6C 5DQ9B 5FUZH 3U6RA 1EH9A 4NHUA 5I19H 3N85H 5I8OH 4WI7A 1AJ7H 3FB8A 3S5LB 1A7BA 3PQYD 3EYSH 4Z8FL 3C8HA 4RAUA 4WI3A 5D7KE 1MRCH 4HK3N 1EVUA 4DAGL 3LMJH 2AI0L 4E41D 2WV3A 2Q86B 4K9EL 4BFBD 4XCFL 1RZGA 4NZRH 3HAEA 2A6JA 1JK8A 3U30B 3UJIL 5C0CE 5TFSH 1CFSB 3V5DB 3DXAA 3CDGA 2WWMC 4M62H 4Q9RL 3EIFA 2I07B 2XN9A 4JN2A 3MBEA 1JWSA 4YXKL 4JGJA 1FFRA 5C0CD 2B1AH 1WIPA 1Z5LB 4JREC 4G8GD 4AENA 5E00A 4KI5C 1A6ZA 3NIFF 5JW5B 1P7QB 1UADC 1UKSA 4N1HB 3QUZD 4ODXA 3W39A 1YNKL 1MCRA 1WC7A 1UJ3A 2FO4A 4HS6B 3WXWL 1S7TB 2MMXA 1A5FH 5SX5K 4S1QL 3AS2A 1Q94A 2W9EL 3QIBD 4RDQF 2VE6A 4F2MA 1OTSD 4Z7NF 4KQ4L 5JW3L 3LRSA 1CDGA 4YPGA 1HCVA 4NKOA 4BFIA 1XGYL 1F45A 1C5CL 3D69B 4P3DA 1G0DA 3FFCD 4I77L 2ZOKA 5HPOA 4HBQA 2E6QA 1JHLH 2D4FA 2ED9A 1JGUH 2YSSB 1F4YL 4I13B 1EHLL 4APQA 1TCRB 3OJMB 2UUDK 1HILA 1D5BB 4TSBL 4V2CB 5J6GB 1YZZA 3P9WB 1OSPH 1KACB 5I1CH 5IQ9A 3MRRB 1BLNA 5C8JA 4ELMA 4Y4KB 3GMQA 1GGCL 2OMBA 5EIQA 4RGNC 5IQ7H 2AJVH 4M6OL 4Z95L 5AUMA 4Z9KB 4KTDH 1FNGB 4WHTB 1FFPB 4PRIB 5SX4H 1OAXL 5DUPL 1U8NB 2VDQH 5D71L 3GO1L 3LSOA 2NY1D 3V4VL 1MAKA 3CFBB 3MJ9L 3TYFB 2BJMH 3QRGH 2OS7A 3AMLA 1R24A 4ODWB 3VG9B 5FA4B 3WBDA 4PJFA 5IB4B 2IH3B 5FFLA 1NC2D 3CAFA 1MCBA 1AC0A 1CL7L 2R23B 2CJUH 1FL6B 1LE5A 1UM4L 4PLKD 5K9JL 2XZCH 5C07E 3X12A 5KAQG 2XTLA 4PJCA 3FT3A 4JY4A 1MAJA 2DYPA 4HC1A 1B0WA 1CD0A 4UT7H 4QHUA 1ZHLA 4P5TC 5CD3B 5C07D 2PNDA 3RVXC 5MI0C 3JZ7A 2CLVA 5KANI 1LEGA 4JFFB 4W68A 2C7UA 5E6IB 3V6FA 4JJ5A 5F1OB 1FLRH 1K6QL 4LPXA 1H0DB 1TLKA