4EI6B

Structure of xv19 valpha1-vbeta16 type-ii natural killer t cell receptor
Total Genus 51
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
51
sequence length
244
structure length
244
Chain Sequence
MGPKVLQIPSHQIIDMGQMVTLNCDPVSNHLYFYWYKQILGQQMEFLVNFYNGKVMEKSKLFKDQFSVERPDGSYFTLKIQPTALEDSAVYFCASSFWGAYAEQFFGPGTRLTVLEDLKNVFPPEVAVFEPSEAEISHTQKATLVCLATGFYPDHVELSWWVNGKEVHSGVCTDPQPLKEQPALNDSRYALSSRLRVSATFWQNPRNHFRCQVQFYGLSENDEWTQDRAKPVTQIVSAEAWGRA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Valpha1 XV19 Type II Natural Killer T cell receptor (mouse v
publication title Recognition of CD1d-sulfatide mediated by a type II natural killer T cell antigen receptor.
pubmed doi rcsb
source organism Mus musculus, homo sapiens
molecule tags Immune system
total genus 51
structure length 244
sequence length 244
chains with identical sequence D
ec nomenclature
pdb deposition date 2012-04-04
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4ei6B01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4ei6B02
4ZSOB 4KUCD 1TJGH 3VXOA 1FYTE 1AQKH 1JPFA 4OLZH 5BJTA 2DL9A 1UC6A 1RULH 4J6RL 5TH2A 4LHUB 1V3KA 4WENB 3ARSA 3NPZB 3MRBA 2X4UB 4LHQB 4O51B 3X12A 1J18A 5EUOF 4M43H 4DFIA 1KELH 1HNGA 1QBBA 5E99L 3VXSD 1XMWA 5D93C 1DEEA 5DMIH 5TF1L 3VXQA 5C7XH 4P49A 4YBQC 3KG5A 3TP4A 5EIQA 2GK0A 4BZ1L 2Y07H 4ODXA 3CFDA 4PV9B 2OR7A 1UACL 1N5AB 4PFEA 3WUWA 1LP9E 2ZOKA 2IANB 5JR1L 4NKIL 4R26H 5D7LE 3TFKC 1S9XB 5J13C 1G84A 5DJYB 3EJZD 4OF0A 4XC3L 2WZPD 2VLKD 3JTTA 5E94A 5B38G 3QIUC 4XWGL 5J57B 1FIGL 3OJ2C 4KY1L 1AFVH 4LLMB 5DJCA 4H0HB 3MJGX 1HHJA 3W82A 3TVMB 3FCTB 4BK4A 1AHWC 2F53A 4ONHB 2XRAL 2H6PA 4LIQH 2X1WL 5JLZB 4XX1E 4ENED 2XTLA 3C6LD 5I1EH 1Q94B 5GS1A 3EZ8A 4XRCB 2P5EB 4FN0A 1DQDH 3OSKA 2VIRA 1H3TA 2YXFA 1MCOH 1Z2KA 3MNVA 1OF2A 2EE2A 3CSYB 3BGMA 5HYEA 1DN2A 2BP3A 1KT2B 4PS4L 2DQJH 3QO0B 4K8RC 1YUHB 3OAYH 3CVHA 4M00A 4H25B 3UCRA 5IEKB 3A6OA 3S3PA 1OW0A 4X6FB 4ZD3L 3CC5A 1IL1B 2VDKL 2XQYK 2I25N 3B9VA 1KYOJ 4U1IA 2VDOL 3U4AA 3ZKXC 1HH6A 1HI6B 1HSAB 5F6IC 4U1KA 1JNJA 5CS7A 5EWIH 3WS6A 1JJUA 5AAMA 3PGCA 4AK1A 1G0YR 4L4VB 4G9DA 2IG2L 3WD5H 4MJIA 5IVXE 1QA9A 2NX5D 5EBLB 43C9A 1CL7I 4PY8I 3G5ZA 5JXAH 3EO9H 2YOCA 3BZDA 5A2KH 5ALCL 3F7QA 4QCIB 5C6TL 4I0PA 1UCBH 4MAYB 1JF5A 4L9LA 1TVHA 3OR6B 4X9BA 5KN5B 1MEXH 2FL5A 1MFAH 4OZIE 4G6KH 2RHEA 4GAGL 1NDGB 4MJ4A 4OFVA 1BFVH 1JZ6A 1D9KB 4XAKE 1DLHA 1N6QH 3IDIA 4NRZB 1F11A 4G6AD 1JE6A 4O2FA 3V5HB 2DI9A 3S5LA 3GMMA 3GNML 4J4PA 1EJOH 4OCSL 1SHMA 5C86A 4XVUC 2Y72A 3I6GA 5DJXA 3CXHJ 4ZDHB 3ZE2F 4LVNB 4E9LA 2JTDA 4OGAD 1A6ZB 1HKLL 2C5DC 3VDBA 3ZYOA 4QT5B 4F7TA 2Y6SD 3WE6B 5I19L 5JDSA 3P4OA 2J8UF 1NEZB 2N56A 4U31A 3AROA 3PGFH 3AS2A 1JF1B 1FVEB 3VRLE 4NBXB 4PP2B 2CUIA 1QFWH 4KRNA 5HYIA 2EH7H 4PIRF 4DN3H 2CGRL 4NIKB 5EPMA 5DD3H 3VRIB 3D87B 3UPRA 5FDYA 3AREC 1SVCP 3BGFB 4W81A 1MFNA 4ORGB 5GRXG 3HKFA 3DX7B 3BT2L 2FX9H 2Y1VA 4L8SC 2H3NA 1H3PH 4OLWH 4YHOH 3Q48A 3NOIA 1A2YA 2R4SL 3EO0A 2YPLD 3LOWA 5DFVC 5FCUH 1A7BA 3S35H 4U1MA 1DVFA 1T5XA 4RFOL 1A7NL 1MH5B 4V1DA 1C1EL 3TT1H 4GQ9L 5BZWA 4TUKH 2FBOJ 2HAZA 2O5YL 4XP9L 5D93B 3HZYB 1T0MA 4RISH 5F3BB 5FUCC 3TA3D 3KNBB 1JWUB 1K3ZA 4MB3A 4QTIL 4HMEA 4POZC 5JHLH 2IGFL 1UCTA 3QG6A 3PWPB 4ZS6C 4YXLH 2HMIC 5F7NC 4JM2B 3GSNB 5EA0H 4OZHE 1J11A 3KPLB 4JFYB 3V0AC 2VXSL 1Z6JT 1A3LH 1N2RB 5J13B 5GS0L 4LP5A 4MSWA 1Y18A 3VXMB 3LRSB 4CVXA 5DDHA 3C5SA 3RQ3A 3GJFH 3N50A 5E6ID 3QIUB 4NBYB 4K2UL 3QP3A 1AKJB 1E0OB 5HDBF 2FJHA 2N7AA 2X6MA 1WISA 3B9KA 3MGTA 4KV5E 3QDHA 3UTTE 3EFDL 1AHWB 4HG4J 1YN6B 1CZ8H 3MV8D 1DUYA 3LS5L 5KTEL 1SYVB 4J1UB 2BVOA 5GGVL 2DS4A 1MCNA 3W0WE 3RI5F 2ADGB 1CLCA 1I3VA 5IM7A 4GW1B 1MCPH 4MDJB 4WI3A 3U0PA 1MWAL 5T3XH 2E8ZA 4O4YL 3TBYA 1PX3A 4MNGB 1NAMB 2VMFA 4NKOA 3P0VL 2CIKA 1NH6A 2OXHA 3RVXC 2AJ3B 3B83A 2ITCB 1KIQB 5BO1H 2D0FA 1FDLH 2Z8WC 3PQYD 4POYA 1RUML 1YJDH 5DJ2B 1DE4B 4JRYE 5CZVH 4HUKB 4N5ED 1ZGLA 3VXSA 1MCDA 3VXUB 4X4ME 4PJCA 2R56H 2F19L 4NNYB 3JTSA 1X5ZA 2VJXA 3G5VB 3HZVA 1RIHH 2H1PL 5JXEC 1IBGL 1RFDL 2FCBA 3EHBD 2VH5H 1P7QB 4KAQH 4PJ7F 5DVNA 4DFHA 1OWRM 1NDMA 5H35B 3LEVH 3KS0H 1QZ1A 3U79A 5DJZA 5GRJH 1HWHB 4F58H 3D18B 1CDYA 3JWNC 1MIML 1TJGL 5EUOB 1I8KA 3CLFL 4BSWB 1HQ4A 3PWVB 5TDOB 1ADQH 2VLKA 2CO7B 5DYOA 1I4FB 2WINB 3RX8A 3MCLH 5TFSH 3ARBB 1BWMA 4OCRH 5I76B 1MJUH 2EDOA 4M43L 2AJSH 5LGJA 3STLB 2R8SH 5T1MB 5F21B 5E4EC 3MCG1 2NYYD 1QSFD 1RHFA 4Z77A 3VFGL 3C6LA 1QLFA 5FECA 4QY8B 3TCXA 3AREB 1RI8A 1JPST 1UKSA 2VYRE 4MWFA 3QQ4B 4L8SB 2H2PD 4LPUA 3OZ9H 2Z92B 2QQKL 2VN4A 3SKOA 5CCKH 5M94B 3AY4C 2EEBA 1NMBH 5SV4A 4R26L 5AZ2H 1WK0A 2NY0D 2EDJA 2PYED 3DI3B 1QPPA 1RJYB 3BD4A 1AGEB 3RZWA 4WNQB 2ZJSH 3IGAB 4OUUB 1TZIA 2F8OA 4M1CD 5KSAC 3I85A 2A1WL 1AFVL 4HH9B 2DQCL 2GT9B 3MLUH 3NACH 4CDHA 4JQXC 2R23B 3PL6B 1B90A 3RTQD 2NX5A 5CSGA 2EDFA 5CZXC 3CX2A 3VXRD 2Q76B 2MKWA 5ADOH 4P46D 3OKOA 5IB4A 4RIRB 2DRUA 4HCRL 2C26A 1JK8A 2B0SH 5I1EL 3MREA 3WL9B 1U8MA 4CL7A 1K3IA 4PRHE 3OHXB 4YH6A 1L4IA 4F2MB 2ICEB 3SGDI 4EJ1C 3BRFA 3L3IB 3GUTA 1MCOL 3CFKB 4I48A 4EI6B 1NGQH 3E6HB 5DURB 4Z8FH 1NBYB 1F97A 1AJ7H 4LCYB 4LLWA 4JN2B 2IC2A 1NCTA 2PETA 3MRHA 4TQEH 1NMAH 4Z78A 1CLYH 1M71B 3NCJL 1K4DA 1OB1A 5E5MA 4PRPB 3SGJA 2OL3A 3PP3H 2NW2A 2W9DH 3KLSA 5FM5O 4PJXE 4R7DA 3TT3H 1B3JA 3CFEA 5EWIL 2W65B 1B0GA 4X5WA 3UTSA 3KDMB 4Z0BH 1BM3H 5FB8A 1G6RB 3BESR 2V9RA 3EO9L 5C6WH 5KW9H 3MRGB 2IAMD 1U8NB 4NO2A 2HKFL 1UCBL 2YPLA 4DK3A 4KI5F 1MEXL 4ODWA 5JIIA 4G6KL 5BVJB 4WEMB 4WUUE 4X4XB 3ARRA 1K8DA 4X80H 5F9OH 3C9NB 4JZNA 1S7UB 1XGPB 3BP5A 3BUYB 1N6QL 3KLHD 2R4RH 5EO1A 2IPTH 2J8UB 3FQTB 4X7DC 3RU8L 4H88H 4NO0D 5HGDA 5DJ8A 2F74B 2UUDH 4HC1H 4S1QH 5CEZD 2C3VA 3DGGA 3OXRA 2CRYA 3MV11 1JTOA 5CBAA 2DI8A 3Q6FB 5MEOB 4FFZL 4JY4B 1F90L 3U9UB 5HVHB 5C0GA 3JWOH 4JKWA 4NYLB 5CSZA 3LQZA 4NQEB 5I0ZA 4FXGB 3UAJD 3TZVC 1AQDB 4FQ1H 4NQTA 4ZUTA 3ARPA 4BFEA 1QFWL 2XY1A 2VLRE 1FYHB 3MBXH 4GG6E 1YEIL 1R5IB 1A1NB 5DD3L 2BX5A 3O6KH 1FBIL 3W9EA 3QI9D 1D5ZB 4MVBC 4F9LA 5J6GA 5E6IA 3QJFA 3FB5A 2GUOA 3O4LE 5EIVA 5E08H 2FX9L 1PY4A 5CILH 1OGAB 2P43B 4OLWL 1OTSC 4PTTA 2C4FU 4UQ2B 1RQ5A 3QPXH 4HWNA 1VEPA 2AERT 3MROB 3QDJE 4NKMB 2NY3B 3S35L 1D3CA 4XBPA 3U7YH 3VGAC 1FVDB 3RI5K 1VFUA 2IMNA 3TO2B 1Z5LB 5CHNB 3M17B 3MV8A 1BBJB 2IALA 5E8DL 3MLYL 3QBTB 3DRTB 2FECL 3V52L 2AXFA 4RISL 1GZQB 3RRQA 2BNUA 1KLUB 1CICC 2X4QA 5LAXB 2MKLC 2X5PA 4YAQA 3WHE0 1WZMA 5JHLL 3MGOB 4YXLL 4UTAH 4Y19E 3BPNC 5H37H 1RY7B 5KJRH 3O6FD 3BRDA 5EA0L 3BI9X 1UXWB 4BQCA 1WBZB 1R3HA 1A3LL 4YPGB 2E27L 4Z5RA 3DETD 3L3GA 1OSZA 2FHBA 5CEYA 3FB7B 4G8FA 4PBXA 1I1RA 4X6EA 1LE9A 3MUGA 1UYWH 1C08B 3IDJA 4I77L 3QUMA 4I2XA 2WUBH 1MRDL 4OLYH 4LCIH 2V5RA 4YHLH 3NFPB 4WRLA 3EYQC 5GGSY 2CDFB 2A6KB 1VKXB 5BZDB 1ZV5A 3WDHA 5D7IF 1FG2B 2WWMC 3UTZB 1EHAA 1CZ8L 4FQXD 4AZ8A 2X05A 5CD5D 2XTJC 5IROC 1AD9B 4S1RL 4TNWF 5L7XL 4ISVB 4X9GA 1N0XL 4OZFG 3PJSA 3IU3A 1ITBB 4KI5C 3HHRB 5T3XL 4EDWL 3GSRA 4Y1AB 3DROB 12E8H 5HYFA 5F1IA 3ZLQC 5HYJB 7CGTA 1MCIA 4GLRH 1N64H 2E6QA 1UT9A 4J3XA 2VDLL 1NBVH 3UBXG 5IGXL 1P7KB 2ZUVA 1J10A 1RK1A 3BKJL 4PJ7B 1ZHLB 5I66A 1QSFA 3T65B 2R56L 1FFNB 3CK0H 43CAA 4JANB 4IM8A 3ZT6A 4EUPA 4DKEH 4ZOBA 5E2UH 2R0ZH 4OQTA 3R06B 3LV3B 4KAQL 2DQFB 3B8YA 1BZ9B 2OBGA 1KTDA 1P5VA 4NNXA 5IHLB 3EJYC 4KHTH 1FHGA 2V7NA 1OTUD 2MTPA 4P57A 3BOVA 1Y6KR 1KXVC 3QO1A 5GZND 2E6JA 2PYEA 1JZ5A 1YEGH 3P77B 3P4LA 4EI5C 2E9IA 1W0YT 4M7JL 1Q9OB 3GSUB 4Z7VF 1MHCA 5I1GL 2D31A 5TFSL 4KDWA 1MJUL 3FL7A 3KPRD 3EOBA 3IS1X 3S9DB 1QEWB 2NXZD 3RTQA 1N7ML 1H3GA 1BFOA 4YFLF 5SWQB 2OSLA 1IAIH 4P9MH 1AD0B 4P46A 4RAUA 2VLME 2AKRB 2EIZA 4JDTL 5C0AD 4H8WL 5ESQB 3QCUH 3TN0C 1K85A 1IZJA 5EOTB 1T22A 2HFGH 2BVQB 4XCEA 5E8PA 4U6HA 1LNUA 2YKLH 4QGTA 3VW3H 5JUEL 1ZS8B 1I3RA 3LH2H 1ZT4B 2EXYC 3O3AB 2HJLB 4E42B 3E3QC 4E41A 4GAYA 4Q74A 5J6HB 5FF6B 3VFPB 1BOGA 4PJ8C 4PRNA 4JPIB 2Q8BL 3ZT7A 5AZ2L 4KMQA 5HHMD 1CR9H 2ZCHL 4R90L 1DBAL 3ROLA 4LU5L 4XTRD 1M7XA 2I9LB 5IWLA 1T3FB 2ZJSL 1HXYA 2H41A 4UINH 4PD4K 5DC9B 3LPWA 5HHOB 1K4CB 5EO9B 3SPVB 3VI4F 5E5RB 2R1XA 5IHZA 5INDA 1P4IL 3MX0A 4Z76B 5GS0C 3BPNB 3MLUL 4ESKA 1LEGB 3PWUB 1NQBA 4UMGA 4LSTH 2Z35A 4OLUH 5ADOL 3KPMB 3ZKQD 1DLFL 3K4AA 2BRQA 4H1LB 2IAMA 3X13B 5C08B 5C0BD 1G9NH 3K3QA 1OPGH 3LKPB 3OKMA 4HWUA 4YUEL 5F7EH 3HMXA 1S9KC 3L3JA 5JOFB 3HUJE 3IKCA 4W6XB 4F80A 3G6JF 3FQUA 1G7QB 2NTSP 5FO9A 3WFDL 1NUGA 4NP4H 1H9VA 4Z8FL 4WCYL 2L0DA 4NO0A 4HIIA 4GUPA 3NA9H 2LU3A 4PPTA 4TQEL 3U4BL 1NMAL 3OGCB 4KKAD 4WV1C 4EXKA 2R2HB 5E70A 3FJTA 2W9DL 2XTJB 4ZFFB 3WXVL 2D2OA 2Q86A 1RMFH 3GK8L 3TT3L 4H5SA 4G9FB 2UWEE 2YEZA 1RUAL 1HZHH 1CLZH 1QD0A 4PJEA 3BH9A 1S7XA 5FGBA 1LE5A 1BM3L 5GRVL 4N9GB 3VGBA 2BXYA 2XPGB 4U0QB 5KW9L 3FT3A 5GGTH 4UAOC 1CFBA 4HIXL 1FG9C 3HC0A 3CFIC 4P2QB 4HS8H 1D5MA 2C1PB 3BW9A 4TSAH 5F1KC 4J8RA 2JCCA 5I18H 4WWID 3W39B 1BFSA 2Z93B 3B2UD 25C8H 4YDVB 4X80L 5F9OL 3QQ9D 4ZXBB 1G7MB 4U1HB 3DO7B 4MJ6B 1MF2H 3IDNA 1Q72L 2R4RL 2IPTL 3HNTH 1W0VB 3VI3E 1F8TH 5C92A 3TJEH 4HC1L 1S78D 3IJYB 1Q9LB 3CDCA 1K8IB 2NY4B 5DVLA 4ZFOB 3RDTD 1D9KD 4PJ9D 4MXWH 2AV1B 1IAOB 1IQDA 2OTPA 4Y5XC 4LPTA 3SDXA 4MNQE 4O02L 3GHBH 4LQFL 3LKOA 3U2SA 3TNMA 3MBXL 1FNLA 4P3WA 5I6XB 1HHIA 3O6KL 1IILE 1KJ3H 2YD2A 4LSQH 4EI5B 1JHLH 3SDYL 2IFFH 3GZKA 2I27N 3UMTA 4I3RL 4KJQC 5DEGA 1Z9LA 3VJ6A 5E08L 3ULVE 1MIEL 1A7RH 3V9FA 2OJZH 2HT3D 1R3LB 4TNWK 2G9HA 5K59E 1YNLL 4UBDD 5D2NE 1R3JA 4FQXA 4HXAH 4ZOCA 1UGNA 4HJ0C 4L29B 3WS3B 5IBTL 5SWSB 4LF3A 2XNAB 4JFPA 3H9SE 3CAFA 4TVPD 4HKJB 2EDTA 3LVEA 5KJRL 2YPKB 4R0LC 2K9UA 3L7FB 1EXUB 2AXGB 2A74A 2HRPH 4YBQD 4PJ8B 4KK6D 2AEWA 5HHPA 2DJUA 1A8JH 4NKDA 1QVOB 3PWPD 1WZ1H 4JFHE 5F7WC 1F6AA 1UYWL 5D7IB 4A6YH 1ZT7A 1UB6B 1GVIA 1FFOB 2WUBL 5I1CH 3QHFH 3DECA 1J0YA 1KEMH 3BGAA 4HKBB 3MPCA 4LCIL 1JZ2A 1AC0A 3EYFA 4OLVH 3MRLB 4JVPA 4YHLL 3MNZB 4N0FB 3BZFB 4X83A 2EIDA 1VGKA 4Q0XL 2CLVB 1YNTB 3PP4H 4QRUB 5D9SA 3DUSB 1UG9A 4WY7H 3T0EE 1YEJL 5E00B 5A2IH 5IMMB 1HHHA 2BHZA 3TNNA 4QRSB 2CRIA 4RQQA 5DD5H 2NQCA 5C0CE 4XP1H 3M07A 3RHWF 3GJEA 5FUZH 3B3IB 4XAWH 3RL2A 3OKKA 2EKSB 2FZ3A 1WIUA 4YXKL 1YMMB 1QO3A 2NTFA 1YEEH 5EIIA 1J8HA 4J12A 2P49B 5C8JB 4PJBA 2E7HA 4KJYB 1DQLL 2DLGA 3AAZB 4ZNEE 3ILQC 4ZSOA 2XACC 1LO3L 3LKQB 1PZ5A 4WV1B 5DI8B 3KPNB 3DTXB 1MWAB 1BZ7B 1BWWA 3KPRA 1N64L 3I3BA 2VABB 3OKNA 4X7SH 5HI5C 4GKNA 1MHHB 1Q0YH 1I8IB 3R4DA 3HRZB 4WO4B 3OGOE 4XWOD 3CK0L 2V2XA 4O51A 1JNLH 1TNMA 1L7TL 3AS0A 1X5IA 4MA7L 1A7QL 4BQ6A 5E2UL 5BS0B 3AUVA 4UAOB 2YWYA 2JIXD 4TOYL 2JELH 2R0WL 1SBSL 4N0CC 2A9NH 4KHTL 1NL0H 4Z7VB 5B3NA 4RA3A 5EB9A 4NC2B 3HRPA 1FNHA 4FTVD 4RFNB 1YEGL 4PV9A 2JJTA 5IIEB 1N5AA 3MBEC 3VFMB 1AO7E 3EOAB 1WBXA 1T5WA 4JPKH 4RWHA 4XPFH 4KJPC 3F5WB 4AT6A 2IANA 3V7MA 3WIFB 2EH8H 4XNMA 3P2TA 4PREB 1QNZL 1DANU 3QHZH 4WFED 2XN9D 4Y5XB 1T89C 3RWHA 4JFFD 2IQAB 3QT2A 4OZGE 1QLEH 2R1WB 3QULB 4HFUH 3LMJH 3QCUL 2Q1EA 2HFGL 4F15C 3VW3L 1YPZA 5IF0B 2ZPKH 4Z7OF 3I6LE 3LH2L 1KLFA 3FQNA 1FZKB 3WFZA 3MOQA 3MV7E 3ARXA 5FUOL 4NGHL 1QRNB 4NQSB 3STBA 4DOHE 1E4XI 3X3GH 5IMLA 3PNWA 1RAMA 5I8EA 2ICWA 2HH0H 1YEHH 2DLEA 1FZJB 3EBAA 3MOBH 5HJ3B 3G5XA 4HUNB 4XPHH 4H25A 4X4ZA 3OAYK 4X6FA 2XZZA 4U6YB 5I9QB 4JKLA 4U1JA 3QXUA 4JGJA 4R0LB 1HYSD 2ED8A 5HBBA 1OAKL 4LSTL 2X40A 1KSRA 3G6JB 1CE6B 5LG1A 1P84K 3CLEL 3VD3A 2J12B 4OIIH 1F45A 4Y7MA 4KZEH 1TXKA 4Y4FB 5BRZB 1RJZB 4WI4A 2HMID 4MJ2A 3LCYA 4YWGL 4WHTA 3RA7H 3GHEL 4ZTPH 5F71A 4RSVA 4YLQT 4WTXA 5BMFL 3OR6A 1NFIA 3NA9L 2IPKB 4MLSA 1XCTB 3OMZA 4YHYC 4YR6B 3CH1B 4ELME 4JGMA 5EC1B 4R4FL 2QBWA 3RDTA 1ED3A 1BQHB 1D9KA 4D8PB 4NRZA 2IBGA 3RWFA 2HFTA 3V5HA 4G7YH 4C56B 1JHTB 4NZRL 5IW3A 4LCCC 1Y0LB 4L3AA 1S3KL 2P7TA 1M6OA 1TPXC 1RZJL 4M03A 1YYLH 3CZFB 1D5IH 2HYMA 4ZDHA 2AJVH 3JVGA 1FV1A 4K3DH 1H15B 4QT5A 3ZE1E 3HG1E 3WE6A 4LASH 4PJIA 1NEZA 5DK2A 3DX8B 3QIBC 2B1HH 4MQXD 1JF1A 1FVEA 2DJSA 2P8LA 3IDGB 2DLFH 3HI6H 1OP9A 5GXBB 4HS8L 4TTGA 4U6XB 2QLVB 3VFUB 4KQ4L 2GFBA 1INEH 4K71C 3WFEL 3ZTNH 1AGFA 4QKXB 3UTQA 5I18L 3E2HC 2ZNWA 4ORGA 3RWDA 25C8L 3RVXD 4JHWH 4P2OC 1BREA 4Q9QH 5DWUH 3RWEA 3IDMA 3CPLB 4PJHA 2SEBA 3I75B 1FNSH 2PR4H 3RUGA 3QUYC 5BV7L 1O7SA 2W59A 4L3EE 3WFHB 4PGEB 4NQDE 4PGBB 2B1AH 2YPVH 1N6UA 1MH5A 1S7SA 2VAAB 3JV6A 3ZE0E 3QEGH 4MXWL 3GM8A 3HZYA 4LP4A 2ZKHH 3GSQA 2HN7B 3NIDF 3PDOB 3KNBA 2CLZB 3D6GA 5EN2B 1VFAB 3SDAC 1JWUA 3QRGH 5H2BB 1GPOL 3PWPA 2VLLA 4NHUB 4QRPE 3C08L 2XWTB 4ODVH 3MBEB 4OM1H 4XVTL 4LSQL 3A6CH 3P30H 1RK0B 1N4XH 3FFCE 3KPLA 35C8H 4JFYA 4QTHA 2H32H 3JSSA 4XNXL 4M9PA 1A7PL 3VWJC 2V5SA 1KLGB 1LP9F 2J6EA 3LN4A 1N2RA 3VGHA 4YHNB 2OJZL 1ZVYA 2VLJE 3BDBA 4H8WC 3V0WL 1QPXA 3VXMA 1G7IA 4YZFE 4B5EA 3LRSA 5IMOA 2AW2A 4EQ3A 1OD9A 3KXFD 1J1XH 4JHBA 2D7TH 3V4VL 3RHWK 2BNRB 4HXAL 4MZ2A 4DWHA 2EO1A 4NM8H 2MHAB 4EOWH 1LDPH 4GXVH 1ONQA 1SEBB 2LFGA 5KAQF 4AG4L 2E7LA 2I07B 1HHKB 4J1UA 1BQSA 3KPPB 1UH2A 2HRPL 3INUL 2X4NB 2ADGA 2AABL 2ATPB 4MQ7B 2NXYB 3PHQB 1Q1JH 2IADB 1T6VN 4H0IA 4A6YL 3RNQA 5EZIL 2CKBH 1XGYH 3BVNB 1XEDA 1I1CA 5I1CL 2AJ3A 5HI4D 1KEML 1FCGA 1ODAA 3QQ3B 4CADB 2QSVA 2XV6B 4OLVL 5L2KB 1O0VA 3G08A 3K46A 4OKDA 2K7QA 3CU7A 1F2QA 3RKDC 3GJFB 1KCRH 3PP4L 2AJUL 3BDXA 1DE4A 4P23B 4PG9B 1HEZA 4BH8B 5KSAD 5HY9A 1GZPB 3MXVH 2GJ6B 3CX5J 5F7MC 3MJ8B 4N0UE 1B4JL 3IXAA 4NT6B 5DD5L 1NUNB 4FQIL 4ZNCD 5FUZL 5IVXF 1N59B 5CZXD 4XAWL 4Y8DC 5FHBH 1G7PA 1RUPL 1VEMA 5H35A 1YEEL 4G8IA 4I3SH 3DUUB 1K9TA 4X5LA 3D18A 3SE4C 4KVNH 1PG7L 4HPYH 4OZIF 3MLRL 5KOVC 4C59B 3DUHA 2GYSA 5EUOA 1FO0H 3Q2CA 5TDOA 4L5FL 2EE9A 1Q0YL 1PG7W 1CDJA 1X9QA 2W0PA 4EN3D 4JFFA 3U0WH 5EOCJ 4LCCB 3UTPD 2VZTA 1I4FA 1WJ3A 2WINA 4NN6C 1QUNA 2GSIB 3OKEA 4Q7DA 1CCZA 3VMNA 1JNLL 4HFWA 1JGEA 2VZ3A 4G3YL 4MHHI 5I1AB 5T1LD 5FOBB 5DVOA 2ICWJ 4RFEB 3DMMB 4I5BB 4QXUH 2DYPB 1CFNA 1JGUL 1LILA 3O3BB 4D9RD 1NL0L 1DQQA 2DD8H 3K4ZA 4ZPTB 3E2HB 1A1MB 4L4JA 5L9DH 1ETZB 5CJ8A 3ULUE 3N9GH 5T1DL 5FA3B 4Z7QF 5DHYB 4DK6A 3UZQA 2YD5A 5E2JA 3VWKB 4K3JL 4P2OB 3QQ4A 3SJVB 4URTB 2Z31C 2Z92A 3L7EB 5T3ZE 3L6FA 4ALAH 1U3ZA 1XCQB 4Y0GA 4JPKL 1H3UA 3IDUA 3K0WA 2F54B 3QUYB 1T2XA 1H5BC 4GW5A 2X44D 1JYXA 1CL7H 3PABB 1A6VH 5GGSB 3O2DH 5KVMC 3L9RA 1BIIB 1AGEA 1UKTA 1MREL 5EOQL 3ARQA 3TO4C 1T7YA 3K2UH 4G43A 3V7AE 4M6OL 1QLEL 3WNPA 2F53E 3IDYC 4HH9A 3UO1L 4GXUN 4LBEB 2UYLB 4TSBL 5EBGA 1YQ2A 2ZPKL 3VWJB 3MRCB 1CDIA 4J3WA 3O3UN 4H26B 1MI5D 1GGCH 2MQCA 4OJFH 3TZVD 1VCAA 2ZCLH 4LLUB 5FYKU 1FNFA 1ZHKA 1QBMH 2FGZA 1CGSH 1I9EA 4JO3L 3ET9F 2HT2C 5IMKA 1SYSB 3WL9A 3AB0C 3OHXA 4LSPH 4OQ1A 1SJVA 2ICEA 3DXAD 4KKCD 1KN2H 3L3IA 3RWJA 4B7LA 1YEHL 4MA3B 3CFKA 4NC1E 1OTSD 5D6DC 1KB9K 3OX8B 3LPGA 1NBYA 4JN2A 4YO0B 1PSKL 1R3KB 2GTZB 1WEJH 1A0QL 1IGIL 1MSPA 2YWZA 2RIKA 2R2BA 1GGYA 3QDGD 3FHQA 4MJIE 3PP3K 1EPFA 1CICD 2VXUH 3HC4H 5A40E 2D7MA 2E9WA 4OZ4A 4Y2DD 1MFDL 1HWGB 5TGBB 4OIIL 3MLSH 2EDRA 4YGAB 4NO5B 4R3SB 2HFEA 1OHQA 2HLFD 1RUQL 4JM4L 1G6RA 3C2SA 3MRGA 2CH8A 4NQCE 5GRVK 5DEFA 1CFTB 3AFLA 4HF5H 1A5FH 1R5VB 2CK0H 3I9GH 3NH7H 3MV9E 4GRLD 5BVJA 5DS8B 4KDVA 4X4XA 1LEKB 1HILB 1V7MH 2NZ9C 1HDMA 1CF8L 3BUYA 5DT1H 4NZUH 3FQTA 2DI7A 1NCCL 4G7YL 3CZJA 1J0HA 3T4AA 4MX7B 3ZKNC 2XZCL 3M8OH 5JXEA 4PJGF 2R0LH 1S9VA 2Y23A 5C6PB 2UUDK 2OTWB 1YYLL 4G6JH 1D5IL 1NCBH 5I1JL 4K3DL 3RBSA 1FYTB 3STZB 1ZVHA 4Q2ZB 5KZCD 1TZHA 3BDYL 3KPOB 4NQEA 5GISH 2ITDA 4FXGA 1DL7H 1AQDA 1FZMB 1EJ6A 4HIHA 2DLFL 3HI6L 1L0XA 5AWNH 2R1YB 1VEOA 4IMKC 3S96A 1RVFH 4Z9KB 3VG0L 4YC2C 1INEL 4KTYA 1BD2D 2IFGA 4HXBH 1G7JB 1FRGL 4TUOB 1ZGLP 4QRQB 3NAAL 4ZUUA 5LBSH 5DWUL 4Q9QL 4V1DE 4NN6B 5HI3C 4UQ2A 5D1ZC 3CDFA 1FNSL 2PR4L 3MROA 4E5XB 4ONGH 2B1AL 2YPVL 4NZDA 1FGVH 5ESVB 4KTEH 3OAUH 2OK0L 1T03L 1BBJA 4LLVB 4XNZC 4CGTA 2FEEL 4N1HB 2NY7L 3DRTA 3UDWC 3V4UL 1FCCA 2KZWA 3ARFD 3EO1B 3V95A 1LP9B 4PLOB 4K3GA 5LAXA 5D1QC 2ZUYA 5HPMB 2B2XH 2DM7A 5D7LB 4MB4A 4HLZH 1NC4B 5L2JB 1PY9A 2D7PA 4QHUA 1NCDH 4RBPH 3AY4A 4XXDB 3EJYD 2X42A 35C8L 1UXWA 4BQBA 1WBZA 4YPGA 5EU4A 3X14B 3BSZH 1A3QA 5FKPB 1H5BB 5IQ7H 1ZVSB 1FZOB 5IFAH 2A83A 3MQIA 3FB7A 1EX0A 3C60B 4JAMA 1T66D 3TEUA 2GAZB 3TO4B 2APBA 3IYLW 1J1XL 4OGXL 4C83A 5B4MC 2D7TL 2I9TB 2KUTA 5T1KD 4PJAA 4DKAA 5KSAA 5E8NB 3LIZH 2AV7A 2NY1C 1GSMA 4LGRB 1J5OH 3P9MA 4JQXA 2YUVA 2A6KA 4NM8L 3PIQB 2YA0A 5D8JL 4EOWL 4TUJB 1JGVH 1YC7A 4PB0H 1AI1L 4GXVL 3NIGE 4X7EC 1FG2A 3DVNB 5DD1H 2J5LC 2AP2A 3UTZA 5IVZB 4WU5B 5EZJB 2EZ0C 4YBLC 3TN0D 4R7NB 4DN4H 4ISVA 2GI7A 3AB0B 2ICWI 3IFNL 1AGDB 4DQOH 4M7LH 5JW4R 1GH7A 4G6FD 1KN4H 1NUDA 1YMHA 1Q1JL 3ZKMC 2ZSVB 3H0TB 4M7ZC 2BVTA 5JPNB 3VU2A 4EN3A 3DROA 5K9QI 4PJ8D 5IB1A 3KYNA 1RUKH 3L3HA 3VXSE 4GAJH 2Y5TB 1P4LB 1OY3B 4PJCE 3R8BB 4YPJA 5ID1A 1ZA3B 4GSDH 5IVXB 3EW3B 2BCKA 4PJXF 1FVCA 3QEQD 4OD1H 4HKXB 3R1GL 1QSZA 3O41A 3L3DB 3MXVL 2QKIA 3QXDB 3T65A 4M62H 5GS0D 1FFNA 4QXGH 3REWB 2VXVH 3AMLA 1EK3A 4OZIB 2WNGA 4XPTH 1WF5A 3R06A 3LV3A 1A64A 5FHBL 5BVPH 2IPUG 1ZLSH 3X11A 3BQUC 2D03H 3EJJX 3FQWB 4XMPL 4RAVB 1ERNA 3WN5A 5CJ5A 2VLKE 1NJ9A 4OAWB 1X5KA 1PKQE 4JN1H 2R2CA 4A2LA 1RZJC 5F1NB 2ZG3A 1FO0L 3HR5A 5FK9B 3QEHB 3QIWD 3VE0A 3G6AA 4OBSA 2EC9T 3I02A 4KDTA 2P8MB 1ACZA 2FGWH 2WK2A 3RGVB 3SGDH 4YX2H 1I7RB 1UJ3C 3BMWA 2ARJB 1KB5L 3DBXB 1S5HB 2YUXA 2CLRB 1CIUA 4OZFA 5SWQA 4QXUL 1MI5A 3UPAA 1I1FB 1GCFA 3TZVA 4HJGA 3WSQH 4CKVX 5IW6B 4OD3L 4GG6F 4YC2B 5C07D 1JWMB 3QAZC 4YE4H 3WUWG 1JBJA 2DD8L 5BV7C 1ZS8A 1KV3A 3VGFA 5L9DL 3VCLB 1ZT4A 3N9GL 5IP4A 4LSDA 2HJLA 4JVWA 4Y5YC 1YEDB 3E1F1 5D1ZB 3MXWH 3UBXA 4FQ2L 2YC1B 5FF6A 3VFPA 1CXHA 3HCVA 2PTUA 3DSFH 1NGPL 2R0KL 5EORL 4G5ZH 2YRLA 1CL7L 1A6VL 2PW1B 3O2DL 5J1TC 4XNZB 2I9LA 4GKZB 4RNRB 1T3FA 3LSOB 3QDGA 1QFHA 3B8SA 3RWIA 5ACMA 5J12B 2ED7A 2NX5E 5HHOA 1CICA 4M1DH 1K4CA 5D1QB 1A6UL 1AIFB 2ARWA 5EO9A 3NFSH 3DV6A 2V17H 4UV7L 2BSTA 4MQSB 5LCVL 1X5FA 2EDBA 1LEGA 2QQLL 1L9MA 4ONFH 2Q6WA 5DJAA 1OM3H 1JMZA 1A6AA 5DQ9B 5ICZB 1VPOL 1GGCL 3KPMA 1ZA6B 3GKWH 4AL8H 1TTFA 1J1OH 5F44A 5EBWB 3GKZA 1U8KB 5IB5B 1CGSL 4UT9H 3IVKB 4GRLA 1TCRA 3NFNB 5MEQB 2JJWA 5JOFA 3UTTB 1CDBA 1KN2L 3K80A 4KJQD 1NKOA 1UQSA 1U91A 3OTTA 4PLJC 3GB7A 2NY1B 4J3UA 3VXNB 5EZLA 2FB4H 3MO1A 4OLXH 3W0WB 1WTLA 4UDUA 1KPUA 3DVGB 2VXTL 2QSQA 2J5LB 3E8UH 3OGCA 3D69B 5GIRA 2R2HA 4FQLH 3SKNB 4YBLB 5IROA 5EFIA 4Y4HD 2YN5A 2FR4B 4PJDA 5CMAB 2MFNA 3A6BH 5TJWK 2VXUL 3HC4L 3N06B 3RWCB 1EO5A 1PDKA 3MLSL 4OCXL 2G60H 4APQD 2YPLE 1R0AH 4M7ZB 1BD2A 1PX4A 4X6BB 1QSEB 4N9GA 4K23L 1A6TB 1OAZL 2XPGA 1T1ZA 2A2QT 1P6AB 3CUPB 1JV5B 3U6RB 4M4PA 4HF5L 1C8PA 3I9GL 2CK0L 4LFHG 1MY5A 3MRQB 2R69H 5IK3B 2W0FB 5CBEB 4YHZL 3ULUH 4UQ3A 5K9OB 4YDVA 1IEAB 3L95B 5FV2A 5GJSL 3DO7A 4XBGA 5T3ZH 5DT1L 5E2TH 5JIKA 1W8NA 3BP7B 4MD4B 3U9PH 2FLBT 1C12B 3S4SG 2WM0A 3D3VD 2R0LL 3IJYA 1JNHA 4NJAL 1NCBL 4V2BA 1Q9WB 3V6FA 2J88H 1IAOA 1LEIA 4ODSH 3RPIA 3RNKB 1MQKH 2YUWA 5FM4A 4FOMA 5GISL 3HZMA 2CRMA 1Q9KB 5C3TA 2DQUH 4PRAB 1DFBH 1ULVA 3T3PE 4LLQA 1RVFL 1IFHL 4LNRA 5IB3A 3UC0H 3ARGD 4XCYB 5TE4H 4HXBL 5HGAA 4M8VA 4EI5A 2KDGA 1KFAL 4H20L 2HT4C 4CJ1A 5JO5B 2QV2A 5LBSL 3SDDD 3ILQD 3MV8E 3WLBB 1UJ3B 2DLHA 5J9PB 2EEAA 1W0WB 3CVHH 1R3LA 1M7IB 5HI5D 4KRPC 2AEQL 4TYUA 5E4IA 2VDMH 4KTEL 1MFCH 2E9JA 4UV4H 3NCCB 5KVEH 4G7VH 3TN0A 3N1FC 3P11L 4NSKB 4L29A 5SWSA 2ESVD 5L8LB 2XNAA 4JFZH 5KVFH 4IOSD 2APVA 3EYSH 3M45A 1S9YB 1G0DA 4Y5YB 3PQYE 5I71C 1AGBB 1VERA 1TQBB 2XY2A 5CINH 4N0CD 2FX8L 1EXUA 2C4FT 4DKFL 2AXGA 3T0DA 2C3HA 4I2XE 4OIAA 4PJ8A 5D7JC 2O5ZH 1EEZB 4LRIC 5IFJB 4NWUH 1QSVA 1UKQA 2AQ2A 5ELIA 5DO2C 5D7IA 1UB6A 1C5CL 2Z0BA 1XGUA 2FWOA 5HYQB 5I1DA 3QEQA 2PW2B 3FMGH 5DJ0B 1S5IH 3LIZL 5FAAA 1JYWA 3MFFB 3WFBH 3MNZA 4N0FA 3BZFA 2YZ1A 4PRHB 5GGRB 4HS3A 1YNTA 3V6ZB 2VUOA 5HGHB 4D0CA 3BZEA 5DD1L 32C2A 1A1OB 3VFTB 2BC4B 3OAZH 3GMOA 4DN4L 3ORJA 2X4SA 4Y4KB 4Y89A 1UZ8A 1KN4L 1P9MA 3HUJF 1QFPA 1QBLH 2LABA 1KC5H 2EKSA 3QWQB 1C7SA 3QDMB 2XFXB 1F4WL 3O3EB 4L1HA 2P42B 3QH3B 4PJXB 5C8JA 3CVIH 4U33A 3AAZA 2WP3O 2Z4QA 1F3RB 5F1OB 2D0HA 5KSUB 3C5ZD 1RIVH 5JW4M 4GAJL 4TTDD 3LKQA 1QSFE 1F4HA 1CFQB 1MWAA 5HD8C 5KVGH 1MHHA 5I16B 4A6YB 2VQTA 5C0FA 4MMZC 3HRZA 1C16A 1K2DA 4OD1L 2F15A 5CJOL 2UWEF 3D2UD 4FFVC 1H3XA 1J1PH 4M62L 4UNUA 4JY6B 3D85B 4QXGL 2PYFB 5C07A 4ZG1A 4WEBH 4NOBA 3H3BC 1NBZA 1EEYA 4WUUB 5T5NG 3FRUB 2PYEE 1GGUA 5BVPL 1U93A 1ZLSL 2VZVA 2D03L 4JR9H 5HDOA 2HVKA 5ISZD 3S37L 5CP7B 4QWWD 4ODUB 4ZAKC 4Z7VA 1EHLH 3ULVD 4JN1L 5ICXB 2MPAL 4TNVF 5DFWH 5IIEA 4AQOA 3VFMA 3VMPA 3EOAA 1VDGA 4CJ0A 1MCHA 3B2VH 5IJVA 4FMFA 1QFWM 3VI3F 2FGWL 1A9EA 5JQHC 4KI1A 3VXRE 3H42H 4YX2L 1CDGA 2VLRB 4GG6B 2HKHL 3MACH 4ORZC 3S88H 3FOMA 1XF2A 3WKMH 4Y5XA 4XVSH 3K8KA 3QFJD 3B4NA 3O4LB 3TJHD 1NGYA 5L8JB 5E9DD 4K55A 4LLDB 1SMOA 3Q5YA 5F88B 4YE4L 2DWDA 3QIBD 5SWZD 1ORSB 4IDJH 5E7BA 4R97C 3FO2A 5I2IA 1J87A 1QRNA 3DSFL 2DBLL 1F58L 4KRPB 5K59F 3LEYH 3O3DB 3X3FH 1FL5A 3PXHA 5IKCB 4Y19B 1TENA 5HJ3A 1RZFH 1DN0B 4Y4HA 3GSOB 3ZDYF 2QQNH 1SJHB 1CG9B 1B2WL 1I1AD 5CGTA 3DHJA 7FABL 3NFSL 4U6YA 1WV7T 4R0LA 3F58H 2HFFB 2BSSB 1PBYA 3G6JA 4UDTA 3FOLA 1NCNA 2ZSWA 4AL8L 4I4WA 3UXFA 3SDAD 1J1OL 3QISA 3FN0H 1MLBA 5EZOH 15C8H 4G6MH 4NZTH 4UT9L 4C4KT 4JPVH 3QG7H 5DSCA 3VXTB 5HHXH 5CEZE 1MCSA 4YXHH 1XF5A 1PEZA 5F89B 2CXGA 3MJ7A 5ILTL 4HT1H 5IHBA 4F9PC 4HCRA 2FB4L 4OLXL 5JZ7D 1PW3A 1URLA 3MJ6A 3MRFB 1XCTA 4JLRB 4PRID 5CFHA 5MEND 3CH1A 4GLRI 1LO0L 1RZ7H 3E8UL 1INDH 2ADJB 3IXTA 4CDGC 4QRTA 4FQLL 5HGBA 4D8PA 3V2AR 1T83C 3CDGA 3MNWB 3A6BL 1OTTC 1AGCA 3GMNA 5LWYH 4D0BB 3BH8A 1HN1A 1ZANL 2FIKB 5K9KA 1BX2A 3CZFA 3D39D 3CFCH 3TCLB 4HX1B 3GBMH 1XF4B 1H15A 3RJQB 4G80B 5DVMA 2A6DA 2Y5EA 3HE6C 3QWOB 4G8GD 5D6CB 4JFDD 2X70B 3ALPA 1GGBL 2JCCE 5FKAA 5SX4I 1INQB 3IAGC 4JCLA 2OM5A 1OAYH 2J8OA 2NNAA 2ICES 4ZO6A 5I17A 5CLWA 3L3OB 1ZWIB 3ZL4L 2CMRH 2R69L 1Z9MA 4U6XA 3CMOH 3VFUA 5DUBA 2Z9TA 5C9JB 4Y16C 3PWLB 4NCC1 2HWZH 4MXQC 4HBCH 4HK3J 3CD4A 1ZHNB 4ZMAT 3IAPA 3EDFA 1A7OL 5E2TL 5I73C 1A47A 5TDNB 2F9BT 4HW6A 4HWBL 4YQXL 3U9PL 2C1OA 2ESVA 4XHJD 3SDXE 1H3WM 4PGEA 3KR3L 4CVZA 3B5TA 2G75A 2H9GA 3AS1A 4NWTH 1W8OA 2JF1A 4XP5L 3D9AH 5DD6A 4UIKH 3OWEA 1MQKL 3ESUF 1IAII 5JMRA 5C09D 2CLZA 4X9FA 5EN2A 5TPWH 1DFBL 4RZCB 5C0JB 4XCCH 1DUZB 4NHUA 4KKNA 3H7BB 4G8EA 3I2CH 3DIFA 4WHYH 3QWRA 1T21A 1DP0A 4MA8H 4I3GA 3O8XD 4BZ2H 2OJEB 1ZHBB 3HNVL 3Q1SL 3KPSD 2QHRL 5FYKL 3QZWB 1YNKH 2JJVA 4GBXD 2FJFB 2EDDA 4S1DC 3RAJH 1T89A 1R24B 4WGWB 4P4KB 1MFCL 4BFGA 4UV4L 1UB5A 4GAFB 4NRXB 5DK3A 4OZGF 5KVEL 4G7VL 4Y5VB 5HDQH 4FHBD 4MCZB 2OP4L 4MNHA 3MRMA 2MHAA 4JFZL 5FV1L 3MRJB 5LQBH 3TIDA 3TGXA 5MP6L 1MJJB 2E7BA 3ZMRA 4OB5H 4R97B 5CINL 5MERB 2I07A 1HHKA 1LK2B 5GS2D 3UJJH 3GRWL 1SJXA 4RGND 5FYJU 1OOAA 4P2RD 2O5ZL 3VFOA 1A14H 1GGIH 2VRAA 5E2VH 3JBG7 4ODBD 5DMJB 2QHLA 4MQ7A 3GSNL 4NWUL 3NZHH 3PHQA 4Z7WA 4XPAL 2Z31D 2HLAA 4RDQG 4WU7A 3V5DB 1KIRA 4N8CH 2H2SC 3OQ3B 3CFBA 4PTUA 3V6OA 2H32B 4HUMB 1S7WA 1L6ZA 3FMGL 3ES6B 2YBRA 1R6VA 3QQ3A 1XGRB 4CADA 5D1XC 3T0EC 3D2UA 1XR8B 4L4TD 2HRLA 3FB6B 4XP4H 4KZDH 3U1SL 4PR5B 3VFVB 1AR1C 1IAKB 3HUJB 2DQEL 1A6PA 1U42A 2KBGA 1MELA 4TNVK 4W68A 3O9WD 4RX4A 4KKLC 4XMLL 1QFUH 2D4FA 1QP1A 5GSVA 2XZAH 3MJ8A 5ISZA 5I8CA 4U2ZA 4NT6A 4F7MB 3MRIA 5J56B 4QOKD 2P24B 5DEZA 3ZSSA 2ZG1A 3RL1A 2PKDA 2C4XA 1E4WH 6CGTA 3KPRE 4RMUA 4AEIH 3FTGB 3DUUA 1WT5C 2DQHL 1G7HB 2BY3A 2QL1A 3CVIL 3NMEA 1NGZB 2UWEB 3GSWB 4ZTOH 1RIVL 4OKVA 2DICA 1OGTA 5C0AE 3S34H 1TVBA 1NAML 4ELMF 5IT2H 4XNYH 5DF0A 3LKNB 4WWKC 2IJ0C 3TH3T 3HI1B 2CKBB 3QFJA 1E4XH 1TLKA 1X5HA 2WBJD 4LCCA 1NGWB 2YD7A 2QEJA 4L9DA 5FYLL 2YXMA 3BKYL 2AJXL 2RFXB 4F7EB 2A6JB 3D0LB 3HE6B 1F4YH 1CLOH 2APTA 3QNYA 3OXSB 5DMGC 3ZE1F 5E8OB 3T2NL 3QIBA 5HHME 1EO8L 2X10A 2DYPA 3GSVA 8FABB 4R2GD 5SWZA 4LSVH 4PB9H 2V2TB 4JR9L 1HINH 4LEOA 3O3BA 4PJFA 4PBVC 4W70A 3GO1H 4YNYB 4Y16B 4IMLB 4PG2C 1CN4A 1EHLL 4QYOB 1ETZA 4C55A 5FA3A 5DHYA 4I1NB 4PJ5D 1DDHB 1BHGA 4P2OA 2IEPA 4U0RC 3QXWA 3L7EA 4JGUA 3T1WA 2VISA 4RMQA 1ZK9A 5F9WC 2F54A 1D6VH 3QUMH 5F3HA 3QUYA 4MNQB 1I1AA 2FSEB 2FHFA 3H42L 1DQMH 5DC0A 5C0BE 1IRAY 3T4YB 4J2XA 1FO0B 1JWSB 5TE7L 3WKML 3ZE0F 5E8EB 4ELKA 4MCYB 1YPZE 2ZWLT 3ZKND 4LOUC 5BW7C 3SDAA 3TIEB 1MUJB 3BUTA 4AIZB 1VFOA 2UYLA 4CU8A 5IOPB 3VWJA 3MRCA 3PDGA 4UIMB 2FHCA 3O0RH 1A4JA 4IDJL 3BPLB 4U3XA 1HSBA 5GZOD 5EU6D 5I15H 3MJ9H 4YZFF 1DANT 2QR0A 4PRIA 3I3DA 3H9SB 3JZ7A 5MENA 4PRDB 5CJQL 4MA3A 4LLAA 3SGEI 4LRNL 4EDXB 5HI3D 4GOSA 5IR1B 1WITA 4Z95H 2FJGB 4N0YH 2QQNL 3W9DB 1NFDA 4OFDA 5KVDH 2X4OB 4X4YB 3QDAA 4LMQI 4YO0A 1R3KA 1WC7B 3D39A 1BLNA 4OM0L 1AXSB 1XGQB 4JFDA 4EUPH 5ITBH 1G9ML 1GYAA 3WNNA 4NO3B 5TGBA 3RVUC 4X98B 1B88A 2DIJA 4NO5A 4R3SA 1NLDL 3H9HB 4D2NA 1W72H 3P9LB 2VQ1A 1A3RH 5JW4Q 1WBYB 3MUHL 2O5XH 3BXNA 3ZYJA 2DB8A 4LSUL 2FBJH 3FO9B 3T0EB 3FN3A 4DGYH 1AP2A 1CFTA 1XGTB 3QJHB 2DKMA 3OG6B 3QUXB 1EFQA 3F65A 2Q7YB 4LKXB 1KUMA 5C0CB 1CGWA 5B4MD 1RZ7L 3ZKSD 1INDL 2MCG1 1KJMA 5MEPB 1IM9B 2D3VA 2NY1D 1WVZA 4MJ5B 5LWYL 4ZOEA 4PJIE 4R96B 1WSST 3RFZC 4YDKL 1I3GH 3DX9A 4NUGL 3HS0A 4IIQB 4MD0B 4L8DA 1FC1A 1FYTA 2EZ0D 2OI9B 5D70L 5CWSA 3UJTH 3C87A 3SE4A 3O8XA 1FZMA 3GM0A 1OAYL 3KPSA 3NIFE 4HWZB 3VFWA 5TQ0H 4PJHE 5IB2A 3ZKMD 4GBXA 2GJZA 4WWKB 1MNUH 4YDLC 4XP6H 3RUGE 4CN6A 2HWZL 3QXAB 4TUOA 1J0IA 4TVPE 4QRQA 4GT7A 3UP1A 4DUXA 5JW5A 2BHYA 2OQJA 1DBBL 4JO2L 1BECA 1MHEA 1V7NH 4WJ5B 4NWTL 4X9HA 1WWCA 5KANI 1I8MB 4JJ5A 2K7PA 5T33L 3PWPE 4LLVA 2Z8SA 1IM3B 4IRJC 1AO7B 3PGDB 3DSNA 3EO1A 1LP9A 2W60A 2YA1A 2DIBA 4P2RA 3ZTJH 5I1LB 2EKJA 5D71H 4XCCL 1HOCB 3ULUF 4XXCC 2Z31A 4JFQB 3BQUD 1IAIM 3VXME 2BY0A 3HC3H 1U2CA 1AR2A 5F9WB 2BNQD 4RBPK 3B5GA 4KGLA 4ODTH 4OZGB 2VR9A 3LKRA 1NCWH 4HLJA 2ZUXA 4L4TA 3X17A 1YNKL 4BFBD 3IDXH 3TO4A 3OR7B 3RAJL 3BRGC 4WI8A 2NY5H 3S98A 5CEZH 2FX7L 5F7DB 5AYQA 1P2CB 3RKPA 4U1SB 5E8NA 4YK4B 3MV7B 2MCPL 1VA9A 5HDQL 2XWBB 4AEFA 4BQ8A 2FO1A 3L5HA 2ED9A 4ODHH 4DOHB 2QSCL 1DBJH 4DKDC 3DVNA 2E6PA 5LQBL 4X6CA 3KPQB 4I0PD 3TV3H 5B39B 5KS9E 5EZJA 3WIIH 2QADD 3IRPX 3UJJL 4MDIB 1WTGT 3B6SB 4JQIH 2J4WH 5E03A 4NNPL 1AGDA 5E2VL 1QKZL 3GGWB 4GFTB 1YDPB 1ZEAH 4LFHD 3ECBA 5CSBA 1CWVA 3O4OC 1JZ4A 5D6DA 4P3DB 4WVRA 4N8CL 3D0VB 5EULV 3QUKB 4NRYB 5IJKC 1KYOK 2YN3A 1NGXB 1P4LA 1KJVB 4XP4L 3BPCB 1ZA3A 3LEXB 1S7QB 1IGTB 3TVMC 1D5BA 1J12A 4CMHC 1D5XB 5J11B 4FTVE 2DM2A 3IFOA 4M5YH 3L3DA 1CBVL 3QXDA 4X0KB 1FGNH 2C9AA 2XZAL 3GEWB 3REWA 1BIHA 1MVUB 4JM2F 2B5IC 2AK1L 4HULB 5AD0A 2RCSH 1X5YA 5FGCB 1RZ8A 4ELMB 3D1MC 4PJ5A 4WHCA 1T1WB 3P4MA 3QPQC 4AH2B 2XI9A 3ABZA 4GKOA 1BF8A 4RAVA 2EDYA 3MOAH 4WFEE 3EZJB 2VWEE 3WV0A 3MA7B 2XN9E 5CD3B 3WLWD 4P59L 1DVFD 1BAFH 4JFFE 4OAWA 3PHSA 4N8VB 4LHUG 4XNYL 5F1NA 2D7NA 3QDMD 3AXLA 5FK9A 3QEHA 5ETUB 3HG1B 2IF7A 2L7JA 3GSXB 3CXHK 3F6LA 4PRBB 1E4XL 2Z91B 4YIQB 3HFMH 5ACZB 3EYOA 1RJLB 1IQWL 3DBXA 1F4YL 1CLOL 3RVTC 2D7OA 1BVLB 2AI0H 1CIDA 4X99B 1I1FA 3K2MC 4KH2A 1JMXA 4WFFD 4MAYC 1DBKH 1HINL 4DZ8A 4IMKA 3KVQA 1IC4H 1JWMA 1U8JA 4YDLB 5IG7B 1Y6MR 3I6KB 4L3EB 4NQDB 4UTBL 1KEGL 3P73A 4FP8H 3VCLA 5E6ZA 1XH3A 4XPBH 1YEDA 3B9KD 4JKKA 3DO3A 5D1ZA 4OGYH 3JV4B 1KCUL 5FUCE 4P4RA 4ACPA 1RZIB 3I50H 1DQML 5C0ND 3RWGA 4QRPB 1MAJA 1XF3B 2RGSA 2BMKB 2BOBB 3UDWA 3ZT5A 3O45B 1LQSR 3LSOA 4JHZA 1KCLA 3FFCB 4U1GB 1DSFL 4MA1C 5D1QA 1DQJA 2W0KA 1H8NA 3T0WA 3OPZL 1CGUA 3BO8B 2Y4SA 3FT4B 2MJWA 2VLJB 3BGFC 3S36L 1U95B 3QUZB 3SE8L 4JE4B 4FQHB 4R4ND 2F5BL 1ZA6A 1OCWH 3W5MA 1TVDA 2GY7B 4NC1C 1U3YA 5EBWA 2VXQH 3M1BB 1U8KA 2V2WB 5IB5A 2B8OT 2YA2A 3CIQA 3MJ9L 3CFJB 3NFNA 4JY5H 2QSTA 4W6WB 3MLVL 5ESAB 4MS8C 2HT4D 1A6WL 3MR9A 4KROB 4EZMA 2EDLA 1Z0NA 1U92B 1FL6B 3W5NA 3GIVB 4N0YL 5A3IC 1OT2A 4HG4K 2JK5B 5KVDL 1T6WA 3HAEH 3DVGA 5JHDD 4HUVA 4KK8C 3NIGF 3MCKA 2XKUA 4JM2C 4X8JA 6FABH 1LGVA 1WFTA 4KMTL 5DRNB 4L9LC 2IH3B 4IRSC 2YD1A 4KUCF 2FR4A 5CMAA 2NY6C 1XIWC 2PCPB 1XT5A 3GMRB 1IVLA 2OR8A 1QG3A 3SKMB 1MHPH 1W72L 3O4OB 4CW1B 3SDCB 3FQXA 4W4OA 1UENA 5FO7B 3K7UA 2VL5A 4X6BA 3WNMA 1A3RL 1QSEA 3CSGA 4CAGA 4J4PC 5D7JD 5EBMB 2VN7A 1JV5A 1UJTA 4DGYL 4X4MA 1MCKA 1F3DJ 1NSNL 5H94A 4N0UB 1XZ0A 4PJCF 2W0FA 4PJGA 4QRRD 2OR9H 4CMHB 3DRQB 1JZ8A 4OCWH 1IEAA 4TSCH 4S0SD 2XQYG 3U83A 4RWYH 2YZ8A 1CVSC 3TM6A 3IJHA 1C5DA 3U46B 1JPFB 3RVWC 2D7QA 5BJTB 2ATKA 2B5IB 1C12A 4RMTA 1LO5B 1NEZG 4M5ZL 5TH2B 4Z7UF 2EYTA 1F3JA 2XZQL 2PNDA 1CQKA 1GHFH 3BQUA 3MRBB 4LLYA 1RZKH 1Q9WA 1RU9H 1C5BH 1RIUH 3KXFE 3MUY1 2BNQA 4OTXH 3UJTL 5C0DB 1EH9A 2V7HA 3F7VA 4OI7A 1Q9KA 3AS3A 4PRAA 5EOCH 2BY1A 4IS6A 3QYCA 5TQ0L 4K3HA 4XCYA 1MNUL 3VXQB 3O81A 1U8OA 4AENB 3QNZB 4FZ8L 3GI9H 3U7WL 3WIHH 1TITA 5JO5A 4ODXB 2UVFA 1J8KA 2CJUL 3CFDB 5TF0A 1T2QL 1U6AH 4KVCH 1UJ3A 1J88A 3SKJL 1UM5L 2NY2C 1W0WA 3TWCL 5HD8D 2ZOKB 3NTCL 4DTGL 1V7NL 1QACA 3U82B 2J3SA 5A16A 2P46B 4RMRA 4LPWA 5DFTA 2B4CL 1FH5H 3JTTB 4HKZB 5E94B 3HN3A 4ZFOL 5D71L 4ZUWB 3FONA 5CP3A 3C6SA 1S9YA 4Y5YA 2YD8A 1AGBA 2AEPH 1HHJB 4J3TA 1MLCB 3CXDH 2DOCA 4JDZA 4ZAKD 1MFBL 2Y7QB 4PJAE 2F53B 2A38A 1BJ1H 2H6PB 3ARBC 5IFJA 1JP5A 4JFXA 3PHOB 5E6YA 4UILH 2XQBH 2DTML 4DGVL 3S4SA 2NR6C 5ID0A 2BJMH 3BP6A 1CK0H 1T7ZA 5GS1B 4K94H 4PGJA 5HYQA 3VFSB 4MA1B 5EU5B 2PW2A 2VIRB 5DJ0A 3T04D 3MNVB 4KK5C 4Y88A 3UTSD 3CVHB 4L8BB 2R39A 4PRHA 5GGRA 2BERA 5HGHA 1TJHH 1R5WB 1QR1A 3TV3L 1ZT1A 3VFTA 4P3CH 5HVFB 4FFYH 3I3EA 1BEYH 4OIBA 4U1IB 4P5MA 3BAEH 3W11D 5CAYB 5F8RC 3KJ6H 3OAZK 3G6DH 4JQIL 2J4WL 4MQTB 3UTPE 4BA8A 3B5HA 5J1AA 1ZEAL 3G5YB 4U1KB 1CT8A 5DQDH 1WAAA 3QDMA 2XFXA 4G9DB 3SO3B 4MJIB 1DR9A 4GRWE 43C9B 4OF5A 5KSUA 2AQ3A 4D9LL 5B3JE 1G9MC 1FPTL 1S7VA 3PL6C 3D25A 2R29H 4L9LB 4D9RE 1TVHB 1MCEA 1KCSH 1BZQK 2YK1H 2ZCKL 4IRSB 5I16A 2FL5B 4L3CB 2NY6B 1XIWB 4KU1A 2YMXL 4TVPH 1YN7A 3EJZC 1I9IH 4NQCB 3WFCH 1DLHB 1FGNL 1JRHH 3IDIB 1U8QA 1F11B 2PYFA 4O2FB 1G1CA 3MV9B 3RZCD 4UB0H 3FRPG 2ZOLB 3DV4B 4HIEA 3GMMB 3MLWL 5CEXB 4I18C 2WLZA 4F8QA 3I6GB 4OFPA 2HJKB 5DJXB 2WLYA 1QTYT 4I0KA 1MRCH 3MOAL 1YY8A 5HDLA 4GRMA 5CP7A 5JDSB 3BIBX 3P4OB 1U8HB 4ODUA 2J6EH 4CBPA 2YS4A 5ICXA 4TULH 3WJJA 1B9ZA 1IEHA 2DJ4A 4DW2H 4ENEC 5EPMB 3FN9A 4R4BB 1L6XA 2FATH 1JI2A 3MFGB 4JO1L 3VD9A 1MI5E 3HFML 2K3TA 1MCWM 4ZPVA 4GG6A 1GOHA 1JNNL 1JGDA 3EO0B 3IU4L 4IRZL 5F9AC 2DKUA 4Q9RH 1OTTD 2WBKA 2Y06H 4GO6B 1T5XB 3DXAE 4IHOB 2YD6A 1FAIH 4V1DB 3VD4A 1KCVH 5C0RH 4OLEA 5BXFA 2VERN 1T0MB 3T3PF 4FQCH 4LDLB 4NM4H 5ANMA 3E6FA 4KUZH 1N5YH 1A9BA 3QG6B 2EC9U 1EVTC 1FNGB 1UADC 4XPBL 3O2WH 4O5LH 4WI7A 5GGQH 5DK0A 4K8RH 2NY2B 3QDGE 2KPNA 3L5WA 5FYJL 4DVRL 4N90D 2JB6A 5JHDA 5JOPD 4MXQD 5IKCA 1OSPL 5HVHC 1Y18B 4CVXB 1DN0A 4JG1H 1AXIB 3GSOA 5DDHB 2L4OA 1SJHA 1CG9A 4LKCB 4ZFZB 2YSSB 1AQKL 1JYNA 2WBWB 4OLZL 4G6AC 2FJHB 4GW4B 1T2JA 4PLKD 3FQRA 5DXWA 1RULL 2BSSA 3HNSH 3MRNA 1IGMH 5D7JA 1OCWL 4LAQH 3BWAA 4LRIA 3SGJC 3L5XH 3L5JA 1UWEH 2NY3C 4JKPH 3LD8C 3NABH 4QRRA 1KELL 1GOGA 5IM7B 3ZO0A 5DMIL 5C7XL 3TBYB 4CNIA 1I9JH 1CXIA 3MLTA 4NKOB 1IKNC 4PJDE 1ES0A 4LK4A 3V4PH 3IB4A 4KXZI 2Y07L 3MRFA 5HHQA 5JW3H 4UNTA 4O2EB 3ZDXF 2YHGA 3MYJB 4FZEH 4X7TA 4FG6C 2KKQA 1BJ8A 1HCVA 1BD2E 4JB9H 4D0BA 3H3PH 2OX5A 5KSBA 1KCKA 2CPCA 3UYPA 1ZGLB 3VXSB 4PJCB 1MHPL 1U3HD 2XIDA 1XF4A 3MC0A 4ZUSB 1JYVA 5DR5H 5D6CA 3TA3C 1E6OH 4BYHA 2MOVA 4YHKH 1OAUH 3L3OA 5EO0A 1NDMB 3FT2A 1U58A 5DJZB 3EDEA 4Z7UB 2H2SD 2OR9L 1ZTXH 3PWLA 4OCWL 1MY7A 3HI5H 5DRWB 4TSCL 1ZHNA 4LIQL 5CGYC 4RWYL 5D1XD 3QA3A 5IVNA 1HQ4B 2VR5A 4K7PX 2VLKB 3IETB 4QXTB 1DQDL 3S7GA 1JPTH 1PKQB 5ADPH 3FO1A 3HZKA 4E41D 4I18B 1GHFL 5F7LB 2DQJL 1KG0A 2EIEA 1C5BL 1MAMH 5IW1A 5LGJB 1EFXB 5J89A 4ZAKA 4F57H 1X4ZA 1JL8A 2P8PB 4RZCA 4ZQKB 5C0JA 5DGRA 2YRZA 2AJZA 2X41A 2ADIB 3H7BA 3UYOD 1SJEA 3C6LB 4O2CA 1QLFB 3FFDA 5FECB 3WIHL 2RR3A 4Y8AA 1UWXH 4MWFB 1U8LB 3SKOB 2HJFA 5E1AA 3QZWA 3WD5L 4JHAH 2NZIA 5JXAL 1CQYA 1A4KB 5I1KH 1R24A 5DJDA 3DHMA 3H7LA 3LKSA 4HK0A 3EFFA 4LMQE 2A9MH 3E3QE 1UXSA 3OB0H 2AGJH 4P48A 4R6UA 1MFAL 4J7RA 5MHSD 4D0DB 1FH5L 4R9HA 1TZIB 4O9HH 4N5EC 1BFVL 3MRJA 3F7YB 5C2UB 3AGVA 1MJJA 4UT6H 2AEPL 1ND0A 1Q0XH 2R2EB 1LK2A 1PYWA 4M48H 1G6RH 1AY1H 3KYAA 1EJOL 3UX9B 3OJDA 2BSRA 3T08A 3QEQE 3K8MA 3OKOB 3WYRA 5IB4B 4UILL 2WUCH 4K7PH 1JK8B 1I75A 1U8IA 2BJML 3MREB 1E28A 4HJJH 4JO4H 1U8MB 1CK0L 3PGFL 5LJYH 4KPHH 3ES6A 3KLAA 2EH7L 1X7QB 3I84A 4DN3L 3RZCA 1EIBA 4PR5A 4LCWD 3WNKA 3VFVA 1IAKA 4JQVC 4K7FA 1OAXH 1H3PL 3MRHB 4YHOL 4X5XB 1K4DB 1OB1B 2IH1A 2WQRA 3VFRB 1V5JA 3ARWA 4FFYL 5HSFA 2NW2B 5FCUL 3BAEL 3LD8B 2CDGA 3KJ6L 4GG8B 3G6DL 4R7DB 2VSDA 1JPSH 5K93A 3THMH 3CFEB 2F58H 3TT1L 3FAXA 3JXAA 4TUKL 1B0GB 4X5WB 2DWEB 5GSRB 4F9PA 2X09A 1G7HA 5FB8B 2VO5A 4AM0A 3GMQA 1NGZA 4Z0XB 2H2PC 3ULSA 2LAAA 2JLLA 3DX6A 2YPLB 1N3NB 2P5WD 3LKNA 4I9WD 5E2WH 1KCSL 5C07E 4ODWB 1T83A 1NC2D 3BZ4B 1FNAA 2AK4D 5D2LA 2NY0C 3FO0H 1I9IL 4UUJA 4XI5D 4EBQH 3ISWA 1F6FB 5EO1B 1I8LC 2A6JA 3NN8A 4KC3B 3TA3B 2CDEA 4JFED 1CTOA 5E8OA 8FABA 2EEDA 1YY9C 3DGGB 1T1XB 2JCCF 5INCA 1LK3H 3MRRB 5CBAB 1M05A 4JFOA 5CSZB 4QYOA 3O2VH 4P46C 1NAKH 4WTWA 4HD9A 1DDHA 4DW2L 2FATL 1NMCC 3KYMA 5DHVB 4MNQA 2FSEA 1MCPL 1NCUA 2E9BA 5E6IB 4FXKB 3FB5B 1UZ6E 2GUOB 3SDXF 2ZUTA 3VXPA 5DLMH 1FO0A 1JWSA 1VGEH 4XBPB 3IFPA 4BM7A 2Y06L 1KIPB 1FAIL 2BK8A 3TIEA 3A0OA 4YGVB 5BO1L 1MCRA 1FDLL 3MV8B 3K4DA 1OP3H 5D96B 3SGKC 4WTZG 5IWLC 1YJDL 2AXFB 4AIZA 4OCLC 5IOPA 1KB5A 4FQCL 1I7TB 3MGAA 5CZVL 4NM4L 5F96H 5DA0B 4KUZL 4ZXBC 4PGCA 4UIMA 1I1YA 3P0YH 2CQVA 4WW2F 4XHQA 1RIHL 1KPRB 2FH8A 2B4CC 1PLGH 3C8DA 5GPRA 5FHAH 2VH5L 2NY4C 1QR4A 4F3FA 5SX4H 3L3GB 3NCBB 1SM3H 5CEYB 4G8FB 3LEVL 3PQYB 2LU7A 4X6EB 4EDXA 1LE9B 2DTSA 2FJGA 2W9LA 5GRJL 3P4NB 4F58L 1J86A 3W9DA 1I3UA 1KJ2H 3GBNH 4GRWH 5I8OH 3QUMB 4I2XB 3PWNA 3G6JE 2C7UA 1MCFA 3U36A 5I6XC 1T20A 1YYMH 3O2DA 1WC7A 4H1LG 1U3HA 4LSSH 1GGTA 3U48A 3MLZH 1ADQL 1MCCA 2CKNA 1J8HD 1XR9B 4IRJD 3ELAT 1AXSA 2RQ8A 1XGQA 4GMSH 2NY5C 2H26A 3MCLL 3V0VA 4LPYA 4NO3A 4X98A 4OCRL 3L5XL 4I13B 3KYKH 4YHIB 5GRYA 3EDJA 3P9LA 2AJSL 2R8SL 3ARZA 3UAJC 3D3VE 1WBYA 4LHUD 2GQHA 3FO9A 3EGSA 5D1XA 1XGTA 3QJHA 1HIMH 1I9JL 5CIPH 3GSRB 3QI9C 2VKXA 1IGCH 4LKXA 4XBEH 5C0CA 1J05B 5J3HD 2GITB 5JW3L 2CRZA 4JDVA 3OZ9L 5CCKL 5GRUH 1M7DA 4FZEL 3FZUC 1NMBL 5MEPA 4TPRH 2EXWC 4BSVB 2EYSA 4IBLT 4MJ5A 1B6DA 4OZFH 5C70A 4R96A 4ZNEA 3H3PL 3LHPH 4AMKH 2E7MA 2OZ4A 5I66B 2APWA 1MPAH 3IJSB 1N8ZB 5DR5L 5IBUB 1VFBA 1J0ZA 1WT5A 3C8KA 2A0LD 2IAND 4EUPB 3TPKA 1FORH 1GOFA 4YHKL 5E99H 3NACL 3O6FC 1KTDB 3F7PC 4HWZA 4NNXB 2FEDD 4OV5A 1W72B 2V7NB 4WWKA 5TF1H 4P57B 2ESVE 1FLRH 3U0TA 3QXAA 4M61A 4GKSB 4BFIA 3DETC 1BVKA 2NY0B 4DEPC 2PYEB 4Z6AT 3EYVB 3N1MC 2B0SL 1UACH 3KJ4C 2O61A 1X3DA 3TVMD 1PD6A 1JPTL 5EG6C 4NKIH 4K7PY 1MHCB 1I8MA 4KKBD 1NGQL 2D31B 4RCAA 2IBZX 2MSPA 1IM3A 5CJXC 4XZUB 1AO7A 3EOBB 3WXWH 2CD0A 4ONOA 1AJ7L 1BFOB 2P5ED 3ZYZA 2XG4A 4PG2A 4WW2C 2LE9A 3VXRB 5I1LA 1CLYL 4P46B 2RB8A 1FIGH 3MZTA 4RAUB 2EIZB 4KY1H 4EVNB 1WUNT 1LO2H 2J7LA 1HHGA 1T22B 4XCEB 5E8PB 3VGDA 1IEBB 1LNUB 1NMCB 1XAUA 1EGJH 1I3RB 1B6UA 4WO4C 3BFOA 4Z0BL 2BVUA 4JHAL 4LCWA 4PRNB 3OR7A 4U2YA 4NFBA 4QHNA 1EHNA 4CVUA 5BW7A 4K9EH 3ROLB 3LDBB 1GAFH 4L4VD 2XWBA 5JW4N 1HXYB 3RVTD 4O9HL 1JN6A 4RFNC 3TLRA 4Z7NE 5IHZB 5INDB 2A6IA 5B39A 4MAYD 1KTLA 4Z7WE 5SV3A 4L8CA 1CFSB 4H88L 1Q0XL 4M48L 2VDOH 3VG9C 4S1QL 1AY1L 2X1PA 3B6SA 2Z35B 3V6OE 4Q9CA 3WKNA 1JCKA 2FNBA 3IF1A 3DNKA 1B0RB 1YDPA 1NFKA 2P5WA 3JWOL 3OKMB 4PBWD 1OTUC 3D0VA 1NC2A 2KL6A 4FQ1L 3L3JB 4NRYA 2AK4A 1KGCD 3IKCB 4OFYA 3FQUB 1OAQH 1NGXA 5FO9B 5ALCH 4ZUVB 4X6DA 3BPCA 3LEXA 5ISZE 1IGTA 4HIIB 3SY0B 4GUPB 4JFEA 1D5XA 3C8HA 5CILL 5IBLC 2BRRH 4RGMC 3QPXL 1BP3B 3GIZH 3WO4C 4N8PA 5FYKD 3HB3C 3U7YL 3N0PB 2Q86B 4FQQB 3THML 4FFWC 5B22A 4OCSH 5E5UB 3DYMA 5F97E 3UTOA 5I1IH 3NCMA 4O58H 4E0RA 4B0MM 3BH9B 1HKLH 2MNUA 1LE5B 3QI9B 4BH7A 5JORA 3MA7A 5CD3A 5I19H 3CH8A 4KFZC 3QFJE 1F4AA 5I9QC 2X89A 3FT3B 4UTAL 2OTUA 3F62A 3MLXH 3QEUB 5E9DE 2ZP0T 1TFHA 2W9EH 5E2WL 2CGRH 5ETUA 5A3ID 3GSXA 4J8RB 2JCCB 1L7IH 3FO0L 4YIQA 2VZSA 4EBQL 4PJIF 4HGKC 5SWZE 5ACZA 4KK8D 3BT2H 4Y4FC 5DC4B 4XTRC 5D5ME 3SGEH 4JM2D 1RJLA 5I0DA 2R4SH 4PP1C 4PJFE 1D6EB 3F12B 4NHCH 4OLYL 5F70A 3TFKD 3PV6A 4S2SA 1A7NH 1HXMA 3G9AB 1G7LA 4GQ9H 3VXMD 3O6FB 3T0XA 2W07A 2O5YH 3NIFF 1IQDB 2Q8AH 5IG7A 4PJHF 3I6KA 3SDXB 2XKSA 3QIUD 3RUGF 4QTIH 2MMXA 2Q3AA 4DEPB 2IGFH 3TNMB 1AKJD 4M93B 3BYYA 3KJ4B 3C09B 1F42A 1T1YB 3AU1A 1RZIA 2X4TB 5LGHH 4DVBA 1WCBB 1FC2D 4M8QA 1CXEA 3WHXA 5GS0H 3TBWB 1P1ZB 3O45A 4IRJA 12E8L 3FFCA 2G9HB 3RVWD 1WQVT 5CJBA 2M8XA 1FN4A 4OV6F 5EUKA 2ORBH 4WW2B 3BO8A 4CRPA 3FT4A 4K2UH 3VDAA 3TESA 4XXCA 1NBVL 5MI0C 4OFKA 4K8RD 4Q58C 1U95A 5F96L 4PRIE 5KSVB 2FLRT 1FJ1B 1TQCC 3IRZA 4FQHA 5MENE 4LHUA 3EFDH 2AXJA 3MRKB 2LVCA 2FIRT 3M1BA 2X4UA 3LS5H 5E95B 5FYLD 5KTEH 1VADB 4DKEL 5GGVH 1NFDE 4JRXB 5FHAL 2R0ZL 5HHPB 5FA4B 3G04B 4NKDB 3VXUD 1U92A 3D39E 1V3MA 3Q0HA 1MWAH 3BPOB 1CYGA 4O4YH 1F6AB 1ZOXA 4G8GE 1KJ2L 1ZT7B 2EDWA 4JFDE 3QQ9C 1P7QD 3H6JA 2VE6B 1SVZA 3QNXB 5HHVH 2DMKA 4LSSL 3MLZL 5AG8A 5KS9F 1DBMH 1Q38A 2V9TA 1BGXH 3VG9B 1S78C 2PCPA 3GMRA 4XB8A 1I7UB 1S9XA 2DQIH 5DJYA 2HTLC 4HUWB 3RDTC 4PJ9C 5M7QA 3KYKL 1HHHB 4CW1A 4JZJC 4RQQB 3UJIH 1IAIL 2H1PH 4M6AA 4P9ML 1IBGH 5IJKA 4M6MH 5EBMA 3GJEB 4XVUD 4LLMA 3RL2B 3ARBD 1BQHG 2NTFB 2YKLL 5EIIB 1IGCL 4XBEL 3TVMA 2NR6D 3FCTA 4NUJB 1DQTA 3CX5K 5C09E 3DPBA 5F7FA 4ONHA 4HAFA 5GRUL 4QHMB 5JLZA 4RGMB 1PZ5B 1DJSA 4KK5D 1MIMH 3TC9A 1K6QH 4TPRL 2HT3C 3CLFH 5FIEA 3KPRB 3WO4B 3OKNB 3Q5TA 3U46A 4GKNB 1Q94A 2NXZB 1QLRB 4UBDC 4XRCA 3ARED 2P5EA 4YDIH 5DVKA 1UM4H 3HAEB 1LO5A 1CR9L 3LHPL 4AMKL 2NXYC 1ITCA 3CSYA 5C0AB 2R9HC 1MPAL 3KPSE 1KT2A 2V2XB 3QO0A 1YUHA 4UINL 5IEKA 4OCMC 5DFVD 5C0DA 1FORL 1X5AA 4LPXA 3OKLB 1IL1A 5K9QG 4YDJB 3NIDE 1X6NA 3VFGH 4OLUL 4XNUH 3AM8C 3BIAX 4AENA 1FLRL 3QNZA 3ARVA 1HI6A 4P23C 3WHE1 1SQ2N 1HSAA 4KK6C 5HHMB 1I85C 1UH4A 2FD6H 5A2JH 1MRFH 3BKMH 4POZD 4ZS6D 1G9NL 1OPGL 2LVEA 3ARYA 2QQKH 2ENYA 3BP4B 4L4VA 4NKQB 5F7EL 3PL6D 1WBXB 1T5WB 4RGNE 5EBLA 4M3JA 5DZOA 1CS6A 4AT6B 3K1KC 4P2RE 4NCC2 4BSJA 4QCIA 4XNMB 4NP4L 4MAYA 3AVEA 1UH3A 3WXWL 5KN5A 2IBZY 4HWBA 4BUHA 3RWHB 4HKZA 1NDGA 1SY6H 4ZUWA 1FE8H 5C0BB 2A1WH 4L4TE 3IS0X 2OXGA 1LO2L 5FFLA 5DURD 2DQCH 1RMFL 1MLCA 1I9RH 1YPZB 1EGJL 1EFXD 3FQNB 2Y7QA 3LPFA 1JVKA 1HZHL 4DUVA 1CLZL 4FS0A 3PHOA 4PRPD 4KK9C 1A6ZA 2E7LC 1NPUA 1YJDC 1ORQB 4HCRH 3DMMC 5GGTL 4OD2B 1GRWA 5IMLB 3PNWB 3VFSA 5EU5A 4PP2A 4QOKE 5I8EB 2ICWB 4K9EL 4X6CE 3ZDZE 1GAFL 3B9AA 3VRIA 3G5XB 3N1PC 1T80A 5MI0B 4TSAL 1JF6A 4L8BA 3WJLC 1J9CT 4C58B 3KPTA 3VWKC 1TQCB 3DX7A 5SX5H 3TYGH 1R5WA 1MF2L 4XWOC 4U1JB 3HNTL 3NCJH 4KWUA 1QOKA 1F8TL 2ZUQC 1ZGLM 3TJEL 5GRZA 1KTKE 3S35X 2YR3A 4MLIA 4MMXC 2GTWB 3G5YA 3RIAF 4CVWA 4L1DA 3IAQA 5FCSH 5F3BA 4DAGH 2VDNH 1IGFH 1E4KC 4IOFC 3TBVB 3GHBL 1ZE3C 4HZLB 3GRWA 4WHTB 5JXED 3BEVB 1OAQL 1TCMA 2HKFH 4JM2A 1KJ3L 5F8QC 3GSNA 3Q3GB 1IE5A 1JHLL 5B38B 2IFFL 4IRSA 1NFIB 3MUJA 3MRDB 4NQED 4L3CA 1XIWA 4J3VA 1TJIH 2BRRL 1A7RL 5EH1A 4PJ5E 4NQCA 5ITFB 3RDTB 1ED3B 3LS4H 4PJ9B 3GIZL 3B9EA 3RWFB 4AIXA 2VWEC 3MV9A 4JZJB 3RU8H 2ZOLA 3DV4A 4KGJA 5AEAA 3QIUA 3GJFK 1G9EA 3NCFB 5CEXA 2P7TB 4CU6A 1OGAD 5JIPA 1M6OB 2HTKC 3BN3B 1AKJA 5I1IL 2HJKA 4O58L 1FV1B 4FFZH 2NY3D 1F90H 3BE1H 4PJIB 1U8HA 3N1QC 5DK2B 1AHWA 3REVB 1TMCB 1YN6A 3MLXL 2P8LB 1SBBA 1SYVA 1YEIH 2W9EL 4RMVA 2GFBB 1FBIH 4R4BA 3C5JB 1AGFB 2HVJB 3UTQB 4Z7QE 1L7IL 4U6TA 3RWDB 4GW1A 4MDJA 1CD9B 1WZ1L 5GGVY 3RWEB 1WWWX 3IDMB 4MNGA 1NAMA 3VA6A 4PJHB 5EU6E 2SEBB 1WIOA 4FG6D 2XICA 3RUGB 3KWWB 3K8LA 2WWKO 3L3KB 4NHCL 3QHFL 5EU7C 1S7TB 2ITCA 1KIQA 4IHOA 1W2KT 1S7SB 3JV6B 4PYGA 1HYSC 3U30C 5E8DH 1M1SA 3MLYH 3V52H 2Q8AL 3GSQB 5DJ2A 3OJMB 4WY7L 3VXUA 2VLLB 1FNGA 1FIEA 2DKSA 4NNYA 4D94A 3G5VA 4PLNC 4XP1L 1ACYH 4QTHB 2WANA 1OL0A 5IHUH 2E27H 3LN4B 5LGHL 1EBAA 1P7QA 5CGYD 4KRLB 4HIJB 3FRPA 1G7IB 3NVQA 5IMOB 5DUPH 4I77H 4LARH 4LKCA 2ORBL 1REIA 4ZFZA 2GCYB 2YSSA 1MRDH 1EO7A 1DTUA 4X7SL 4BSWA 3PWVA 4AEHH 4Y1AD 4GW4A 1X6LA 2XWJB 4AYFA 3ULVH 1CVRA 3RBGA 1ONQB 5HYJD 4PJAF 3ARBA 3CJJA 2YD3A 4XCNB 2PO6C 3SE3C 5I76A 4S1RH 3DGCR 4RA0C 3STLA 5L7XH 5T1MA 4MQXC 3R8QA 5JA8B 3RVVC 1H8SA 1N0XH 2JELL 3VRLF 5AZEH 5KS9B 2A9NL 1UA6H 4EDWH 3RNQB 4QY8A 3AREA 1IC5H 2C3WA 5HHVL 3O11B 4L8SA 1X4XA 4O2EA 5TDPB 3MYJA 2JB5H 3G08B 4XPFL 2ZUQB 1DBML 3JWOC 4WFHD 2VDLH 1BGXL 4LQ1A 5IGXH 3ZKXB 1QSEE 3BIKB 3BKJH 2EH8L 2DQIL 2J1KA 4M4RA 1HEZB 1RJYA 3C60C 5F6IB 5HY9B 2JIXB 3Q6GH 3QHZL 1EBPA 4WNQA 3IGAA 4OUUA 3D5OF 4ZUSA 3IXAB 3UJIL 4PJGE 3CNKA 4M6ML 1BJ1J 4HFUL 4FTVB 3LMJL 4GRWF 4CN1A 3K74B 1G7PB 2GT9A 5B3JF 2R23A 3PL6A 4G8IB 1KNOB 3UZVB 4Z7UA 4U7KA 4OZHF 2Q76A 5JA9A 1H0DB 5DRWA 5JOEA 1GC1H 2GSGB 4GJTB 4RIRA 1K6QL 5GRWA 2XN9B 4MVBD 1CGVA 4YDIL 3X3GL 4F2MA 3IETA 2BNQE 1UM4L 4JFFB 4QXTA 2HH0L 1PKQA 4M7JH 4NN7C 4I18A 4EI6A 5I1GH 3MOBL 3E6HA 3OKEB 4XPHL 4DCQB 4HFWB 4Q6IC 1JGEB 2H8PB 2MQ0A 3T0AA 1N7MH 1EFXA 4LCYA 4WI9A 4NN5C 4KV5F 2P8PA 4EIZC 1CFNB 1E4JA 1M71A 4ZQKA 4XH2B 3DURB 4QHLB 4OI9A 4PRPA 5AYUH 4JDTH 1Z3GH 4H8WH 2ADIA 2UZXB 1DQQB 4XNUL 5CZKA 4HWEH 2VNCA 5HHOD 5JUEH 3A67H 2FD6L 1MRFL 3BKML 4KZEL 2W65A 1U8LA 4OF8A 1EZVX 3L6FB 1UWXK 3KDMA 3NA4A 3RA7L 3VRJB 1A4KA 2Q8BH 4GW5B 1BMGA 5HI4C 4ZTPL 1U8NA 3L9RB 5C08D 2WWKT 3RIAK 2ZCHH 4R90H 1DBAH 3U30B 4LU5H 1WWAX 4D0DA 3OB0K 4G43B 4IOIB 4IJ3C 5H8DA 1SY6L 1FE8L 3F7YA 1ROWA 3C9NA 1S7UA 5IVOA 1XGPA 5D72H 1YY9D 5C0IB 1P4IH 2J8UA 2DQTH 4YHMH 1LHZA 3EYQD 1I9RL 2R2EA 2F74A 1UEMA 2XKNB 3RGVC 5ALBH 5KAQG 2WWMD 1IGJB 4RMWA 1DLFH 5MEOA 1FSKC 3Q6FA 2AJVL 2XTJD 1ZHKB 4JY4A 3U9UA 3DOSA 5IEHB 2QTEA 4XX1G 4LASL 4NYLA 3QXTA 4YUEH 5IMKB 5F9JB 5C71A 3RY6C 2B1HL 4G9FD 1CD8A 2YD4A 2Q7NA 3BEWB 3RWJB 2UY7A 1X7QA 4KI5D 1UEYA 1R5IA 1A1NA 3WFDH 4M9OA 5HYSG 3ZTNL 1D5ZA 2JJSC 4JREC 4WCYH 4EN3C 4JHWL 3TYGL 1OGAA 5C0EB 3U4BH 4U05A 4PUBH 4X5XA 4P2QD 1WAAE 1MCWW 3VFRA 3QDME 2R2BB 2PO6B 3H8NA 4NKMA 5H37G 3WXVH 4GG8A 1FVDA 3GK8H