4EI6B

Structure of xv19 valpha1-vbeta16 type-ii natural killer t cell receptor
Total Genus 51
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
51
sequence length
244
structure length
244
Chain Sequence
b'MGPKVLQIPSHQIIDMGQMVTLNCDPVSNHLYFYWYKQILGQQMEFLVNFYNGKVMEKSKLFKDQFSVERPDGSYFTLKIQPTALEDSAVYFCASSFWGAYAEQFFGPGTRLTVLEDLKNVFPPEVAVFEPSEAEISHTQKATLVCLATGFYPDHVELSWWVNGKEVHSGVCTDPQPLKEQPALNDSRYALSSRLRVSATFWQNPRNHFRCQVQFYGLSENDEWTQDRAKPVTQIVSAEAWGRA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Valpha1 XV19 Type II Natural Killer T cell receptor (mouse v
publication title Recognition of CD1d-sulfatide mediated by a type II natural killer T cell antigen receptor.
pubmed doi rcsb
source organism Mus musculus, homo sapiens
molecule tags Immune system
total genus 51
structure length 244
sequence length 244
chains with identical sequence D
ec nomenclature
pdb deposition date 2012-04-04
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4ei6B01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4ei6B02
1WTLA 4KUZL 1U9KA 1X5HA 5IB3A 1JPGB 2F5BH 3TV3H 3MXVH 2IQAB 2PTVA 3FL7A 2VDPH 4LPUA 1U8KB 3GMMB 4TSAL 1ZHNB 2Q7NA 3FMGL 2KZ1B 4JPWH 1UT9A 3ZE0E 3BGAA 2PCPB 3OQ3B 2ICEA 5F7FA 3GUTA 4P23A 5LAXA 2MOVA 3LKNB 1AIFB 4HMCA 2E9BA 5BS0D 2XN9D 4JO1H 1RK1A 3LKQB 3QUZA 2YSSA 2R2EA 4YBLC 2CUMA 3CLFL 3OX8B 4GG8B 4XAKD 4YDKL 3U46B 4OCXH 2CDEB 5B8CC 2VABA 1D5ZA 4EEEA 2H45A 2OL3B 1KELH 5E00A 3O4LA 3O6LL 2X4QB 4U1LB 4U6YB 4OB5H 5JXEC 1FVEB 4Q0XH 5I17B 4JM2D 5DEZA 1HIMH 4X83A 5T5FH 1CL7H 2O5XH 4QHLA 1FDLH 4KU1A 3P0VH 4L3ED 3CIQA 3W0WA 5CILH 5JXED 2DQFA 3HI5L 2JB5H 3RNQB 3BKJH 5FCSH 3KLHC 3X14A 4WUKL 1ZVSB 4YO0A 4WWKB 1KPRB 2IEPA 3TGXA 2V2WB 3SDAA 4JJ5B 1GAFH 3SBWA 4G7YH 3SO3C 1S5HA 5TDNA 2Q7YA 4ODHH 2QR0A 4OCWH 5JW4Q 5FDWB 1I8MB 3KLHD 4YJZL 4G9FD 2NQCA 2OCFD 4CVXA 4NM4H 3MXWL 4NT6A 2IF7A 3LPWA 3FFDB 4MXVE 4A6YB 1A9BA 1KIUA 1S8DA 2BVOB 2PYFA 1M7IB 5DC9B 1JZ6A 4WI3A 1X4XA 3CPLB 4JFXB 5GS0L 4H5SA 3S36L 5I30H 3UO1H 4I0PB 3MYJA 4XWOC 3MUHL 1JL8A 1QOKA 4HLJA 4CN6A 4LLWB 3WD5L 2AXJA 4WU7B 4JVUA 3ZLQC 2CLZB 1JGDA 5DURD 4DUVA 4P5MA 4R4FH 4Y4HB 2ZWLT 3DI3B 2P8MB 2BVYA 2X4UB 3CVIH 4Z76B 4GOSA 4XWOD 5FO7B 2C3GA 5GJSH 35C8H 4EXKA 1UCTA 2WBKA 4KAQH 4LRIC 3MGTB 3P0YL 3ILPA 3RWJB 5I16B 4NQVB 3QULB 1GGTA 1A22B 2ZUQC 1T5WB 1IBGH 2DMCA 2DLTA 1A21A 3TZVA 2DQEL 3MNZB 1YECL 4HCRA 4MA1B 2P48B 2MPAL 3T0BA 4YH6A 3UTZB 4PJ5B 3PP4H 2MCPH 1J1XL 3OB8A 3VXQA 5E2VH 5B3JE 4NRXA 5T1DL 1DLFH 1E4KC 5DRZA 1J8HA 4LSQH 3F12B 3G9AB 3CFEA 1RIUL 5KTEL 4O5LL 4HJGB 4PJIE 1IT9H 1FNHA 2GCYB 2P5WD 2FNBA 3BKCH 1DVFC 3ARFC 3B9KA 1OM3H 3VWKB 5IFJB 4DQOH 1VERA 3NGBB 3DX8A 1RUKL 2BSRB 4KDTC 4KV5F 4M93B 3D2UA 5D5ME 4XBGB 1CVRA 1L7TH 4OKVB 2IPKA 5JHLL 1J11A 1BJ1H 3U2SA 5E0QA 3PIQB 5EU5B 3O6FA 4QRPE 4XMLL 5DVOA 5L2KB 5JQ6L 5SWZD 1H3XA 2IH1B 2C3VA 3S34H 1QSFA 3RIFF 3UTSB 4J3OC 1XR9B 4POZC 4ESKA 4JHWL 3G6DH 3DUSB 2DLGA 3QR2A 3C2AH 4M6NH 4GJTB 3D85B 2GJ6B 4XCNA 3LRGA 1U95A 5C2BL 5D7KE 5C0DA 1YY9C 3KG5A 3KWWA 4TPRH 3WDJA 4C56B 5C8JB 4NNXA 4GFTB 1RURH 1WLHA 4HBQA 4RRPA 4NZTH 2ICWB 3QPXH 4BQBA 1BD2E 2IFFL 4HS8H 1E0OB 1D5XA 2YD9A 1DUZA 5DLML 3KYKL 3IU3B 4XP4L 5DK2A 1MIEL 5IP4A 4S1QL 1YY9D 4TQEL 3HAEA 4MXWH 5T5NF 2CPCA 4AL8L 1KG0B 4LF3A 3CFJB 4LCCC 5EU6D 5E4IA 4B0MM 1F11B 4ZOEA 5GGVY 1X44A 5DQ9A 4JQXA 4LCYA 3FQUB 3T3PF 3P77A 3PNWB 4PJ9D 1N2RA 4NO0D 4V1DB 5C08D 4YEEA 3QNYB 1Q38A 2EEBA 2J1KA 3O6MH 2XN9E 5BS0E 5BW7A 3JTSA 2NNAA 3EJZD 5DJ8A 3WLWC 2HFFB 2OTWB 5ICYA 1CGTA 4PRDB 5I6XC 2PO6A 1KCKA 3QFJD 4XAKE 1MJUL 3BPLC 5IBTL 3S88H 1CR9H 1QHPA 4HG4K 4PD4J 1I8KB 4CMHC 3LKSA 4PP2A 2NTFA 4RFNB 1NGZB 3GMOB 2WIIB 3MV8A 3BH8B 4HHAB 4WENB 2W91A 3QEUA 4FQ2L 2M2DA 2XZCH 1ACYL 1S7WA 4M03A 4P49A 5GZNC 4HUMB 4KJQD 5E1HB 4I3RL 3I02B 4DKFH 2NY7L 4BH8A 4L3EE 4HGKC 1I7UB 2E6QA 1RJLB 3GSRA 3CVHB 4P9HH 4JHBA 1BQUA 4DW2H 4FQQA 4LNRA 3PV6A 3Q3GA 4OZIF 5JIKA 1C1EL 2VSDA 3BEVA 3QA3B 5D96B 4PJ8D 5FKPB 2ADGA 3ULSA 4OF6A 2B4CH 5DD0H 1JRHI 2A9NL 2UZYB 3QDGA 3VW3H 2EXWC 5ANME 3R4DA 1AXIB 4OGXH 2WLZA 1JNNL 4D0CB 4L1DA 2AJUL 2F8XC 3JSSA 3L6FB 4MDJB 4G9FE 2PETA 2J8UF 2OMNA 3H9HB 5LGHL 1EIBA 4CU6A 5E5UB 2YRZA 4P23C 1MCSA 5CP7A 4EBQH 4LSRH 4U1MA 2OX5A 2QHLA 4WEUD 2HKFH 2FLRT 4YHLL 4ZNCD 4WGVB 3B8YA 4DN4L 5A43C 4QRUB 1R3LA 2IPUK 3MNVA 3HE7D 4NM8H 3GSOA 1NAML 3TA3B 1R3KB 4ZSOA 1AD9A 1MI5B 1K4CA 2VR9A 3CFDA 4JKMA 3B3IA 3WUZA 5B38G 1G84A 5MEND 2FIKB 1J0IA 3BP7A 1YQVL 3EOTL 5DJXB 3ZTNH 4WW2A 1KPUB 3E3QE 3KLSA 4D9LL 5CD5C 4JR9L 3BYYA 1MQ8A 2Y5TB 1TZHB 3QIBA 2HLAB 5BVJB 2YBRB 3GMQB 2QADB 1AXTL 2AEPH 1QQDB 5EU3A 1GJIA 3P30L 3RNKB 1KC5L 4G3YH 3DPBA 2FX9H 1G7LB 2X40A 5T1MA 3MRKB 1BQSA 4KI1A 5CD5D 3SDAC 5EUOB 3SBWC 3DURA 2R69L 4GW4B 4WEBL 2AK4B 1VCAA 2AJYL 2P5WE 3H42L 2J8OA 1MRFL 5FUCC 5HY9A 1GYAA 5F70A 4BFGA 3TJHC 2LAGB 1LE9B 1GOHA 5J1AA 4PYGA 1YJDL 4O2CB 5C6PB 1CCZA 1CL7I 1G9ML 4EN3B 4LU5H 5J57B 5GRZA 3U0PA 2B7DT 1E6OH 5I1KH 2JCCA 2XRAL 3WE6B 5DFVC 1XIWC 4Y2DB 4XXDA 3O9WB 1QNZH 2OZ4L 2FR4B 3L95B 3RU8L 5SWZE 3V9FA 3AY4A 2NY3C 1IC1A 4GLRI 1WQVT 4ODSH 1AR1C 4R0LA 3NCMA 4QXTB 3EFFA 5EG6C 4M8VA 1WITA 5EOCL 1UYWL 3KPNB 1YA5A 1IGCL 3MUY1 4RIRB 1FL3A 4Z0BH 5DQDL 1UH4A 4NQCA 1RUPL 2H32A 5KAQG 5GGRB 5I9QC 5FUZH 2DBJA 1TETH 4ENEC 3DIFB 4TUJB 3EO9L 4DAGH 4LLYA 3TZVC 3QBTB 3VFVA 2P24A 3L3IA 4OCLC 2UYLB 4F2MA 2X4SB 3BVNA 3RDTB 3FQXA 3ZKNC 4QXWA 1ORSA 3G6JF 1JMXA 1IAKA 4F3FA 3GRWA 4XH2B 4MDIA 3BSZL 4HD9A 3RIAK 1A4JA 2VDNH 2PKDA 5ILTL 4JQVA 1UB6A 5EU6E 2VWEE 2EIZA 1X7QA 2BZDA 2Y72A 3ZKND 1I1CA 3HZYB 3B9KC 1K8IB 2MKLC 5HYIA 3U0TB 4YXLL 3HG1D 5D2LA 2NZIA 4N0RA 4O58L 1JGVH 1R6VA 3JUYA 5C08E 3RTQA 3TBSA 2IWGA 5IJKA 3MGOA 5IB4A 1ZGLM 1NCNA 1TJGL 5GRJH 3R06A 4NNYB 3MLTB 3O6FC 3QFJE 3L3KB 1UCBH 4Z7WF 3TYFA 1ZT1B 3RUGF 5KANI 4HUUA 4I18B 4YPGA 1N5YL 1JPTL 1FCCA 3NFNB 1H9VA 1Z3GL 4IS6B 1E27B 3FO1A 1FN4A 4P0DA 3Q1SH 4JVPA 3P9LB 4MNHB 1EO7A 2RCSL 1P4IL 4U49A 4OI9A 4XMPL 4GMTL 1LO3H 3EHBD 25C8H 4Y8DC 1RUAL 4V2CB 4XAWH 3S6CA 2PNDA 4N1EA 1NBVH 2WWKT 5HYSG 4DZ8A 3CFCH 4EDWH 2X9XA 4EI6A 3MRNB 1DFBH 1ZLWK 4PLKC 3T3PE 3MMEB 3U79A 1D5BB 3IKCA 1S7TA 2H2PC 2WWMC 3I50L 4OQTL 2OJEA 1UEYA 4RWHA 1IRAY 1IC7H 4PJBB 3SKMA 4HK0B 4G8EB 1YZZA 5KG9A 3IJYA 3WHE0 3K3QA 1EMTL 4I77L 5JIPA 4PG9B 4PJ7B 2YZ1A 3FT2A 2NY6B 2OSLB 4HUXA 4Q7DA 2DQGH 4Q9CA 4F57L 4X9FA 2ADIB 5EBLA 2ICWJ 4I2XB 1MHHA 5GQBA 1N59A 3TBWA 3C5JA 1ZV5A 4C58B 1NCWH 3FTGB 1NMCC 1ZT4A 2HKHH 2DQCL 4NBZB 4X7CC 3MSPA 3VFOB 4JRXB 5EBGA 3QXUA 4G6KH 1I4FA 3BP5A 5C70A 3ZKXB 3L3JA 3G5VB 4KPHL 4OZIE 3LN9A 2X1WL 1FZMA 2UWEE 4I0PD 5D7JB 5FUOH 1IQDA 5JHDB 4Y5YA 5B38A 5GGTL 4ZNEE 5D7IF 5IB5B 4IHOA 5IQ9A 4HLZH 5IK3B 3RHWF 5E03A 2G5BA 2X4NB 4G9DA 1QRND 1PEWA 1H5BB 1HSBA 1MHCA 2XACC 1PG7H 4FQLL 4JFZH 2J8UE 3K1KC 1F58H 5EBWA 4RZCB 3QP3A 5KANG 5TFSH 5FF6A 2NXZB 3VI3F 5B4MC 1KEGH 1FLTX 3B6SA 4P2YA 2P8LA 3GI8L 3L3GA 5EFIA 1R3HB 1XGRA 3WIIH 4UILL 1G7MB 1U8HB 4WNQB 4OCMC 2OL3H 1NLBL 3VDBA 5AYUL 5KOVC 4RFOL 3WN5C 3WFEH 1LK2B 4Y16A 5JO5A 4WFHD 1MCKA 4XRCB 3RPKA 1K9TA 1JFQH 4GSDL 4YIQA 1YEEL 3FZUC 3KYOA 2Q20A 5BCAA 5T1LA 3CDGB 4AG4L 5CBAB 1YEKL 4N8VA 3VWJB 1DBKL 1GGUA 4L4TD 3IF1A 4KRMB 4TTDC 1ZA3A 1I9JL 2CDGB 2A1WH 4ZXBA 2K7QA 4GKNA 4G8IB 2BVQA 3A6BL 4XT1C 4LPXA 3GBMH 4MNGB 2FB4H 1ZEAH 3VXRB 1T2QL 4HUWA 4YPJA 3F7YB 4RMTA 4UAOC 3WIHL 5IMLB 3MRCB 1KTLB 1U92B 3C8HA 5F88B 4ELKA 1KJ3H 2NW3A 3O2DL 1P7KB 1GC1L 2LU3A 5EU7C 5F7EH 1BZ7A 5I1IH 3HPLB 1CGSL 4LFHD 4Z5RA 5L2KD 1RJZB 4NPYA 3BUYA 1AQDB 5A2IH 4BFEA 4ODUA 4M3KB 3TT3L 1N4XL 3HZMB 5E8NA 2JCCF 3ETBF 1BM3L 2GITB 2XWTB 3OKEA 4W81A 2EE6A 5ECJE 4FTVA 3OAYH 3RPIA 1R3JA 4I13B 4MJID 4WJ5A 4X7EC 3VXUB 3WBDA 4XP6L 2R0ZL 2GJ6D 4DGYH 3HCVA 2P8PB 4OSUH 5F7HA 5E9DD 5TQ0L 3OKNA 5ENWB 3VMNA 4MCYB 3HG1E 4B50A 5D9SA 1X4ZA 5FO8B 3MRBB 3KNBB 3OJMB 4HH8A 3GSNL 4QHNA 7FABL 3O3UN 2BSED 5KSUB 3I75A 1ZSDB 5J06A 2OTPA 15C8H 1WBZB 2X10A 3LIZH 3DETD 4X5XA 4OGYH 1T3FB 4D9RD 4OZ4A 5D1QA 1FO0L 5DTFB 1NQBA 3EYOB 4HJ0C 3AY4C 2HLFC 5CAYB 3O3BB 3OGCB 1FC1A 3TFKC 3CXHK 3V5DA 4V1DD 3EYUL 4PJIA 4HS3A 5F7UA 3G6JE 1OCWL 1OPGH 2NZ9C 1HHKA 5E6IC 5IR1A 2I26N 3SE9L 4P59L 5ABDE 2W9EL 1TMCB 2CK0H 3DVGA 1ZLVK 1LO4L 3SQOL 4P57A 2ZJSH 5GIRA 3GSUA 5HHMD 4E0RA 1I8LC 4LCWA 5HYSA 3FRUB 4OQ1A 3KR3H 3MLUH 4AENB 1F6LL 1A14L 1NEUA 1TVHA 2E5EA 1UWEH 4Y0GA 1Z5LB 2V7NA 4R90L 4HPOH 4UV7H 3LH2L 4PLJC 2FECI 5DDHB 4M43H 4WO4C 1AGFB 3O3EB 2WNGA 3OHXA 1MRCH 3RTQC 5I8EA 1GGBL 3DARA 3QQ9C 4QEGA 2A83B 1BD2A 2XKNA 2BVTA 2W60B 4WO4D 1IM9D 3I6LD 3KPQA 1I85C 2FD6L 4M7ZB 3S5LG 4XBEL 3D0VB 3DBXA 4PJFA 3S3JA 3OR7A 4P2RB 3RX8A 5DMGD 3RGVA 3O2WL 1C5BL 2GSIA 2BOBB 1NBZA 3IDIB 1LK3H 1B9ZA 2B20A 2GI7A 2CLRA 32C2A 1NC4B 4EI5B 4MJ2A 3S4SG 1LEIA 2B8OT 1A5FH 1FGNH 3VXMB 3MRQA 2VXQL 4AEIH 4GRLA 4XNXL 5BS0A 1LEGA 3TA3D 5B39G 4NQDD 1QRNE 1DQTA 1MFBL 4BYHA 4GG6F 1JTPA 3T8XA 3V6FB 2IMMA 1EUUA 3EYSH 3BO8B 4FXGB 2NY1C 3HTLX 4XVTH 5GS2D 1XGQA 4CL7A 4UUJA 3K8MA 5IBLD 5ITBH 4NO3A 3U4BH 5CJXC 5JIHA 4LSTL 4OFDA 1J0KA 2NY1D 1OARL 1I7ZA 2UUDK 3AREA 4JEGB 4R26L 2YWYA 4DTGL 1H8OA 4W70A 2V17L 2QADD 3UYPA 4BKLB 5KZCB 4DGVL 4WFHE 3OG6B 1DQQB 4L4TE 3UBXB 1J10A 1L4IA 2YPKB 5DYOA 2VQTA 5D7IE 3CVHH 3FFCA 2KUTA 5AZ2H 2F8VA 3CLEL 3GO1H 5HHOB 1ZANL 2D7NA 5DD6B 3H6JA 2XTLA 1ETZA 4BZ1H 3G9VA 3WFZA 5JW4R 3C08H 5KS9F 5F6IC 3AVEA 1SJVA 3P73A 1G6RH 4NFCA 4V2BA 1RZ7L 4M6OL 1F4HA 4Y2DD 2UY7A 3QHFL 5TPWL 5CBEA 3RWHA 2VR5A 5L2KE 3T0ED 2RGSA 3RIAF 3N9GL 4MS8C 4JG0L 3P9MA 4GAJH 3ARUA 1PGRB 2VXSH 2XOTA 4Y5XB 1SM3H 1DBAH 3SQBA 4MJIE 1OP5K 5SV3A 3L3DB 1ADQH 2GJ6E 3ULVD 5F9JB 4K8RC 1W8OA 3U1SL 1F90H 1CD1A 2EIBA 3BDBA 2AI0L 4FQXB 4MS8D 1J5OH 5HHXL 5E9DE 5IMOA 1NFIA 1LEKB 1EXUA 1QO3B 3FOLB 1EV2E 5FGCE 4HSQA 4Y16C 3RDTD 3WS6C 2A0LC 3QO1A 1BAFH 4L8SA 5E5RB 4YDLC 1Q0YL 1MUJA 1QFUL 5T3XD 43CAB 2ZSWB 2DQIL 3WXWH 5I18H 4M3JA 1KXQE 3G08A 4NO5A 1NMBH 1P7QD 3MOQA 3LQAL 4D9RE 2A0LD 2XIDA 4X4YB 2P7TB 3KPMA 4X7TA 4DCQB 4G43A 3IJHB 5GSRA 2OR9H 1XGTB 5D72H 4RFEB 2VL5A 5HYFA 1IGFL 3QQ4B 1FNLA 3L5XH 1YEFL 1U91B 1NUFA 2I07B 4V1DE 1I7RB 5LGJA 4PRPA 2HFGH 4OTXL 1VFUA 2JTDA 2R1WB 4ZD3L 4NP4L 1TDQA 1WCBA 5E8DL 2RR3A 1Q1JH 2WQ8A 4JFQB 1YYLL 5JXAH 5HI3D 1RZFL 4GXUM 4NBXB 3VFTB 4N90D 2FGZA 1UWGL 2B0SL 3V6OE 12E8H 5HHME 3V4UH 2A2QT 1MQKL 5I15L 3SCMC 5I8CA 4JO4H 3C9NA 3VD7A 3HLAA 4U4BA 4LAQL 2CIKA 1I3VA 5FKAA 4UTAL 4YZFE 3FO9B 3MA9H 5IB1A 3N1MC 3SCMD 3B5TA 5HXMA 3Q5TA 5FA3A 2VDOH 2X70B 1CT8B 3GKWL 2XWBB 4JQIL 3IDXL 1F2XK 4L4JA 5KVMC 3NH7H 1VKXA 4IOFC 2OM5A 3ULVH 3U9UA 5E94B 3N85H 2VLLB 3OZ9L 5EUKB 1FORL 1MFDH 1JPSL 1J05A 2R0WL 5HVFB 3DMMD 5D1QC 2F54B 4HXAL 1GRWA 1A7RH 4Q9BA 4UDTA 2E3VA 1IILE 43C9A 4F7MB 5GRWA 3IS1X 3MFFB 4J4PA 1OB1A 4QOKD 1IEBA 1PY4A 3Q6GH 4CMMA 4ZUWB 4KDWA 5EU6A 3S5LA 5T3XH 2FBJL 4KK6C 4UQ3B 1ONQB 3H7BB 1B3JA 3Q2CA 4RAVA 5C09B 3G5XA 3HFMH 5AAWA 2Y7QA 4HS6A 2ZPKH 1D9KB 2BXYA 2GJZB 1CS6A 4S0TD 3I3EA 2HJFA 4JRXD 4NQDE 2ARJA 1Q8MA 3UZEA 2NLJA 3F7QA 2H3NA 2ADFL 5HHQA 5B39A 5JORB 1IGML 4YFDB 4TNWK 5J7CC 1IQWL 4M5ZH 4ZAKC 2YPLA 2C4FU 5ICXA 3STLB 1AFVL 3O3AA 2IAMC 1MJ7L 3REVA 4P2OC 5DJDA 3KPRB 5DSCA 3U4AA 3CXHJ 3B2VL 4IRSA 1JCKA 1HH9A 4TOYH 2NXZD 5CSZA 4LLVA 3P3YA 2R15A 5ERWB 8FABB 3GSWA 3DYPA 4Z7VB 3BE1H 4NZJA 4P2OD 1NBYA 3VXNA 1RZJL 4OLVH 1RV6X 3FOMA 1JK8A 1CZ8L 2VUOA 4GQPH 2Z31B 4JN1L 1D6EA 2QQQA 4HFWA 4LKCA 1JZ4A 4GG6E 1JVKA 4U1SA 1CE6B 4OF3A 4D0BA 2FATH 4ZS7L 3WHXA 1YN7A 2AV7A 3RGVC 2EXYC 3MLYL 3MLVL 3VWJD 4OCYL 1AKJD 1J1PH 4QRTB 5EB9A 5EDXA 4YWGH 3N1GC 4H8WL 3V6BR 1H0DB 3WFCL 2HJLB 4RMWA 4OIIH 5DK0A 3NFSH 3GEWB 4GRLC 2XTJC 1FPTL 1GIGL 3T0EE 3U9PL 1UM4L 1I8IA 2J5LB 3VXRD 3VFWB 4YXKL 1KJMA 4WI4A 4LLUA 1T1XA 1T5XA 4ZUVA 2EDEA 2HN7B 4I9WD 1RQ5A 1LO2L 1KPVB 3F7PC 2ZUVA 3ULVE 2Z35B 4B53A 1FNSH 2UWEA 2RFXB 2ICWI 4OLZH 4RA3A 5E6ZA 3MREA 2BNQD 4NRYA 5GS1B 1H3PH 1V3LA 1O7SA 5GZOC 5DJZA 3RA7L 1AH1A 5T3XE 3ARQA 4CRPA 3SO5A 4QO1A 4CJ1A 5KS9E 1E28A 3LS5H 2L0DA 4UNTA 1GGIL 1DDHB 4X7SH 3ZSSA 4QRRA 1T1YB 5HHNB 4PGCB 4FABH 2X89A 1KLGA 1CFVH 5IV2B 3HZKB 1PJ9A 1T1WA 3WLBB 4LPVA 1C12A 2DQTL 4O4YL 1W2KT 5EC2A 1YC8A 5INCA 2NY5C 3QUYC 3OR6B 4HKXB 3BP4B 1OTSC 4L29A 1T4KA 3HR5A 4TRPL 3MRLA 5J3HC 2NXYB 3LEYL 5FA4A 2ZCHH 1J0YA 4N90E 2G60L 5E2UL 3S35X 4U6TA 5GGSA 1R24A 1MWAA 2IBGA 3WS3A 1QACA 2P43B 4B7IA 3DX6B 1OTSD 1I1FB 5CEZL 2Z4QB 1S7VA 2E27L 3W2DL 2QSQA 1A3LL 2BRRH 4LBEA 1RSFA 2DJ4A 4LFHG 3UTTA 5EU4A 4M6ML 4NKOB 4KUZH 5GS0D 2DS4A 3QDMA 4LGSB 2QKIB 4L8SC 1B6UA 1V7ML 5DQJB 3JWOL 3E2HC 4X99A 4X6CB 4UINL 5IEHB 1I1YA 2VN4A 3FMGH 4PJBE 1GZQA 1XR8B 1NC2B 1GVIA 1ZGLP 4MMXC 4DUXA 2HJKB 3N1QC 3V6ZB 2Z93B 4MAYB 5F96L 3CK0H 1GOGA 3MODH 1XH3A 1KB5A 1HH6B 3MNWA 4PJ7E 4QOKE 4AIXA 2EYTA 3CLFH 3MV9D 4JFDB 4YR6A 4U6HA 4HGWA 3V4PH 2KBGA 4ZTOL 3B9VA 4NOBA 2CKBB 4KRPD 5BJTA 3QEHB 4PJGF 3O6LH 3PWPB 1I3GL 1IARB 3B2UD 5F71A 3VD4A 2VYRE 1T03H 1JPGA 4JRXE 4LCIH 4O2EB 4TUKL 4WCYL 3RJQB 4NKIL 2HH0L 2IQAA 4P2RD 3L1OL 2B1AL 1U8KA 5KSAB 3GMMA 1OGAD 1MHPL 1NC4D 1T66D 1BREA 5DGRA 5DUML 2PCPA 1KSRA 3ARGC 3VXMD 3LKNA 1AIFA 3QG7L 4P48A 4MA8H 3LKQA 4WUKH 5C0EB 2YUXA 1BWMA 1TIUA 3OX8A 4GG8A 2OK0H 5DVMA 3MOAH 5IW1B 4APQC 3U46A 4GRWF 2HVJB 2FSEB 2CDEA 5E1AB 4GQ9L 4ZS6C 3MX0A 3ARGD 4AYFA 2OL3A 3JWNC 4N68A 1KCLA 4PFEA 4DJMA 5J11B 3CAFA 5D71L 4HZAA 2X4QA 4MVBC 4U1LA 4P5TB 4U6YA 4Z7UF 4LGRB 1FVEA 5I17A 3ARWA 2AJZB 4EQ3A 4GKZB 2B5IC 3MXWH 2EYRB 5C0RH 4ZOCA 5KZCD 4G6AD 5GS0H 4J4PC 3S36H 3QUXD 1LP9F 4KKCC 2BC4B 2CDFB 4ZUUB 4Q74A 4S0SD 4BUGA 1EEZB 4P2CG 3PGFL 4ZFFB 3IDYC 3UYRL 3RNQA 2Q8AH 1T1ZB 1KCRL 4PJCF 3V8CA 1ZVSA 3RKDC 4WWKA 1KPRA 3QFDB 1JWMB 4N0FB 2V2WA 2WIMA 4KJPC 4JJ5A 4QXGH 1OAKH 3FCTB 3BWAB 3VXRE 3PHSA 4NCDA 5DO2C 3VRLE 4R96B 5FK9B 3CFKB 3HNVH 5FAAA 1I8MA 2W38A 1XGYH 3QB7C 4WHCA 4GBXC 3UROR 4I9WE 3QDHA 3EYQC 4F8QA 5EC1B 4S10A 5LXGL 2DQEH 1Z6JT 3FFDA 3LN4B 3TP4A 4A6YA 2BVOA 1M7IA 1DBML 3CPLA 4JFXA 1SEQH 1J1XH 5HGBB 4I0PA 3C6LB 1HKLL 1XGUB 1MH5B 2EICA 4IRSC 3VFGH 4LLWA 4X5WB 2EDBA 1RIUH 2BNQE 4WU7A 5KTEH 3NACL 4O5LH 1T21B 1MCPH 4H1LB 1YMMB 1EBPA 2CLZA 2VDRL 3QUML 3KXFB 4FQ1L 4Y4HA 1U36A 2YK1L 2PYEB 4RGMC 4PGEB 2P8MA 2RJMA 2X4UA 4HX1B 5JQHC 4Z76A 5L88L 1V05A 4J8RB 4YGAB 4NZUL 4XMKL 5FO7A 4FQXD 5I74C 2DL2A 1RUKH 2W0FB 1P84J 1I7TB 3MGTA 3SHSA 4YFEA 3RWJA 1T6WA 5I16A 4NQVA 3QULA 3CD4A 5JHLH 5IGXL 3I3BA 1T5WA 1SY6A 2EDYA 4NUGL 1F6AB 3DO3A 1CLOL 3DOSA 3MNZA 3UTZA 4PJ5A 1OQXA 5D1ZB 1MF2L 5C3TA 3JTTB 4P4KC 3TVMB 3VH8B 4Y5VB 3F12A 4JN2B 4QRSB 4HJGA 1TNMA 2WANA 4XPGL 4DZBB 1FYHB 2NMSA 2GCYA 3D18B 5I1DB 2ARWA 5DXWA 4P99A 5IUSA 4P4KD 4OM1L 3VWKA 5IFJA 4C54A 4OLYL 4IRJC 2BSRA 4PJXF 3BUTA 4HQQL 1G1CA 1PSKL 1KLFA 4XBGA 2IFFH 4OKVA 1TCMA 4EUPB 3PIQA 4XP4H 3B5GA 2C3XA 1MIEH 5EU5A 4WY7L 4S1QH 4TQEH 4RDQG 1CXEA 5L2KA 4IRJD 2IH1A 2DQHL 3UTSA 4KMTL 1XR9A 2BY1A 4NQED 2DTML 1KCSH 3DUSA 3HNSH 1DBJH 4HIXL 3RVTD 1R5VB 4FQJH 1FYTB 3D85A 4XNUL 2GJ6A 4FQIH 5FFLA 4GMSL 1KTRL 1X9QA 1CFQB 4R2GC 5AD0B 5ESVB 3UJJH 5J1TC 1EBAA 4C56A 5IBTH 5C8JA 2GY7B 3VD9A 4JM4L 4G6FD 1EJ6A 4NSKB 3I9GH 4NFBA 2ICWA 2EH8L 3L3HB 2HP4A 4ZO7A 2J4WH 4KJYB 1PX4A 3B83A 3DHMA 3IU3A 4FQ2H 1JPST 4Y19B 3KPLB 4TNWF 1A6AB 1ACYH 1NLDH 3C60B 1T7XA 1BBDL 1KG0A 2YMXL 3CFJA 1NPUA 2YD3A 4AIZB 4P2RE 1F02I 1G7IB 3O8XD 2NY7H 1F11A 1OGAE 2EEAA 3M17B 2AJXH 3BEWB 4WHYH 3FQUA 1HKFA 3PNWA 2DJSA 3VXME 3RVXC 4V1DA 2Q76B 5GISL 3QNYA 2WZPD 5BMFL 1T7VA 1C1EH 2HVKB 2J6EL 1CF8L 1YNLH 2HFFA 2OP4L 2OTWA 4LL9A 4PRDA 3D1MC 1OAYL 4XPBL 2A9NH 2BNRD 3QIUB 2M26A 4YHYB 1JV5B 1I8KA 1JNNH 3QNZB 4NGHL 2AJUH 1NGZA 3GMOA 1TFHA 2WIIA 3BH8A 4HHAA 3V6OA 5GSVB 1U3HD 4PJGE 2XZAH 3KPRD 2Q6WB 1HYSC 3I02A 4K2UH 4NWUH 1IKNA 5I75B 1UJ3B 1I7UA 3ECBB 1RJLA 2VZVA 3GSXB 5FHAH 3DX7B 3CVHA 3BGFC 4Y88A 5DMJB 3BHBB 3HE6B 1NAMH 2D03L 1HOCB 1FIGH 4RX4A 2LAAA 4Y1AD 3QA3A 4AEFA 2HAZA 5FKPA 3TH3T 4KZDH 3PQYD 4D2NA 4ZFZB 5SWQB 4I0KA 1G6RA 4CNIB 1W72B 5DMKB 3MLWH 5DFWH 4D0CA 4GRWE 3QWOB 3HI6L 5FHBL 3L6FA 4MDJA 3ZZ1A 3M1BB 4F7TB 1UEMA 3H9HA 4D9LH 4JR9H 3VRJB 4LVEA 1TPXB 5J8OA 3TO2B 3MJ6A 3QIWC 1BGXL 5SX4H 2SEBB 4QRUA 3WFBH 4G8GB 5K9OB 2R69H 1KULA 3TA3A 1R3KA 3S35L 3R0MA 3H42H 1MI5A 4CVUA 1CWVA 1MRFH 1NKOA 2ID5A 5DD3L 3DUUB 3X3GL 1CG9B 2WBJC 4ELMB 4PLNC 1YJDH 2VC2L 4M62L 2FIKA 2DLHA 4F37K 1G9MH 1KCVL 5DJXA 1F6FB 3QWRA 3UTOA 1Y6KR 2H8PB 5JW5B 2J12B 2XA8L 4LQ1A 5L0QB 1KPUA 1QBAA 3PJSB 5DVKA 1NFDB 1CFNB 1FFNB 2XRAH 2Y5TA 3S7GA 1FL5B 1TZHA 2WBJD 5EN2B 2HLAA 5BVJA 2ERJB 2YBRA 3GMQA 4PJDB 4BZ2H 5HYJB 4X6BB 5CUSL 3RU8H 4ZO9A 1QQDA 4J12A 1V5JA 3RNKA 1MCBA 4J2XA 1G7LA 4WWKC 2B1HL 3BKYL 3MRKA 4OF0A 5I1JL 5EUOA 1QBBA 1UYWH 1KBGL 2RQ8A 1XF2B 1IGCH 4GW4A 2AK4A 4I48B 4XPHL 5D6CB 4NO2B 1O7VA 4LOUC 1LE9A 3S3PA 3L5WB 5GRXG 4ZFOL 3EO9H 4Y89A 1EAPB 4LSPH 4O2CA 4F58L 1EK3A 1S5IH 2GFBB 5IWLC 4EN3A 1OTTC 3SDCB 4K55A 5JTWA 2D7TH 4LOUD 3WE6A 2BSTB 4Y2DA 3O9WA 4NCC2 1RZ8B 5ILTH 3L95A 2UVEA 4Y4HC 1OTTD 4PV9B 3QQNA 1A0QL 4NQEE 2DMBA 2X7LB 3MBXL 4QXTA 4YXLH 4HC1L 2XZQH 1SQ2N 4O58H 3KPNA 5FOJA 3UJIL 3FQTB 1CIDA 4RIRA 4IOIB 4MA3B 4J1UB 3TC9A 1JBJA 5GGRA 1TJGH 2KPNA 4NKDB 3LEVH 5CZXC 3DIFA 4TUJA 3AROA 2D7QA 1RZKH 1WSST 2UYLA 2X4SA 1D5IL 2X05A 3HI1B 3RDTA 3RWDB 1N5YH 1JPTH 3WUWB 2PXYB 2LU7A 1CD8A 4XH2A 4P3DB 5BO1L 2F54E 3NCCB 4NOFA 2I25N 4LRNH 5EH1A 1DQLL 2XPGB 2HG5B 4K3JL 1SVCP 2FYYB 2CXKA 4CUCA 1RUAH 2VKXA 5I71B 3HZYA 1DTUA 2R1XB 4PB9H 1K8IA 3SE4A 3U0TA 3VGBA 3AAZB 3VWKC 3NGBC 2VZ3A 3PWPD 1Q0XL 5GPRA 5IKCB 5FV2A 4EOWL 1MREL 1WBYB 4M93C 4G5ZL 1TZIB 2WP3T 4L8CB 3QXDB 4OQTH 3GNML 1HSAB 4NNYA 1GXEA 1PKQB 3MLTA 4OM0L 4P2QD 3L3KA 5KSAD 1ZT1A 1AXSB 4LLMB 4IDJL 1EMTH 3NFNA 5B21A 4FQCH 4I77H 4IS6A 1E27A 1AGDB 5CLTA 2FEDD 3P9LA 4MNHA 1TQBC 1YYML 1CTNA 3ESUF 3KPRE 4F57H 4OF8A 1JGLL 3O2VL 1PG7W 2K7PA 2FX7H 3L7EB 1QUNA 1H3VA 2GSGB 3UBXI 2VITB 4Z7VE 4LHUB 1M7DB 3QRFM 3U30B 3J8F7 4OBRA 2O5ZL 2OYPA 3MRNA 4P5TD 1L0QA 3MMEA 1D5BA 5F9WB 5GGRY 4LGPB 1QKZH 4Y1AE 5IJVB 3ZE1E 2DQUH 4KPHH 4ZQKB 1BIHA 1S3KL 4MD4B 4PJBA 4M6AA 1ODAA 4HK0A 3BRFA 4G8EA 1URLA 5I1CL 5IQ7L 5GRUL 5D6DA 2X2YA 3F7VB 4L1HA 4ZTPL 4JPVH 2IAND 4PG9A 5I8OL 1L0YA 2VLRD 5K59F 4PJ7A 1U58B 1L6ZA 1EEQA 4FQLH 4FFVC 2OSLA 2D31B 3MCLH 4GO6B 2ADIA 4I2XA 2CRMA 1NCTA 4W6XB 1KJVB 3T0DA 3GI8H 2ZOKB 4FFYH 3EOAB 1KIPB 3FTGA 2QL1A 4UILH 2NY0B 4JRXA 3VFOA 1NLBH 2CKBH 4RFNC 3FHQA 2PR4H 3LEXB 3OJDB 3G5VA 4OCSH 4C4KO 1BF8A 2K9UA 4GSDH 1YEEH 3D3VD 5D7JA 4EIZC 3DGGB 5JHDA 3N1PC 4YFLI 1YEKH 1FGVL 1IKNC 1VB9A 1DBKH 4WUUB 1CLYH 1N64L 5IB5A 3QO0B 4YDVB 5IK3A 2X4NA 3UJTH 1CGVA 1H5BA 1HZHL 3FRPG 4S1SL 3OPZL 1ZGLB 4RZCA 2FX8H 1K3IA 3WL9B 3WIHH 4HXBL 3HR6A 5CGTA 3W81A 4U1IB 1R3HA 3IDMB 1FFOB 1DCLA 1GC1H 3MRDB 1G7MA 1U8HA 4WNQA 2V6HA 2I24N 5D1XB 1CGSH 4JRYB 3WYRA 4KK9D 4PIRF 1LK2A 1ZTXH 2PTTB 2NR6D 3ARBD 4XRCA 2D9QB 4I4WB 4QF1B 5D1ZD 3UBXG 1BZ9B 3CDGA 3MBEB 5CBAA 1BM3H 3VWJA 3P9WB 4KRLB 2FZ3B 2CDGA 3TWCH 4PTTB 5CHNB 2NX5B 3HB3D 2R0ZH 2X4RB 4G8IA 4WDIB 1BEYL 1NMAL 1LO0L 4QHKI 4MNGA 5GHWH 4MB3A 1DUYB 1CBVH 4QHMB 4LIQH 4JO3L 3VXRA 4KHTL 4HWZB 5IMLA 1BFOB 3MRCA 1KTLA 1IKFL 1U92A 5F88A 3B43A 5FGBC 1P7KA 3NAAL 2KH2B 1CI5A 1UB5B 2F15A 3HPLA 4RISH 1FL6B 3STBA 4FRWA 1V7NL 1RJZA 2HT2D 1AQDA 2YEZB 4KVNH 5FYJL 3E8UL 1RUML 3HZMA 2WUCL 2GITA 2XWTA 1X5KA 5EORL 4R8WL 3VA6A 3EYUH 5IROA 3VXUA 5J6HB 5SX4I 5INDB 5F3HB 5E4EC 2P8PA 4WFED 3MOBL 3RRQA 1T89A 4X6DF 4NJAL 2E7LA 4H1LH 3F58H 4L9DA 5ENWA 2YPVL 4MNQD 4P59H 1I1AB 2W9EH 2ZUSA 3MZTA 2CK2A 4MCYA 1LO4H 1MRDH 3GIVB 5FO8A 3MRBA 3PWPE 3KNBA 4JG1L 4WHYG 4WTXA 2KQMA 3CXDH 5KSUA 4EN3C 3ZTJH 3C60D 1ZSDA 2UV3A 3ALWA 4KH2A 1AO7B 2GYSA 2Z91B 4OLUL 3NA9L 1A14H 4P46B 2D0GA 1WBZA 5JR1H 4P2QE 1T3FA 2DQDH 1PFCA 2AK1L 5DTFA 3EYOA 4R90H 4Z7NF 5B22A 1INDL 3LH2H 3O3BA 3OGCA 4R97C 5FOBB 1XF5B 5HDQH 4RAUB 1F13A 3S37H 1D6VL 3X3FL 1AP2B 1JGUH 5AWNH 2K1MA 4R4NC 3E0GA 5JPNB 4XP5L 1GGBH 1N5AB 5EULV 4O02L 5IOPB 5C0CB 4LP4A 2FD6H 3M07A 3NMEA 3FRUA 3RX5A 4AENA 5JA8B 2YD6A 1WJ3A 3CSGA 3EOYG 4NWTL 5CKGA 3IB4A 2W0PA 1JMZA 1IZKA 2R29H 4Q58C 2J88L 4KZEL 3HC4L 1MFCL 3X17A 1Z5LA 1PLGL 5L2JB 1T2JA 1RMFL 4FP8L 3JUZA 3FJTA 2VXQH 2GTZB 3DVNB 1JZ2A 3RWFB 2IANE 5DDHA 3SE4C 3HE6D 4LIQE 1AGFA 3O3EA 2VLRE 4ODTL 1WT5C 2IGFH 3F65A 3LQAC 3PHQB 1LMKA 4NCC1 1MCNA 4X6EB 4ISVB 3HC3L 2A83A 1IMHC 2W60A 5MEOB 4DUWA 4FG6C 4F37F 5D93B 1FFQA 4ODVL 4I18C 5DRNB 5F7KC 3U83A 1OARH 3D0VA 4UV4H 4KQ3L 4DTGH 2A6IB 1HXYB 4P2RA 3STZB 2QQNL 1EO5A 2V17H 4HBCL 4J3TA 3CU1A 2BOBA 3IDIA 1I9RL 3OTTA 3D3VE 1OGAA 1F4YL 5A16B 4EI5A 1NC4A 1A9EB 3ZKMD 3VXMA 4JZJB 4MXQD 1JYVA 4P9ML 3IFOB 1JWSB 2GHWB 4XCYB 2W92A 3QPQC 3V6FA 3BO8A 4FXGA 4DGIH 5IG7B 2EIDA 1ZANH 2AAVA 3MLXH 1UJTA 1MVUB 5MP6H 3FRPA 3UCRA 1ZLSH 3K0WA 5TDPB 1XMWA 4AMKL 2MQCA 2YA1A 1HILB 1HNGA 4HFUL 4NQTA 2VQUA 4ZG1A 1RZ7H 4KJWD 3INUH 4M6OH 5D6DC 3C5ZB 1EEUA 3QHFH 1FNGB 4BKLA 3K4DA 1H8NA 3UAJC 3N9GH 4N8CL 4DK3A 2NY6C 2OMBA 1JNJA 4OFVA 4QYOB 1Y6MR 1DQQA 3MRRB 4J6RL 3SGJA 1BP3B 3UBXA 3WHE1 3HMWL 4DKEL 4FFWD 2YPKA 2BK8A 3MTRA 1HCFX 3MV7B 2VDKL 5KVDL 2ORBL 5HHOA 3A67H 3QRGH 5DD6A 3HUJF 3GB7B 4YHPB 2IG2H 1CGXA 5IT2H 5D8JL 5I1LB 3AXLB 3MACH 3B9AA 5J6GB 3UPAA 1X6NA 3QAZB 3BGMB 5D7JC 1QFUH 2EIEA 4L8BB 3SE3A 3BQUD 3OAZH 5JUEL 4U0QB 3FB6B 4HCRL 5DVNA 5FGSA 3SE8L 5DUPL 5F21B 3QI9D 1KN2H 3MZGB 3G5ZB 4IIQC 3MV11 4Y5XA 5ESQB 1HE7A 5GGVL 1YEFH 4Z6AT 3L3DA 5CJ8A 4PREB 5F9JA 4ZODA 4HUVB 2FIRT 2LTQB 3H9SB 4OTXH 4WFEE 4FQXA 3ORJA 3L5JA 4MB5A 2GEEA 1LEKA 1QO3A 4MNQE 4JY5L 3FOLA 2DI9A 4M1CC 3PXHA 5DC0A 1C5CL 1MCOL 4YX2H 2PXYD 4GRMB 1UWGH 2B0SH 5BV7B 1MQKH 43CAA 2ZSWA 1F00I 1JTTA 1CICC 1Q9LB 4JCMA 3EDFA 1ZHLB 5JLZB 3KJ4B 1FP5A 1QFPA 4M9PA 4LAQH 4X4YA 2P7TA 1FG2B 4DCQA 4KKBC 3T77B 3IJHA 3F6LA 4F33B 4JO2H 1XGTA 1RZIB 4RFEA 4HKZB 3QQ4A 3V0WL 1U91A 2I07A 2P49B 1I7RA 3VG9B 1YPZB 2LE9A 5EA0L 3T2QA 4JQIH 4C83B 1EFXD 4K7FB 3IDXH 1QFWL 2R1WA 2EDWA 4KKBD 4JDTL 4YC2B 4FN0A 1WWBX 2LV4A 5DEFB 1FVCB 4JFQA 4X6DE 5DHYB 2CRZA 4P3WA 1FORH 1JPSH 1T7ZA 2H26B 3ZDYF 3VFTA 2HTKD 4HXAH 4QTIL 4U3XA 3V7AE 1E6JL 2BVPB 1OHQA 2DD8L 5IROC 1C7SA 1RU9H 3C09C 2I5YL 3NZHL 1X5AA 1TJIL 1T89C 3HA0A 3MA7B 2E7LC 1YEHL 3FO9A 3W11C 5FM8A 3ILQC 1RUQL 1SVZA 4XPTL 2CO6B 2X70A 4AM0B 1CT8A 3DRQB 4LSVL 5IVZB 2XWBA 5K33A 1N7ML 3LY6A 5C71A 1D5MB 1IAIM 4HUNB 5TE4H 1B0WA 5FDYA 1A6TB 2XXMB 5DFTA 5E94A 2VLLA 1IQWH 5HI4D 2F58L 4LEXL 4N5UA 5FM4A 2DI7A 1U8LB 2A77L 2F54A 3CJJA 3H2WA 4G6JH 4F7MA 5CKAA 3C8KB 3MFFA 4NUJB 4JFEB 1UA6H 4ZUWA 4MSWB 2W9LA 5D5MB 4QNPF 5KN5B 2VQ1B 4YHIB 4OZHF 4UQ3A 1ONQA 3H7BA 1FE8L 5C09A 3CFIC 4QRPB 4F80A 4KTYA 4OD3L 2EDNA 1D9KA 2GJZA 4P3CH 2JF1A 4NYLB 1KYOK 1RZJH 5HI5C 1DQML 2APFA 4HK3N 2ZUWA 3VG0L 1UVQB 5JORA 4UB0L 2OBGA 3TT1L 4PRBB 1P1ZB 4GAGL 4KHXL 5HI5D 4WUUD 1KCUL 5AG8A 3STLA 1X3DA 4H8WH 3BIKB 3WFCH 1FG9C 1ITBB 1Y18B 2H2SC 4CVWA 3KPRA 2AGJL 5L9DL 1G7PB 4PJDE 3WCYA 4U1JB 4WFFD 1FPTH 1GIGH 3ARDB 2KL6A 1OTUD 3ZT7A 5ERWA 8FABA 4Z7VA 4M5YH 4HIEB 4JPIB 2GK2A 2CJUL 4WV1B 1UM5L 1IM3B 1FRGL 1B4JH 1IFHL 2Z31A 4M7ZC 4U0RB 5DJ6B 2GQHA 4MJ6B 1CE6A 2XN9B 2X09A 4NN7C 3TO4D 2W9DH 2VERN 4XGZB 1A1NB 4QRTA 1A6VH 1NEZB 2C9AA 2IADB 5LQBL 5CGYC 3SDXF 5HPOA 4EI5C 1H0DA 5HGAB 2HJLA 2VLJD 4JPKL 2ED7A 1XF3B 3WNOA 5L6YL 1YEJL 2QSVA 4FQHB 4PGDB 3VFWA 2XA3A 4JM2B 3F6IA 2G9HB 4OJFH 3BIBX 1T0MB 3GIZH 1J1OL 2HN7A 2GTWB 1KPVA 2W65B 1Z0NA 2F19H 2CR3A 1P53A 2DQTH 3ZMRA 1CDYA 4O4YH 2Z35A 4L3EB 5CSGA 5HYQB 4OZGF 5ACMA 2UY6A 2RFXA 4H1LG 3EOBB 3FQWB 3K2MC 3LEYH 5GS1A 3O81A 3HUJE 5C7XL 2G5RA 1Y0LB 5ANMB 2VDQH 4WI7A 3ZTJG 3JWDL 1DDHA 4LDLB 3BPNB 4ORZC 4G9FB 1DN0B 1NGPH 1NGXB 1T1YA 4KKNA 5HHNA 3WXVH 2YD2A 4PGCA 1A3LH 4OFYA 3GGWB 5IV2A 3HZKA 2VDLH 1EHLH 2HYMA 2DKMA 1A7NL 4P4RB 3WLBA 5KSVB 5EPMB 4N9GB 3U48A 5JIIA 1AO7D 1V7MH 1FSKB 4P46D 1NCCH 3JWOH 1R0AL 2EDXA 3OR6A 2I9LB 3ARSA 3LKPB 4HKXA 3BP4A 4UINH 3VH8G 4JHAL 1EHAA 2R4SL 4YNYB 5DURB 3BKML 4F9LA 4K9EH 4JAMB 4NFDA 1WGOA 4HV8B 4M8QB 3DVIA 4KQ4H 1X5YA 3RWGB 3GRWL 2HTLD 2DLFL 3DX6A 5JPMB 4TUOB 4KK5C 3MJ9H 1I1FA 1UZ6E 4PJHF 4JZOB 2Z4QA 4HW6A 4K3DL 4EUPG 5DD5L 1FIEA 1EA9C 4KROD 3FQNB 2XQBH 2YHGA 3K1DA 3TNNB 5C0CD 1IC5L 1IEHA 1I3GH 4XWGL 4BFIB 5FEBA 5TJWK 4NKOA 2QHRH 2Y06H 5F1NA 2VN7A 2QKIA 3DNKA 5GRVL 1V3MA 2H1PH 4WCYH 2ZUQB 5DQJA 4MQXC 1IAOB 4X6CA 1EFQA 4S2SB 3L1OH 3MRIB 5IEHA 2DQJL 4NN6B 2R2HB 2HWZL 2B2XL 3TN0D 1RJCA 2IBZY 4FZ8H 1CFTB 1NC2A 1XR8A 4M7LT 5I73C 2P5WB 5DUMH 2HJKA 2V9RA 4BK4A 4PY7B 3T4YB 3V6ZA 2Z93A 1BJMA 4MAYA 4ZUTB 3TCLB 2DYPD 1HH6A 5I8KL 3MLZL 5I19L 3OBAA 4JFDA 1ZAGA 1II4E 2DIBA 3K2UL 5F89B 3VA2C 1DVFB 4NRZB 3W5NA 2CKBA 3QEHA 3PWPA 5SWZB 3EYFB 4FHBD 5EZIL 3IFPA 4O2EA 3LMJH 4E9LA 3B5HA 3QCTL 1UC6A 4JFYB 4X6FB 5KSAA 1JYNA 3QG6B 3MCG1 2NY4D 5KOMC 3ESVF 5F9OL 2CRYA 4WUUE 5MI0C 4X4ZA 5JDJA 3KJ6H 2GY5A 4XXCC 1KCRH 3OJVC 5C0EA 1NCAL 4XX1G 3ARZA 3IAPA 5IW1A 2HVJA 2FSEA 4MQ7B 4WFFE 5E1AA 3RVWD 4AK1A 4RA0C 5DMIH 4Y4KC 4XTRC 3V7AG 2F53D 4HUKB 4QNPE 3GMRB 4P5TA 4OZHE 3TIDB 3FAXA 3T3MF 2AJZA 2R56H 4J3WA 4GKZA 5DS8B 3C5ZD 3R8QA 4PBVC 5LXGH 2EYRA 3QQ3B 1JN6B 1YN6B 3VDCA 4R7DB 4XTRD 1MELA 2Z8SA 4PJ9B 4NO0B 5C08B 1C8PA 2BC4A 4LCCB 2CDFA 3S4SB 4ZUUA 4U7KA 1T7WA 4OIAA 3NACH 1P4LB 1EEZA 4ZFFA 4U7MA 3QUMH 3QFJB 1T1ZA 4ETQB 2VLJE 3G6AB 1NCDL 3SJVD 2BOCB 1D9KC 3CU7A 2BY3A 1JWMA 3MV7D 2NY2C 3QFDA 4N0FA 4NZUH 4OD1L 4XMKH 1SYSB 2WM0A 1HINH 3FCTA 4MAUL 3BWAA 5HHPB 4RWYL 3F62A 4R96A 5FK9A 3CFKA 1RZGB 4X4MA 4RMUA 3BPLB 4PP1C 2Q1EA 1G1YA 5IGXH 3I6GB 4NUGH 5EC1A 4M7JL 3LN4A 3ROLB 1CE1L 3F5WB 4RMRA 4CKVX 3AB0C 4H88H 1MF2H 3MO1B 3A6CL 5A3IC 5HGBA 2VJXA 4PP1D 3C6LA 1XGUA 5C6TL 1MH5A 1DZBA 2FJHB 1AGBB 1JHKL 3VD5A 4X5WA 1JE6A 2WQRA 4NKQB 1T21A 4PJ8B 4H1LA 1YMMA 3SY0B 3KXFA 4QLRA 3RZCC 2PYEA 4PGEA 4PJEF 4HX1A 1DL7L 4HMEA 1INEH 3BZDA 3SDXE 1A7BA 4J8RA 1WAAA 1FLRL 4MA7L 4OM1H 1WICA 1SJXA 2W0FA 4OLYH 2YA0A 4OD2B 5JW4N 1I7TA 1E4WL 2Z31C 1JRHL 3ZT6A 3RZCD 1I9IH 3T0XA 3MRMB 2VAJA 4LVOB 4WY7H 4QT5B 1F6AA 3GSQB 4PJAF 1AO7E 1QFHA 2VZ1A 5D1ZA 1T1XB 3JTTA 3ZYJA 3HE7B 3MUZ1 1A3RL 1EERB 3TVMA 2I60H 5CGMA 4LLQB 4Y5VA 3VH8A 4OZGE 1QLRB 4JN2A 4QRSA 2UVFA 3MRJB 4IRZL 4PRHB 4DZBA 4OZIB 1LWRA 3D18A 5I1DA 4GMSH 4UMGA 5MENB 1NH6A 2F74B 1PKOA 3GJFH 1EUTA 1AD0B 4AY0A 4EDXB 5TH2B 4GW1B 1VGEL 3OKOB 3BT2H 5IVXF 4KMLB 4JM4H 4HK3J 4RMVA 3E6FB 1V3JA 2EH8H 2ITDB 5JW3H 1EHXA 5C0CE 1IGTB 4EUPA 3CH1B 2C1PB 4N5ED 1J0JA 2F5BL 2J8UB 4B41A 3MXVL 2EE2A 2HRLA 3PP3K 2YMXH 1RJYB 3VFMB 4HH9B 1S78C 3BW9B 4NC1C 2D4FA 4MX7B 1TNNA 4AT6B 4PRID 4IJ3B 2ESVD 3QISA 3LKOB 1J0HA 1R5VA 1HQRB 1FYTA 4JB9L 5BMFH 3OF6D 3OB0H 1HXMB 2J6EH 3HHRB 2BP3A 3BN9C 4XNMB 2E8ZA 1CFQA 1KN4H 5AD0A 1KELL 4XPBH 5ESVA 4UT6L 3ZE2F 4GKOA 1MVFA 4NSKA 3H0TB 4OB5L 5FCUL 2OXHA 3L3HA 4KUCF 3WDIA 2X4TB 4KJYA 4F9LC 3EDKA 1A6WL 4I1NB 4Y19A 4CBPA 3KPLA 1A6AA 2NXYC 3C60A 4X6CF 5AG9A 1FDLL 1HHGA 4JFED 1CGWA 2XQYK 2EC9T 4AIZA 3T4AB 4GAYB 4NBYB 4PGZA 5C07B 1XIWB 1G7IA 1BX2B 5BV7H 3M17A 1ZA6B 2BHYA 3BEWA 3VMOA 5C0JB 3SDDD 2Q76A 1S7SB 3QSKB 3RY6A 2D03H 1QBLL 2HVKA 2QQLL 3ARYA 3T2PA 1GAFL 4G7YL 3S96B 4ODHL 4OCWL 3QIUA 1VHPA 1JWUB 2BVUA 1JV5A 5I9QB 2F53E 3QNZA 1TTGA 1JI2A 4OZFH 3HI6H 5FHBH 4UTBH 2AXFB 2CIIB 3AGVA 5GSVA 3IU4H 5ID0B 3OKMB 1M6OB 3PHOB 4RGNC 2Q6WA 4D8PB 3HG1B 3NBNA 2VISB 4HZLA 1UJ3A 1BGXH 1KACB 3ECBA 5CZVH 3GSXA 3DX7A 4RSVA 3CDCA 2DKSA 3BHBA 4RGND 5EIVA 3HE6A 5HGDB 1KJ2B 5EO9B 2VDMH 1HOCA 5GJSL 1TCRB 2QEJA 1I3UA 3U36B 3PL6D 3QHTC 4ZOAA 5ADOL 1T80A 1KENH 3MV7E 1BOYA 4KAQL 4PG2C 3FO0H 5DEGB 4ZFZA 5SWQA 3AS1A 2VC2H 4XNZC 1NUDA 3TPUB 4CNIA 3DTXB 1W72A 5DMKA 3WFDH 1N6QL 3G6JB 1CK0L 3GJEB 3CGTA 3QWOA 2Y1VA 2XA8H 3M1BA 4NQXB 4F7TA 3E6HB 1DANT 1TVBB 3VRJA 2ZSVB 2MCPL 3LHPH 4XPAL 1DLFL 4K07A 4TVSa 5CUSH 3IDJB 5A40E 3TO2A 2FLBT 4LSDA 3P4NB 1A2YB 4IMKA 1IT9L 4XVUC 2SEBA 3RL2B 4G8GA 5K9OA 2QLVB 5CSBA 3SKJH 2FWOB 3X12B 4DQOL 1DQDL 3H9SE 3DUUA 3HMXH 3BAEH 4I3SH 1CG9A 4ELMA 4Z7WB 4WI2A 2NPLX 3RUGB 4JANB 3LQZB 3OKYA 3ES6B 2Y4SA 4X5LA 2KDGA 2H8PA 5JW5A 2DKUA 4XHJC 2DWEB 3PJSA 1NFDA 1CFNA 1FFNA 2NY5L 1FL5A 3S34L 5EN2A 5ID1B 4YXHL 2C1OB 4PJDA 5HYJA 4X6BA 2DIJA 1G9NH 1TVDA 2XY1A 9CGTA 1HHIB 3MBXH 4M6NL 5KSBF 4LDEB 1UACH 1XF2A 3W9DB 3T1FB 4I48A 4TPRL 1K8DB 1WZKA 1YPZE 5D6CA 5HJ3B 4NO2A 1RURL 1NMCB 3L5WA 3VXSB 2LFGA 5D4QA 4PJEE 1EAPA 4HS8L 3TIEB 4UNVA 2GFBA 1QRNB 2AJSL 1S9VB 2R9HC 3SDCA 4MXWL 1PBYA 3SKOB 3VFPB 5FYKL 5BO1H 2V2XB 3WJLA 2BSTA 5LGKA 1DQLH 1MIML 3GHEH 1PQZB 1RZ8A 1U93B 3O11B 4PV9A 3SGDH 3IVKB 2R0LL 3CZFB 1CXKA 1TTUA 2X7LA 3P4MB 4PRIE 3DECA 5D2NC 2ESVE 1EPFA 4UOW0 3FQTA 1MREH 1NCUA 4JFFD 5FYKU 4G5ZH 4IOIA 4NQUA 5T1KB 3SOBH 4MA3A 4JFOB 4J1UA 4NC1E 3S88L 1CR9L 1INQB 2JIXD 1LE5B 4NKDA 1A7OL 4XCEB 4OM0H 4ONOA 4L4TB 1IC4L 4LLAA 4M48H 4Y4FC 3WN5B 3HI1A 3RWDA 2JJTC 3NCYS 5D7IB 3WUWA 2PXYA 1MNUH 4P3DA 3TVMC 1AQKL 1BQLL 3CDYA 3VFNB 1ZLUH 5CINL 2XPGA 2HG5A 4Y4FD 1YYMH 3BX7C 4JFEE 2FYYA 2V5YA 1F4WH 4ALAL 4URTB 3THML 4DW2L 4KKLC 1DVFD 2R1XA 3ARFD 2HFEB 1JGEB 2ZOLB 3FN0H 3AAZA 4KXZI 3MV01 3QCVL 1L6XA 5IKCA 2O5ZH 3P11L 3HS0B 2R2BB 3RVVC 1WBYA 4UAOB 2B4CL 1TZIA 1OAXL 4L8CA 3VW3L 3QXDA 4JREB 1P9MA 3WIFB 1HSAA 3O45B 1PKQA 4OGXL 1S3KH 5E08L 3CX5K 5C0BD 3AM8A 4MJIB 1AXSA 4CVZB 5F1SA 1NUGA 5GRUH 3HPJB 4LLMA 3ZE2E 4ZTPH 3UZVB 1AGDA 2OR7A 4POZD 2OTUB 4U2ZA 5E9DB 3QEQD 3LD8C 2HKFL 4J23A 5DD1L 5FGCB 3SKNB 3MLSL 2VXVH 1OSZB 1G7JB 3PWUB 4W6YB 3FKUS 1HDMB 3L7EA 5J13B 2GSGA 5CJOH 2VITA 3BZ4B 2FEEL 1M7DA 3DRTB 4LHUA 5CWSB 2MJWA 5BVPH 4RGNE 3DLQR 2KQNA 2NW2B 5FYJD 3IFNH 4R7NB 5IJVA 4XPFL 1DEEB 4HAFA 4ZQKA 4HJJH 4BJLA 1A64A 4MD4A 1YEIL 1DN2A 4JDVB 1FGVH 1MPAL 3F7VA 1N64H 3U82B 4DVRH 1U58A 5BRZD 3G5YB 1HZHH 4G3YL 4Q97A 1T20B 3RY6C 1WC7B 2FX9L 2D31A 3OPZH 4S1SH 2P47B 1XFPA 4OIBA 2FL5B 5CS7A 5HHMB 3WLWD 1FJ1B 1KJVA 4PRAB 5E6IB 2ZNWA 2CKNA 3BD4A 3QIUC 4JZNB 2ZOKA 2ZNXA 3EOAA 1KIPA 1CU4H 2P1YA 4OGZA 2EDDA 3LEXA 1T22B 1CXFA 3OJDA 4WHDA 3UDWA 3MPCA 5GZND 2VZUA 4OF7A 1E6OL 4TYUA 5I1KL 5CP3H 3DGGA 4JJHA 2ATPB 4YK4C 4WUUA 1UJ3C 2WV3A 3QO0A 1QNZL 4YDVA 3BPOC 4YHKH 1SEBB 5GRVK 1G6RB 1BEYH 2ZZUT 4LPWA 1ZGLA 3Q6FB 4WO4B 2IC2A 1IM9B 4JO3H 4U6XB 1S7QB 2HMIC 1WFOA 4KHTH 3H3PL 3WL9A 5FM5M 2RIKA 5SX5K 4GW5B 1IKFH 3MLRH 1MCQA 2APWA 1N6UA 2EXWD 4U1IA 3IDMA 1FFOA 3NAAH 3MRDA 1TETL 4MHHI 3QUZC 5D1XA 4JRYA 4JKPL 2PTTA 1U3JA 1VFBB 4I4WA 4QF1A 4M9OA 1TPXC 5C9KA 1BZ9A 5E6YA 2VMFA 4P23D 3MBEA 3PABB 1MEXH 1RUMH 4NQDB 2WUCH 3CX2A 3MJ9A 1CFSB 2VDNL 2FZ3A 5EORH 4DK6A 1PD6A 1RHFA 4PTTA 5CHNA 1FV1B 2NX5A 4PRHD 4W4OA 1KIQB 3MFGB 2X4RA 4IMKC 4WDIA 2JJVA 5KVFL 4PUBL 1H8SA 2R4RH 1DUYA 1RVFH 3VI4F 4QHMA 2JJUA 1OT2A 2YPVH 4HWZA 5EIIB 2NY1B 1BFOA 1QLEH 1GPOL 3VRIB 1OY3B 4JG1H 1FQ9C 2AABL 5GRJL 3NPSC 1UB5A 1K6QL 4JFFE 5DZOA 2X42A 3KVQA 1FL6A 4OLUH 2AW2A 1WFNA 1IE5A 3W0WD 2DDQL 2XY2A 5J0BA 2BHZA 3KLAB 1U0QA 2ERJC 2YEZA 2ZUXA 3T2NL 1OAZL 2J8HA 5J6HA 1D6VH 3X3FH 3SDAD 5INDA 4GG6B 5F3HA 2MCG1 1MWAL 1ITCA 4XAWL 4XP5H 1W0VB 3WKMH 5J1SC 1I1AA 4O02H 3VXOB 4LDOB 3TJHD 3GIVA 2E8YA 2FGWH 2APXA 2DN7A 3O4OB 2AEQL 3RFZC 1S9KC 3WKNA 3T0EB 1AO7A 2Z91A 3SDCC 4P46A 5F6IB 2Z92B 4RMSA 3U7AA 5C07D 1AGEB 5DFVD 1XIWD 3WDHA 4E41B 4KZEH 3HC4H 1MFCH 5C0BE 3QEGL 4WW1B 2X1QA 1RMFH 5HDBF 4FP8H 3P4OB 4MHHG 2NY3D 5FOBA 1XF5A 1ZS8B 4RAUA 1VFAB 4KI5C 4OZFG 1AR1D 1A4KB 3QEQE 3NZ8B 1AP2A 3PUCA 4ODTH 3UTQB 1KB5L 4FXLA 3GZKA 4LPYA 5JPNA 1YNTB 3ARRA 2YOCA 4YDIH 1N5AA 4L9LB 2M8XA 4KV5E 5IOPA 3HC3H 3MROB 4UT9H 4QTHB 4NJ9H 2HKHL 4KGJA 4ENED 5C0CA 5EOTB 5KS9B 4G6KL 3TZVD 4ODVH 1P7QB 1KLUB 4U1HB 1OP3H 4KQ3H 2FRGP 5FYJE 3MRFB 2QQNH 4HBCH 4XCCL 1J8HD 1I9RH 2CD0A 3DHJA 1JJUA 5IHZB 5L2JA 3T0AA 3GK8L 3SGDI 2GTZA 3DVNA 3FB8B 5KW9L 3RWFA 3TH4T 1J7VR 1TZGL 3B9KD 4H26B 1F58L 1FNEB 5TFSL 1AJ7L 1U8NB 3PF2A 5KJRL 5BRZE 4I8DA 3K4AA 5DJCB 4PY8J 3PHQA 3MRHB 5DC4B 4K94C 3D2UD 2QQKL 4X6EA 3K8KA 4ISVA 4CN1A 4M1GL 4QY8B 4XZUB 3DV6B 2R1YB 5MEOA 3O6FD 2OL3L 2EKSB 4AMKH 1F3DJ 3IRPX 3AM8C 3LN5B 4HFUH 3WFEL 2L7JA 1J9CT 5DRNA 1PVHA 1YQ2A 1EGJH 1QSFD 3W9EB 3D39B 2A6IA 1HXYA 3STZA 3EJYC 5TGBB 4HIIB 5DA0B 4RBPK 5JMOC 4X0KB 3ZHKA 4N8CH 4X98B 3SCMB 5A16A 1RULL 2A1WL 2PW1B 3AC0A 1A9EA 3BN3B 4JZJA 3HMWH 3NOIA 4G80B 4DKEH 1F4AA 1JWSA 3EJYD 3IFOA 4LPCA 3S97C 4XCYA 4G7VL 1ZEAL 4N0CC 3T04D 2VDKH 1B6DA 1Z0MA 5FYLL 5IG7A 2ORBH 2VNCA 1X5ZA 4NN5C 1LNUB 5F9WC 4PLKD 3ZT5A 5BZDB 3DMMB 1N8ZB 2Y07H 1MVUA 2H2PD 2WWMD 5TDPA 4JQXC 5JDSB 3OXSB 4G6ML 4QOKB 5D8JH 4JFHD 1HILA 3CX5J 4LSUH 5BW7C 3C5ZA 5JZ7C 1FNGA 1TENA 5JUEH 1K3ZA 2Q87A 4WGWB 1NCBL 1VPOL 2PO6C 3JBG7 4YQXL 1EEYB 4A6YL 1FFRA 3BDYL 2AXGB 4S11A 2QSCL 4QYOA 3RVUC 3WFHB 3MRRA 2VH5H 4CW1B 1MLCB 1Q9KB 5GGVH 2E6JA 4PRHE 1H3TA 4EVNB 2EDJA 5MENE 3ULUC 2RB8A 4XCFL 3MV7A 3FB7B 4OLXH 1CIUA 3VXSD 5F6HJ 2NY0C 3MUJA 3RVUD 3VFSB 1KJ2H 1NEZG 4JY5H 2QBWA 1GL4B 3N0PB 3GB7A 5GGQL 4YHPA 2WUBH 4OV5B 3QXVA 5I1LA 3AXLA 1MCOH 1T04B 5J6GA 5ACZB 3BGMA 3LIZL 4MMZC 4L8BA 4ZAKB 4U1KB 1SY6L 4YHNB 3BZEB 2IAMB 1Z2KA 3FB6A 3W0WE 2YWZA 4P2OB 1UKQA 1ORQB 4HG4J 1MCRA 3G5ZA 5ESQA 3V0WH 3OKDB 4OT1L 1PYWB 1A7PL 2N7BA 1MCHA 5B4MD 1H15B 4PREA 5T1KD 4DN3L 4TSCL 4HUVA 5EA0H 3H9SA 5DJAB 3U0WL 4WW2F 1QFWH 3CZJA 1AKJB 2VE6B 4M1DL 3WNMA 1NDMB 5FUCE 3TF7C 3BOVA 3HRPA 4K71B 3MLUL 1JNHB 4GRMA 4HWBL 3VJ6B 3FZUD 4QTIH 3KYAA 4NZRL 3R8BB 1E6JH 8CGTA 1Q9LA 3CMOH 3I84A 4RGOH 3T08A 4JGUA 4TTDD 1FNFA 1X5XA 2DD8H 1ZHLA 2EZ0C 4HPOL 5C07E 5JLZA 4UV7L 5C2UB 5IEKB 4UT7L 3NZHH 1FG2A 1TJIH 3T77A 4F33A 1NFKA 4Z8FH 1RZIA 3VGAC 4WW2C 1MRCL 4HKZA 4DOHB 1RUQH 1XCQB 1P5UA 1YPZA 4H20H 4LSVH 3QIBC 2IPTL 2F8OA 3NTCL 2IMNA 4KKAC 1N7MH 4K7FA 4C83A 1TITA 3TPKA 4HULB 2BNQB 4OCRH 1ZVYA 5DEFA 1FVCA 5DHYA 1VADB 2F58H 4LEXH 5I0DA 2H26A 2A77H 3QIBD 2XICA 1CDIA 2JK5B 2MFNA 4LASL 5DR5H 1EVTC 1LK3L 2BVPA 4Q6YA 1KXTB 1NSNH 5H35B 3H3KA 2XG5A 3U4EB 1J8HE 1FGNL 4AEIL 1JHTB 3MA7A 5CJ5A 4O9HH 4OD3H 1EAJA 3WNLA 1QEWB 3VGDA 5EOQL 4AM0A 3DRQA 5HDBE 3JWDC 5IVZA 3TLRA 1VEMA 1D5MA 3UEZA 4X8XA 1A6TA 4BQ6A 4UB0H 4R0LC 1JHLL 2C7UB 3M8OH 4GAGH 3QUYB 1KCUH 1U8LA 3OXRB 4YLQT 4XP1L 3C8KA 4HJ0D 2A6DB 4NUJA 5D2LF 1QSFE 2HLFD 2DRUA 4JFEA 3TFKD 4MSWA 4BH7B 5D5MA 5KN5A 2VQ1A 5IF0B 4ONFL 4JDZB 4YHIA 1F3DH 2NZ9D 4PPTA 3PDOB 5E6ID 1LDPH 4QRPA 3DXAB 2PN5A 3MJGX 3HMXA 5J12C 2BJMH 4NQCD 3CVHL 3GKZA 4NYLA 2CJUH 2WINB 3MRGB 2E7HA 2AVGA 3OMZA 1FRGH 1IFHH 1U8PB 4JQVC 1L9NA 1QA9B 1S7XB 1UVQA 2EDOA 4HT1H 1JP5A 3C08L 1FZKB 3LB6C 4Z7WE 1P5VA 4PRBA 3RUGE 1F8TL 1P1ZA 3O0RH 1IGJB 4XVJH 1N26A 4JFHE 1E4XH 5C0NC 3MV9B 4H0GA 5IJKC 3BIKA 3F8UB 4JPKH 1Y18A 5BQ7B 4PLJD 3LB6D 1G7PA 4KRPB 4UIKL 4U1JA 1YC7A 5I2IB 2DJUA 3ARDA 4GAJL 1SM3L 1DBAL 3RTQD 1XEDA 4LVHC 4HIEA 1EJOL 4OFKA 1J1OH 4JPIA 1CGUA 4Z95H 5KVEL 4OFPA 3QQ9D 3ZDZF 4LHJB 1F90L 4WV1A 1J5OL 1IM3A 3PWJB 4J3XA 1OGAB 3UPCA 2Q86B 3C6SB 4K23L 5DJ6A 3VXSE 1RHHB 4MJ6A 2XN9A 4X4XB 1A1NA 1Q9OB 4XGZA 3UXFA 1XAUA 1NEZA 1WISA 2IADA 5HGAA 1UXWB 2A74B 1XF3A 4JZJC 3ARGB 2A6KB 3OAUH 1NGYB 2R8SH 1OAUH 4FQHA 2MSPA 4PGDA 2OR9L 1O5DT 5DI8B 4JM2A 1QTYT 5GGUB 3NCBB 2G9HA 4U3CA 4AJ0A 4APQB 4PJGB 5T5NG 5HD8C 1T0MA 4OLWH 4CU7A 2DL9A 2GTWA 2W65A 3DV4B 1CQYA 1BVKB 3QUXB 4L3EA 3HC0B 1R0AH 1Q1JL 5HYQA 5JXEA 3BESR 1P6AB 2H32H 2OQJB 1KFAH 5JXAL 2B5IB 1HN1A 5HD8D 5I76B 2R4SH 3BKMH 2WBWB 3V4UL 3EOBA 3FQWA 4F15C 3GI9H 4LKXB 3GRWH 3RY4A 4UI2A 5L7XH 1M71B 6FABH 3GHBL 1Y0LA 5ANMA 2N7AA 5DT1H 5HVWA 3IDYB 4GRWB 4JRWA 4K3DH 3VGGA 3ZHDA 2HT4C 3MA9L 2P4AB 5DD5H 4G9FA 1DN0A 1NGXA 1YY8B 3EBAA 3VI3E 4MQSB 1IGIL 3V0AC 2V5SA 3GGWA 3MJ7B 4Y5YC 3EO0B 3H9ZA 4XWGH 4Z7UB 5IFHL 3RBSA 2BVEA 4P4RA 5KSVA 3BJLA 5EPMA 4N9GA 1I9EA 3O41B 3ZDXF 3RWCB 4PLOB 3NABL 3SGKA 1AI1L 4GBXB 3CH8A 2I9LA 3LKPA 5EU7E 3Q5YA 4E41D 2HWZH 3RAJL 2B2XH 4YNYA 1LP9B 4FA8A 4JAMA 1WEJL 1R3IL 4HV8A 1HEZB 4M8QA 5LBSL 4L5FL 2O5YH 4PGBB 3Q6GL 2ZUYA 2ILLA 3DYOA 3RWGA 4PJCB 4JY4B 2XFXB 4L8DB 5I19H 5JPMA 4TUOA 2HT3C 4JZOA 4AIOA 4RGMB 5GS2H 1GGCH 3H3BC 3HFML 3K2UH 4K8RD 1QSVA 4U33A 3FQNA 3QZWB 2JB6B 5I74B 3TNNA 5EWIL 3LV3B 3D0LB 4BFIA 1NL0L 4ZXBC 1FH5L 5KAQF 4Y16D 5EZIH 4YUEH 1GZPB 4OUUB 5M94B 3QCTH 1NDGB 1IAOA 4S2SA 4U1NB 3MRIA 5BV7C 1ZWIB 2R2HA 4O51B 1CFTA 4I5BB 4ZXBD 2P5WA 2JCCE 5F9OH 4Q9RL 3TJEL 4PY7A 3T4YA 4K3GA 4Z7OF 4ZUTA 3TCLA 4P4KB 1E4KA 2XXCB 2GIYA 1U8QB 1NCAH 2VXTH 4IMLB 3SDYL 3DSFL 1WZ1H 1VFOA 3LZFL 5I1GL 3VG9C 3BE1L 5F89A 1DVFA 1MCIA 4NRZA 1QFWI 1A6UL 4OLVL 4IRJB 5SWZA 3EYFA 2L7UA 1NAMB 1DP0A 3D39D 4NQEB 1KOAA 2NYYC 4UIMB 4JFYA 4PJIF 4X6FA 2GK0B 3MC0A 3QG6A 1AGCB 4YWGL 4FTVD 4LQFL 3NFSL 2VLMD 2IFGA 2DBLL 1NCDH 4G6FB 5FECB 2L4OA 3DX9B 5E2WH 4MQ7A 3I6LE 4PJXB 5D2LE 1WUNT 5I1HL 4KK8C 4FFZL 3L9RB 5IB2B 3GMRA 1B2WH 4IOFD 4PD4K 4LPTA 4K8RH 1FNAA 3TIDA 3D25B 5DS8A 3O8XB 3FO2B 4M7JH 1CE1H 5DK3A 3QQ3A 5D1QD 1JN6A 1YN6A 1OL0A 4OLZL 4R7DA 4JVWA 3A6CH 4HIJB 4PJ9A 2FJGB 4NO0A 5C08A 4R4BB 3V52L 1H3PL 2N4IA 1J0ZA 4LCCA 3S4SA 1JHKH 4HLZG 2G75B 2MQ0A 2AJ3B 1P4LA 1AE6H 2H41A 3QFJA 4KK6D 2BNRB 4ETQA 3G6AA 1T0NB 2EDRA 1DL7H 4X7SL 2BOCA 2DM2A 1FLRH 4MA7H 4NHCL 3B9EA 5F8RC 1SYSA 3WO4C 5HHPA 1U3HB 4PJFF 1AC6A 1E4WH 5IHUH 3EYVB 1JRHH 2EH7L 1RZGA 4LCWD 1CN4A 5IFAH 2YS4A 2ARJQ 3I6GA 4TULL 4ZAKD 3V95A 3M45A 4WEMB 3ROLA 3F5WA 4QWWC 3ZDZE 2IAMD 1NANH 3PWVB 3JVGA 3MO1A 4PY8I 3I85A 2ZCHL 1A3RH 1Z9LA 4M00A 3WO3B 2FJHA 1AGBA 5C0FB 3ARDC 4Y1AB 1DBBH 4PJ8A 3PQYB 3IXTB 4IRZH 5D7KD 3SY0A 2X9WA 1JNLH 2ZCLL 1P4BL 5D7SH 4WV1C 2Y25A 4JM2F 1BD2D 4CADB 3CMGA 4OD2A 3VFUB 2I9TB 3NCEB 4U0RC 1ZLWH 1K4DB 1EO8H 4ERSL 3MRMA 4KY1L 4QT5A 3RGVD 3GSQA 3DROB 2EXYD 2MHAB 1E4XI 5A2LH 5CJQH 4A2MA 1X5IA 5C0IB 4XNQB 4E41E 3HE7A 1UFUA 4GRLD 2XTJD 3K46A 3CK0L 4LLQA 3MRPA 3MODL 1CD0A 1QLRA 4E5XB 5L8JB 1ZOXA 3QIWB 5DUBB 3D9AH 4JLRB 3NCYP 3MRJA 4PRHA 4OZIA 5IHLB 4JM2C 4JB9H 3K8LA 5HBBA 3HNTL 3AREC 5MENA 2F74A 3V4PL 2APVA 3MLPA 1AD0A 4EDXA 3GBLA 5TH2A 4GW1A 2FO1A 3KLDA 3OKOA 4ZNEA 4UT6H 4YHOH 2DLEA 2YRLA 4B7LA 1FBIL 5GJTL 1FZOB 2Z8WC 3CCHB 1UENA 1T03L 5FCUH 3E6FA 2ITDA 2WBJB 1IGTA 3QJHB 3CH1A 5DRXB 2EYSB 4LCIL 2C1PA 3ARED 5TF1L 3VFRB 3KPSB 2J8UA 1A6WH 2YRPA 1A6ZB 1RJYA 2YUVA 3VFMA 4HH9A 5GZOD 3BW9A 4MX7A 4PS4L 3ZDXE 5F6HI 2EE3A 1U8OB 4AT6A 4MWFB 2H9GB 3D48R 1BLNB 4MA8L 3LKOA 2F9BT 3BPNC 4GLRH 1HQRA 3FFCD 4PV8B 2OK0L 3MOAL 1QBLH 5L8LB 3IFLL 1HXMA 2QQLH 1X5JA 1BQHB 4XNYL 5MERB 3NCJL 4XNMA 4KGLA 1RK0B 1C16B 2VXUH 3ZKQD 2WWKO 3OAYK 2E7CA 1FSKC 1SJEB 1EGJA 3H0TA 3SGKC 1YNKH 1HI6B 3TCXA 5CD3B 2IBZX 3QUYD 1A1OB 2X4TA 1S7RB 1D3CA 5C0RL 2YKLH 3GBNH 5J3HD 5TDOB 5EZOH 1NAKH 1NGWB 1SBSL 3UC0L 3D39E 4FZEH 4K7PX 4GAYA 5EIQA 3T4AA 5C07A 2ADJB 1XIWA 5HYEA 1BX2A 4N0YH 4A2LA 4N1HB 5IMKB 4UQ2B 1A1MB 1ZA6A 5F1NB 4FTVE 1OLLA 5I1AB 2Q8AL 4DFHA 3DXAD 1YEDB 5C0JA 1S7SA 1MCJA 3E3QC 3NVQA 5JA9A 2GT9B 2VLME 3OKKB 2V9TA 4QXGL 4TSAH 1OAKL 3FHAA 5EZLB 4Z7OE 5ADOH 3S96A 5C3LD 3HNVL 1F3RB 5FYKD 1UXSB 1JWUA 5IESL 4MJ5B 1XGYL 3ZKSD 1N6QH 4HDIB 1CK0H 1MAML 2B39A 4NN6C 5BXFA 2AXFA 2CIIA 5ITFB 5ID0A 3OKMA 3QXAB 4YDKH 4U1GC 2O93L 1M6OA 3T09A 1SEQL 3PHOA 3U7WL 4CU8A 3IKKA 2EC8A 4D8PA 3RHWK 4XPAH 3HG1A 3VFGL 4XHQA 2VISA 1AR2A 4BM7A 1MCPL 3B8SA 4N0UB 3K74B 3IFPB 1N3NB 1XCTB 4PRPD 2JJSA 4P2QB 5HGDA 1KJ2A 5EO9A 1TCRA 3U36A 1BVLB 1DQDH 3BIAX 4E42B 2VUYA 4P9HC 5CEXB 5DEGA 1JZ5A 3HI5H 3TPUA 3DTXA 3GDBA 3G6JA 3GJEA 4YHZL 4LCWE 2B4CC 4NQXA 5E5MB 1IAIL 3E6HA 2EO9A 4PYHA 1TVBA 3O6KL 2BX5A 1OGTB 2NY5H 2ZSVA 4YXHH 4JKLA 1SHMA 3IDJA 2APTA 1TQBB 1DSFL 5MEPB 3P4NA 1A2YA 4APQD 3RL2A 4N8PA 1WBXB 4WVRA 4ZS6D 1PW3A 2FWOA 4AEEA 5F1OB 3X12A 3Q48A 4U7SA 4MVBD 2Z8RA 2VWEC 3DSNA 1ZLVH 4XC1L 3WD5H 4Z7WA 4XBPB 3RUGA 4JANA 2IANB 3LQZA 2VLRB 3ES6A 5JW4M 2AJSH 4PJ9C 4J4PD 4L3CB 2ENSA 5FYKH 4PJFE 2DWEA 1G0XA 4KKCD 4JCLA 2Y36L 1MIMH 1ZHBB 3GSNB 3EJZC 2C1OA 5ID1A 1OWWA 3PGCB 3P0YH 5JOFB 1KCSL 2BMKB 3HNSL 1DBJL 4HKJB 2R0LH 5K9JL 1HHIA 4FQJL 3RKDD 2XTJE 3TYGL 4FQIL 4KJPD 1FO0B 1YECH 5T3ZL 3W9DA 2MPAH 4DOHE 3T1FA 5DO2D 4ZPTB 1K8DA 3UJJL 1FHGA 3D3VB 4KJQC 1KGCD 5HJ3A 5T1DH 4GBXD 3CSYB 3I9GL 1A7OH 3VXSA 3EYQD 4KTDL 4ONHB 1IC4H 1LQSR 2YPLD 2J4WL 3TIEA 1UADC 4FQPA 1QRNA 3JVGC 1NLDL 1S9VA 3AU1B 3P4LA 4PR5B 2IPUG 3SKOA 3VFPA 2DM3A 4LK4A 2V2XA 4NNPL 1AQKH 4IRSD 3MUGB 1BQLH 5FIEA 5CINH 1PQZA 4PJ8C 4XI5C 3VXPB 2AJXL 4ALAH 2NTSP 1U93A 3O11A 4DEPC 3IVKA 3THMH 3CZFA 2OS7A 2J2ZA 1C08B 4WTWA 3B4NA 3P4MA 4ZOBA 5EOCJ 3JXAA 3QCVH 1MJ8L 4XMLH 2UWEF 1YNLL 3P11H 3ARBB 5JQ6H 3FFCE 4XI5D 4LHQB 1OAXH 5T1KA 3RZWA 3CNKA 1MCWM 4JFOA 3T65B 3QDJB 1INQA 4AH2B 4JHWH 3IETB 1LE5A 4XCEA 4LVOC 4L4TA 5E08H 2PUQT 4MCZB 5DJ2B 3WN5A 1TQCC 3F7RA 4MYWB 4WHTB 3LDBC 4YBQC 4G42B 1NANI 1KF9B 5D7IA 5C2BH 3HE7C 2UUDH 2XZAL 1RIVL 3IAGC 4LARL 3IYLW 4F7CB 3I2CL 4K2UL 3CFBB 1KIRB 2OLDA 3FQRB 4NWUL 5DD1H 3VFNA 4HEPG 5DGQA 3MLSH 4BK5A 3VE0B 5FHAL 4YBQD 5DLMH 4LVNC 2OI9C 3KYKH 5DRWA 2HFEA 1JGEA 2ZOLA 1OAQL 1X5FA 1GHFL 3OL2A 4AL8H 3DXAE 4GRWH 1FIGL 3HS0A 2R2BA 4KZDL 2ZP0T 3KS0J 1WIOA 2YD8A 1LVEA 1AY1L 2EEDA 2D0HA 4XPFH 3WIFA 1CLCA 2CSPA 3O45A 3MLWL 5EO1B 4MD5B 1YEIH 4KFZC 5FYKE 4MJIA 3S37X 4CVZA 4JFPB 3HPJA 5DHVB 5TQ2L 1MPAH 5ACLA 2V2TB 3MV9E 2OTUA 5E9DA 1MJUH 4IJ3C 4MNQB 3SKNA 1P6FA 1J8KA 2EDKA 4QRRD 1OSZA 1QFWM 2X89D 1G7JA 3PWUA 1HDMA 5E4EB 4YBHA 3WFBL 3V5HB 5HVHC 4R2GD 3BZ4A 3DRTA 4KWUA 5CWSA 1OP5H 1OD7A 1HHGB 3NFPB 4ORGB 4PRPE 4I3RH 4OI8A 4BSVB 4N8VG 2NW2A 4R7NA 4AEHL 3RI5K 1DEEA 1BOGB 2EDLA 5E99L 2LVCA 4ODXB 3V4VL 5HGHB 4JDVA 2ATKB 1CDJA 4BZ2L 4DWHA 3G5YA 4R97B 4X6DB 3RVXD 1T20A 1WC7A 5I66B 4WI8A 4IM8A 2FL5A 1FFPB 1QBML 4LP5A 5GRYA 3ZO0A 5F3BB 3UTTD 3ALPA 3H3PH 2P5EB 1FJ1A 4PRAA 5E6IA 5LGHH 3GSVB 1KB9K 3ROOB 4F9PA 4JZNA 1B88A 3QDMD 5IM7B 4JGJA 3FT3B 4HZLB 4YHLH 1PDKA 1T22A 4JKPH 4LSPL 4DN4H 4ZUSB 1I8LA 1S5IL 2AV1B 5F8QC 3I6KB 1G6VK 4BA8A 1KNOB<