1CO1A

Fold of the cbfa
Total Genus 15
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
15
sequence length
115
structure length
115
Chain Sequence
b'ELVRTDSPNFLCSVLPTHWRCNKTLPIAFKVVALGDVPDGTLVTVMAGNDENYSAELRNATAAMKNQVARFNDLRFVGRSGRGKSFTLTITVFTNPPQVATYHRAIKITVDGPRE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords CORE BINDING FACTOR ALPHA
publication title The Ig fold of the core binding factor alpha Runt domain is a member of a family of structurally and functionally related Ig-fold DNA-binding domains.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Gene regulation
total genus 15
structure length 115
sequence length 115
ec nomenclature
pdb deposition date 1999-05-31
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.720 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 1co1A00
3Q01A 4IBWA 1E50A 3VD0A 4IBUA 4AGLA 2J1XA 3IGKA 1KZYA 5ABAA 3WU1A 2WGXA 2J1WA 3D06A 2J6WA 2PCXA 3WTVA 2BIOA 3EXJA 4LO9A 2H1LM 1T4WA 2AHIA 2YBGA 5AB9A 3VD2A 1YCSA 4XR8C 2OCJA 1UOLA 1LJMA 3KZ8A 3VD1A 4L18A 5G4NA 2MEJB 2X0UA 2IOOA 5AOIA 5LGYA 3EXLA 5BUAA 2X0WA 1EAQA 5A7BA 2IOIA 4MZRA 2XWCA 1TUPA 4LOFA 3QYNA 3D08A 2X0VA 4A63A 2AC0A 2J20A 1H9DA 4L0YA 5AOMA 1CO1A 3IGLA 4GUOA 5AOLA 5KBDA 2BINA 4AGNA 4AGOA 5AOKA 4KVPA 2IOMA 4AGPA 4IBYA 1EAOA 5G4OA 3Q06A 4IBVA 4GUQA 5AOJA 4QO1B 3TS8A 4IBQA 3QYMA 1IO4C 3WTWA 4IJTA 1TSRA 2P52A 3WTTA 1HJCA 1EANA 1GZHA 2VUKA 2ATAA 2GEQA 5G4MA 4G82A 3KMDA 2BIMA 2J1YA 3D09A 4L0ZA 3US1A 4IBZA 2XWRA 4AGMA 3Q05A 3WTSA 3WTUA 2J1ZA 4IBSA 5LAPA 4IBTA 2BIPA 2FEJA 3ZMEA 2RMNA 4G83A 3US0A 4MZIA 4AGQA 1HU8A 5ECGA 2J21A 3WTYA 2ADYA 1GZHC 1HJBC 2BIQA 3WTXA 4HJEA 3D0AA 3D05A 1CMOA 4LOEA 3D07A
chains in the Genus database with same CATH superfamily
4G7RB 2RALA 1BOGA 4G9FD 3KPMB 4JREB 3Q0HA 1MCBA 3BHBA 1IJ9A 2KPWA 1Q0YL 2QVKA 3VU1A 1N10A 4JCWA 2F54D 1T6BX 2ZX7A 3FCSA 2EDXA 1MHEA 3CXDH 4LESA 5D4IA 3EJRA 4L8SC 3QZLA 1J11A 3POHA 3VSUA 4ZUTA 2VZOA 4JFVA 4JDEA 4HT1L 4D3CL 5L9DH 2IH3B 3ES6B 1MCWW 1F4XH 1R34A 5AVZB 1J0JA 2Y7OA 1TLMA 1F2QA 3IFPB 3Q48A 3M88A 1H9VA 2H6PB 3I9GL 3OVUB 5FA4A 5IKCA 4OCYH 1ZANL 1V10A 4KZEH 1P1ZA 4D9QD 2A6IB 4PJHF 2B77A 3AY4C 4XVJL 2JJVA 4HCGA 4ICWA 1ID5I 5E8PA 4OFDA 4BUGA 4HXAL 25C8H 1G7HB 1U30A 4U1HB 4JFDA 4FKHA 1PX3A 1UFGA 1I9RL 4ZX3A 2VXTH 5F6IB 2ZCZA 4OZIB 4IDJH 3NG5A 4Y5XC 1ADQH 3DOSA 1WFIA 4IRSC 4PJCB 1MDAA 3U36A 1FZJB 1I3GH 1ULVA 3MROA 1T04B 5FO9A 3QNZA 4R4NC 1KPUB 3HS9A 4K7FB 3U4AA 4L8SA 3MUY1 1UZ8A 3HAEH 3QPQC 1NQBA 4HW6A 3S3DB 1T89A 3AQZA 2B4CC 4KUCD 1IC0A 4GSUA 3HZVA 3SBRA 1U33A 2Y7QB 3BZ4B 1C5DB 1TQVA 1NM4A 4E41A 3P0YH 4RWHA 2BWDA 3GRBA 2EEBA 3BSGA 2WYHA 3NH7H 1NCAH 4MJJA 3AY4A 3MRBB 1PLBA 2FSDA 1VEPA 2VLMD 1UXWA 4U33A 4P3CH 4PBXA 3C9NA 2CJTA 4TNGA 4ODSL 4FMKA 4RISH 2GSIB 1NMBH 2YD9A 4Z3FA 1CGSL 1DDHA 4LK4A 4PJIA 4Y5XA 1ZLSH 1U8NB 4ES9A 4Q8BA 3M86A 3RHWK 3VSVA 2DLIA 2ESVE 2EH7L 2YAPA 4PGZA 3PDDA 3DHJA 2ZUWA 3ULUC 4GSDH 1E5YA 3BX7C 3HC3L 3UTSD 5KS9A 2ZKXA 4LKXB 1J1OH 5E08H 1NC2D 4QRRE 4AM0A 3MX0B 4I9XA 2MNUA 5CJBA 3BN9D 4P2RA 5D1XA 2F7RA 3MU3A 3QCVL 1JHTB 4GAJL 3L3IB 2J1WA 2B39A 1YYMH 4KKBC 2DIEA 1A7PL 1Z7JA 2AXHA 4U7KA 4UM8B 4F2MA 4FA7B 1YNTB 4FA8A 3QO1A 3SPVB 5CNHA 1MFAH 1R3IH 4F8QA 2D3VA 1WZ1L 2XYCA 4GRLC 4JFWA 2QFPA 4AUJA 4A68A 4N1EA 4ZAKB 1IFHL 1G7JB 3BISA 3IFLH 4Z7WF 3W56A 1CBVH 3VD1A 4PJEB 2E3VA 1U91B 3AU0A 4HUUA 3OB0H 4LBEB 2ZUTA 5IBLD 1OY3B 4OGYH 2J4WL 1W9XA 1TKWB 1L0YA 4OGAD 3S88H 2YEZA 1SDYA 2YUWA 4P57A 3QZNA 4OGXL 3WG7B 4Y2DA 5E6ID 2CWRA 5I8OL 5HI5D 2IDUA 4NQXB 5BNXD 5SX5H 1J87A 4TVSa 2O6PA 1X6NA 3PQYA 2VISB 2GK0A 2R39A 4FADA 1OEZW 3DTXA 4J3TA 5GS3A 4FZ8L 4HBCL 5I26A 5GS2H 2NY5L 1KYOJ 4AT6A 2CUMA 1MUJB 1UADC 3AACA 5BV7C 1MCLA 1IGMH 2EJ1A 3V0WL 3QNFA 5JHLH 3WSQL 1F4YL 4FFYA 1CTMA 3VWKC 4ATWA 4MMZA 3ORJA 1ECYA 4ZX4A 2LLNA 5FB8A 4DOHB 4JKWA 2WLLA 3PWLB 5IMKB 2HFEB 3BGAA 2CO3A 2X4SA 1SOQA 3UG5A 3IVKB 3HI6H 1TQSA 2BVTA 1D5ZB 1HS6A 4UV7L 4NO3A 4YHLL 3S9DB 5HYSA 4EQ2A 1KJ2L 4HAFA 4MDJB 3MGTA 4O5LL 1GKOA 4MXWL 3VRLE 2C5DC 3F7KA 2R56L 3V5KB 1S9VB 1OAUH 3IXAB 5HHVH 5KSUA 3QE5A 4UUJB 2ZP8A 3IPBA 5DMKB 4DUVA 2GJJA 2JF1A 3FU7B 5DD5H 3GGWB 5EF0A 5TDPA 1EH9A 3DKHA 5C7XH 1IKFH 3CZKA 2XZAL 1SBSH 1U8CB 3CH1A 3X3GH 2YK1H 3QDJB 4PJFB 4A7UA 3LZNA 4X4KA 3LIUA 1RZJH 4PG9A 1CFSB 2E8YA 3IDNA 1OD7A 1JZ3A 1SUJA 3CFMA 3RFZB 3D85B 2PKDA 3CPLA 3VXSA 1MXGA 4W6XB 3T2LA 3W81A 1BAFL 3FQTB 1K8IB 1X5AA 3GTNA 1CMOA 3VWKA 5CUSH 1VGEH 3G6AB 4LSQL 2AQ3A 1IX2A 3L9RA 1NCBH 3B9EA 3KXFD 1DBJL 3HZ3A 2R9HC 1KZYA 2VITB 5FYKH 3IE9A 3MKGA 2H9GB 4FMFA 1EXGA 4JRYB 4WWID 5HHMB 3WFEL 5F96L 3DX7A 4KY2A 4NQCD 5T33H 4BSWB 3QRBA 4EVNB 3WHE1 1MFMA 3KPSB 4C4KO 2ZOUA 2C9SA 5TDNA 3G5XA 1WG3A 1YEKH 2FYYB 3F12B 2Y3AA 5JIPA 2M8XA 4W9IC 3X12B 1GW0A 4KFMA 2UZYA 3B2PA 1XL6A 3O4LA 3ARPA 3GSXB 4I0KA 1Q4NX 1TDQA 4FQCL 1XF3A 5D8JL 1YEEH 2APSA 4FCHA 1JWMB 2QSQA 4EUPB 2DLTA 5IMMA 4KRPB 4X7EC 5DUPH 1FGNL 4RX4A 4RZKA 3N06B 5JDSB 2XWJB 2B4CL 4G5ZL 4QRQB 1JTTA 1OGAA 1AANA 2XA8L 5BJTB 1CDJA 3BPNB 1RUML 1RP9A 1DE4B 1PX8A 4DH2A 1YEGL 2LTQC 3LEYH 2MNJB 4P5KB 5KUKA 5L2KB 4HIQA 4GLRH 4PJXE 4OU3A 1U93B 5D7LB 2E7MA 4M8QB 1D5BB 2E6PA 3EBIA 4HKJB 4ODUA 4YPGB 2X05A 3SDXA 2BHYA 3FUNA 1Y1DA 4GY4A 4JMXA 1IU1A 4R5VA 3P9MB 4MS8D 4MDIA 3ZL4H 3EYQC 5GRUL 1UJTA 3V4PA 2CDFA 3QXAB 3FJTA 5A2LH 2DB8A 3ILQC 4JM4L 1I1YA 1RPQA 1U3HD 2WAQA 3FAXA 3HPJA 4EZMA 1INEH 2GEQA 3GXUB 1K5NA 3JV0A 3QORD 4JW3A 3ZE1F 4UYQA 4WK2B 1O7DC 3QIWB 4I9WD 3VFGH 4P48A 3B3IA 3CXHK 1QFPA 3OZ9H 4O02H 1LP9E 4AGMA 3ZIMA 3Q44A 5C0ND 4CVZA 1P6FA 1I7ZA 3EJQA 8PAZA 2X2UA 5CEXB 4AVHA 4HUWA 1I3RB 2AK4A 2Y7SA 3M1BB 2FR4A 5ACMA 2P8MB 4PS7A 1CGWA 1XD0A 4I0PD 3ME0B 2OXHB 3HZYB 1C12A 2DJ4A 3K6OA 4HJJH 5IJVA 2ERJC 3AITA 4TTGA 1KB5B 1KG0B 1NOFA 3SDDB 1YJDH 4XX1E 2O26U 2R7EB 4LB8A 5ITFB 3G6JE 3QR1A 5E7FA 3U1SL 3DUUA 1YEHL 1OTTC 3IDXL 4B3VA 3LZQA 3AG4B 1QFWH 1NAMB 3V7AG 1V27A 1RIUH 3NP3A 3RIFF 5IMOA 3ZU8A 4PB9H 4ZYKA 2A9MH 1J0IA 3OHXC 1B88A 4LLDB 5IFJA 1KSRA 1E5AA 3GJEA 3IETB 5JHDE 2W65B 3EXJA 4AY0A 2DWEA 4AUUA 2E9BA 2X44D 5I76A 4DN4L 1U2HA 5JIHA 4HPOH 2O6EA 4S1DC 1YQ2A 4TNEA 3V6BR 1NTDA 5BV7L 2APXA 2NY2D 1KCVL 3GSQA 1A5FL 2W0PA 3KJ6L 4L37A 1YEWA 3A23A 3MXVH 4Y16D 4P2CG 1LWRA 2P5WA 2E74C 2HG5A 2WQXA 3MGOB 4HIHA 4XMPH 3WLBA 4XI5C 3U0PB 5I16B 4M03A 4FYTA 3FC8A 2WNXA 3ZGIA 4PJ7F 5T3XH 2IAMC 1QI5A 3RY6C 3FTGA 1BD2E 4X6BA 2NUTA 3CDCA 3LS5L 1H3UA 4LVNB 4WF7A 3H6JA 2MOQA 4Z7IA 3TX4A 1UYWH 4M5SA 4B7LA 5I18H 3FKUS 5JW4Q 5HYJD 2P47B 3VGDA 2PXYB 2NNRA 4N24A 1LK2A 2E86A 1IM9A 3ZDYE 4KKLC 4M9PA 3AUWB 3GQFA 3KWUA 2RIKA 2OW7A 3MRDB 4IKKA 5HPMB 3IDJB 4KK9D 2BSCA 1FL6B 2ZWKA 4KPHH 2H6UA 4MWFB 5EOQH 5HI4C 3W9DA 4W9ZA 4OF7A 3L5XL 4LEOB 1A64A 5CHNA 5DEGA 4O2CB 4IU3A 5IBTH 2JB5H 2JK5A 4AIEA 1AZCA 3GJFH 4ZS7L 3ZE2E 1GGBH 4IBZA 1AO7A 3RL2A 3VW3H 7PCYA 3T0BA 1N67A 4UM9A 4DKEH 4MHHI 2OX5A 1CLOL 5HDBF 1LEIA 1XEDA 1NCTA 4XCEA 4XMVA 2EEFA 1IGIL 2DQDH 3C6LC 3RY6A 2DYPD 5F2FA 5IVXE 3SO5A 4J3XA 3OKNB 5K59E 1BF8A 3RIAK 3EH5B 3MRCA 5D7JC 3AREB 1BXXA 1SEBA 5CU5A 5DK0A 2OJEB 3D07A 1N6UA 2Q20A 1AMXA 1IAKB 1AI1H 5EU5A 4GRWE 3FT0A 5FW7A 2VABB 3QUHA 4GG6A 1FVCB 1HYSD 3BP4A 3FN0L 3TA3D 2YPLB 1B0RA 4JHZA 2B1AL 4NAQA 4Y88A 4L8BB 4A6YB 4KTDL 2NY0B 5BS0B 3O11B 5CJOL 5I8EB 3WTVA 1JHKL 1F11B 4G8GB 4NUGH 4LLYB 4PJDE 3UMNA 5MI0C 4A2HA 3MA9H 4LLVB 5D6DA 5EUOE 2JIXD 5FO7B 5EU7C 5I0XA 3BUPA 4YLQT 4YXHH 2DQFA 3VD2A 2VLLB 3HR5A 3GMNA 4ISVB 2IDSA 5CP7A 4N0FA 2CDGA 1LJMA 2VLRB 2X12A 3Q8EA 4R6UA 3RKDD 3V5DA 2A6JA 5D7IE 1DJSA 2DEWX 5JNYA 4KHXL 2Z91A 1RFDH 5DA0B 3THMH 5ICXB 3HBQA 2AJXL 3C6LA 1JL8A 1UD6A 1WBXA 2BNQB 5F9DC 2AXGB 4D0CA 4EKXA 1J8HD 3PAUA 5LNDA 2A4CA 1PY0A 4O58L 2R0WL 2QLVB 1PZ2A 1RPKA 2G3MA 3P3SA 4QD2E 5IB5A 1MN4A 1I1AB 1GYUA 4ORGA 5D7JA 1NBYA 3RA7H 2AGJH 3FCGA 1ZV5A 2VAAA 4RSYA 1YYLH 3RVXD 1K6QL 1QA9A 1EJOH 3V0VA 1UVQA 2PO6D 1JXGA 2JCCE 3TBWA 4DFHA 2WK2A 3ARDC 2XG5B 3TT1L 3MJ9A 2DLHA 3HC4H 4V1DD 1BPLB 1JZ5A 4FI6A 5INCB 2AQTA 3HPLA 1XEUA 2C3XA 1UUSA 2DWSA 2GTZA 4LFHD 2BNRD 5IW6A 4MA7L 1R24B 5E8NB 4DKFL 2VIRB 3MV9E 2NZ9C 3GSNL 3MTRA 3PF2A 3KWWA 3ZL2A 4B41A 4KV5F 4K94C 4NM4H 3VXOB 5AUMA 1CVRA 4WUKL 1KBBA 1MEXH 1AGEA 1B0WA 4I3SH 1KCBA 4NZRH 4OQTL 4TULL 3KPOB 2K8MA 3GTTA 4HH9B 3GI8L 1ETZA 4YHOH 2C9VA 4YHPB 3LKNB 1BVLB 5SV4A 1D5IH 2X1XR 35C8L 3Q05A 3DTUB 3I50L 2DI9A 4Y2LA 3E6HA 2FUTA 5DMGD 3OSVA 3QUXB 1K3ZA 4Z0BH 1U8OA 3BUTA 5SWZB 3GSWB 3MUGB 3TYGH 2GBAA 5I1EL 2GBTA 3ARDA 4MNHB 4K3EL 3GPSA 4KQ3H 3MJ7B 4K7PH 5FS5A 1QAWA 4WFHE 5TPWL 2HJLB 4N2EA 4YE4L 3WTYA 2VR6A 4NT6B 5F3FA 4QRUA 3QC5X 2P9RA 2FE0A 2HUEA 4OZGF 3OGCB 5AW2B 3VB8A 4HK0A 3UP6A 4JVWA 1IAIM 2YARA 3SJVE 3DJ9A 1I85C 5CIPA 2Q6WA 3QA3B 4GKZA 1OSZB 3NJLA 2XTJE 4TSCH 4UINL 4LSDA 1ZLUH 3U4BH 3MACL 1SXCA 4WI2A 1VENA 1X7SA 2AQQA 2ATKA 2BERA 3AG2B 3K0YA 3ZTJG 5IB2B 3FUEA 4WWKC 3QUMB 3SKJL 1UXSB 3QWOA 5D1ZC 3W5MA 2J3SA 1CC3A 1A9BB 2WQAA 1Q9LA 3RVTD 4Z3JA 1W72H 4UZSA 2BC4A 2FLMA 32C2B 5EFIB 4XXWC 3LNEA 3I6KB 4CC1A 3VYOA 1SF3A 2J57A 5IT2H 4P2OC 1YEDB 2CA3A 5CP3H 3QCUL 3G5YB 1EFXD 1M57B 2X0VA 3SD2A 5IEHB 3DVNA 3KL0A 3FQNB 5ALBH 2J12B 2BFVL 4EN3D 1N6VA 2FHFA 4DZBB 4Z7OE 1F1AA 3VAEA 4P9ML 1Y1UA 3R19A 1PAMA 4FQ1L 4NIYE 1QUNA 4D0BB 4ELMA 2OS7A 3BPCA 2B14A 2VLJD 1I85A 5K5YA 4Z1PA 1RZPA 1U58B 5FHBH 5DU7A 2AAAA 1C5BH 1SMOA 3HRZB 4XN9A 5DGRA 5MP6H 3VH8B 4OM0H 4IBVA 4M4PA 2YRBA 5FM4A 5CO1A 1A9VA 5FFOA 4G42B 4S0HA 2OMUB 2X4NA 4YHNA 3PFQA 1Z0NA 4A7QA 4WHYH 4X6EB 2XQ0A 2A9NH 4G1MA 1S7VA 4HWEL 3OKOB 3K5RA 1I8MB 2Z31D 3CC5A 2E7HA 1LO0H 2A6KB 2GIMA 3K2KA 4GH7B 2XPGA 3WUWA 4J28A 2FL5A 3T6ZA 5GS1A 4LSPL 1J5OL 3MRGB 3V6FB 2Z92B 5ILTH 2OMVB 4L8DA 4XXWA 3RJDA 1A7BA 2XTLA 2NW2B 5AW0B 1KTBA 4DZ8A 2JMRA 3D2TA 1C16B 5C0FA 4E0RA 3MJ9L 1A1MA 1RJYB 1ET8A 2ROXA 1CLZH 4P2OA 2WKGA 5LDSA 1G9MC 1AHKA 2E47A 2CJUL 1M2OA 3UPRB 1ZSDB 4EJ1C 1PLGH 2YD5A 4OF8A 3AB0C 3IFNL 3N44B 4HKXA 3T1FB 4FLQA 3IMUA 2W0KA 4FXLA 3HG5A 3S2CA 3LMJH 4UOZA 1KN4H 2Y2WA 4EXKA 3D9AH 4KKZA 3GD1C 3SDXF 3L5HA 5HHOA 1EZVY 1FN4A 4QLRA 3UP1A 1PFCA 3WE1A 1GZHC 2C3WA 4HPYL 4KDTC 5K1NA 2EUXA 1WBZA 4FQLH 3LNHA 2NR6D 5KSAD 3O6ML 4H8HA 4Q2ZA 4CDHA 3LZFH 5C71A 4UDUB 5ENWA 5I9QC 1NZRA 2VMCA 4RMBA 3ULSB 4LASH 3ARRA 3WNLA 3KR3L 2WVTA 4B9ZA 4OD2A 2I9LB 4AQEA 3KGUA 4AQ1C 1ES0A 5IHHA 3HNVL 4KI5C 2ZKHH 4L4TE 5T1MA 1EWHA 4H20L 3C09B 4H1LH 5C08E 1J8RA 4G8FA 4QYAA 5DS1A 2XQYA 3F01A 5TFSH 2VXVL 1R3HB 1NGQL 3LB6D 3JWNH 2K8QA 5D5ME 2FUQA 4OJAA 4PLKD 1NIFA 1UQSA 2NY6C 3OX8A 3FU3A 3ESOA 5EORL 5IMLA 4CU6A 3LDBB 3TBTA 4JZNB 3SKMA 1MCCA 3GMPA 1S8DB 3L5WA 2CR3A 1DUYA 2P8LA 1P4BL 2GY5A 4JFEB 5L4IA 2AXWA 5AW4B 3UC0L 3VH8G 1YDPA 3FPYA 4ZO6A 1NFIA 3VCLA 4KDTA 3F6JA 5CZVL 5B3JF 4R83A 3B7YA 1GTNA 4PSRA 3CU7A 4JFQB 5BO0D 2BINA 4ONHA 3HC0A 2FH8A 3K6FA 4M43L 3FU5A 5I30H 4JCMA 1N3NB 4XNDA 1ZHKA 5I23A 1BMWA 1XH2A 3VXNB 3ZIYA 1N7MH 4BZ2A 2D3JA 3FONA 3K80A 5F1NB 1IQWH 1I4FA 1U9KA 2BVOB 2OP4H 1JRHH 4HGKC 4QPEA 5HDOA 1M53A 5D71H 3L4ZA 2NNXA 1ONQB 1A4JB 3FT4A 4KJWC 3Q8CA 3O2DA 3HOGA 2NXZC 3KYNB 5KSBB 1MJ7H 4WW2B 2ICWB 3FB5B 1PIFA 5ISZB 5E4IA 3F7VA 1KV7A 2G5UA 2I60H 4G9DA 4PB0H 5D72H 4Y1AA 4OCXH 4NO0B 4NP4L 4XZUA 5EO9B 1KTDB 1T7VA 3BVNA 4QWWC 4FJZA 1PYWB 1Z3GL 3EYOB 3BZFA 1I3VA 4OFKA 3GUTA 3H9HA 3GXIA 3V5HB 1MWAA 5IESH 5FDYA 4CSZA 2P5EB 3PGDA 4HKZA 1L9NA 4N2CA 4I2XB 2KC0A 4NQVA 3C5XA 3MFGB 3QUZB 1OAYH 1N2RB 5DLLA 3ESMA 4I77H 1W0WA 4WO4D 1OARL 3NFPB 1MFDL 2APFA 4WEBH 2W91A 4MBOA 2WUBH 2Z7ZA 1V3LA 3BOVA 3SN6N 1EO5A 3ARFC 3VFOB 2NQCA 2WM0A 3FCUB 3EZJB 2WTOA 4P5SA 3LIZL 3OLGA 2APBA 4Y5VA 5LAXA 2FBOJ 2IQ9H 2DIAA 3AG1B 3BC9A 4OUUA 5FAAA 3VGAC 2CO1A 5FGCB 4NSKA 2P3YA 3HEIB 2J1XA 4NJAH 3T2NL 3HI5L 3MRKA 4X7TA 4R4BA 3SE9H 4NI3A 1I1CA 2QQLL 2Z35B 4PV8A 1ML0A 1DANU 1A65A 2V2XA 5AAMA 4OSUH 3P11H 2YC1A 1A2YB 2HSIA 4H0IA 4DGWC 4MLIA 5KBMA 1BECA 3DARA 4AZ8A 4HHGA 4LGSB 4L3FA 4HKBA 4J3OF 2QADD 1QRNE 3U0TA 4AYBA 3DV6A 3B2XA 4MJ6B 3HMXA 4YR6B 1O75A 5IVOA 2Y22A 2Y3NA 1J88A 4G6FB 2CUAA 2OMYA 3QUKB 4G7YL 2ZTBA 3CQQA 3G08A 5EN2B 5FYLH 5GSVB 5DWUL 3DRQA 4IRZH 1RULL 2OL3A 4N2HA 5LBSH 4UZGA 1H3VA 1MREH 3OKEB 4GG6F 4XHJC 2ZYIA 5HVGB 4X98A 3BKJH 4AMKH 4CA4A 2MCPH 2EO9A 4KITB 4QTHB 3GLAA 1EAOA 1YQVL 1ZHNA 3QC6X 1EUTA 4P3WA 2F5BL 4TTDC 3NPZB 4YUEL 5KVGE 3NSXA 2VXUL 1AXSB 4M29A 3L7EB 1U2YA 4LSVH 4LCWE 2KERA 4KQ4H 1TSRA 1YMME 3VDAA 5GRYA 5DRWB 4HJUA 5D7SH 3F04A 4N2FA 43CAB 5D4JA 1X5MA 3NN8B 1S3KL 2FX9H 4H4NA 1QQDA 1T2QL 3L1EA 4RETB 5EC2A 1ZKAA 5HYFA 4IOIA 4E9RA 1QFUL 4XP5H 3SCMC 2YAQA 1NUGA 2EACA 3I9PA 4GLRI 2CKBL 4EIZC 2X4UA 1E4WL 2PCPB 1F86A 3AWGA 4DETA 3K72A 1X7TA 1OAXH 2J1ZA 3LV3B 4LCUA 1EV2E 4PJAA 1K9TA 3KYMA 4NXKA 5E99L 3ZT5A 4ETQB 4L29A 2HX9A 3MREB 5GGUA 4L4VD 3LKOB 2CJSA 3KPSD 5GZNA 1ADQA 5IK3A 3GO1L 4XN5A 2JTDA 4LRNL 4N5UA 5EIIB 1KPRA 2IANE 4EDWL 2VDQH 3I6SA 1B4LA 3P73A 4ZFZA 4ZMTA 4WFFD 1G5AA 1KGIA 3LX9A 2NLJA 4NM8H 4BK8A 2I07B 1SQ2N 4KHTH 3RPBA 1UWEH 1E6JH 4TKWA 4YZFF 3HMWH 1Z9SB 1GIGH 2VLKE 2D73A 2XG4B 5MEOB 3QQ4B 3MLVL 1QX1A 3HAEA 1E9QB 2ZF9A 4KRPD 1LEKB 3CIAA 4F1ZA 2X4RA 2VXSH 4OCLC 4XE5B 4M00A 1F58H 4FQIH 4LU5L 3GSVB 4PW9A 5DYOA 1BFVH 1MVFA 2EDDA 4QXGH 3QUYC 4NQEA 5IEKB 3BKMH 4KC3B 3M8OH 3PIQA 3QFGA 5FKAB 5KSVB 5K9QG 1O9VA 4GI6A 2IBZY 1WFMA 5LLIC 1FHNA 1BVOA 1NFDF 1ZA6A 2V5MA 1HILA 1QWHA 4BIKA 2D03H 3HE6C 2KYIA 4Z7NB 1EXUB 1LO4L 1IGYB 3EGDB 2F68X 3RTQD 3RWEB 3UEZA 3VFNA 1EO7A 3BW9B 2WBJC 3JTTB 1H6FA 1G7QB 2NSMA 3QHFL 4PVNA 3F62A 2FQGA 4RCAA 5HP5A 4JRXA 5KTEH 2FJFA 3WMQA 1QFWI 2HZHA 4K5PA 3CFBB 2QKIC 4UI2A 2IO5A 2FGZA 3ZDZE 1D2OA 2A6DA 4X7FC 3T5WA 5HHQB 4MCMA 2IPKA 4AJYV 5BUGA 3VG9B 5KVFE 5AZEL 4G1EB 3EBGA 2QDVA 2EIJB 1QSFA 2A7BA 2XKSA 3QIWD 5BUPA 4H0LC 1NGZB 3OXRA 4QT5B 5BRZE 3QHZH 2J8UB 4HOXA 4NCC1 4N26A 5DK3A 4YL9A 4N8VB 3SQOL 3V0IA 5F71A 2ZQKA 5TQ0H 3H9SE 3V9FA 3DO7A 3BH8B 3LSOA 3HHSA 3RVUC 4HQQH 3UO1H 4KJQD 4DSYA 3RGVC 3QUYA 3QRFM 5MEQB 3RNKB 1U3NA 2Y6SD 3HMXL 7CGTA 4Y19A 3SIKA 5C6TL 3PWPB 1DJZA 5DJDB 3UTTA 5DVKA 4ZQKB 1QNIA 4NKIH 4N2GA 3RWJA 1SEQH 3SYQA 1BF2A 2CO2A 2ZOKA 3KLDA 3SDDD 4IEFA 2V2WB 1FFNA 3HE6A 3PE9A 4TQPA 3VG0L 3K8KA 2SEBB 2Y69B 5LCVA 4Q4IA 4Z77A 5T1JA 2WIIA 1NINA 1V8HA 2WBJA 3EG9B 1JF1B 2QZQA 1MCEA 5EIIG 5B38A 1NMAL 2QKIA 3UAJC 4FXTA 2Y25A 1ZV9A 3VD7A 4JDVB 2YN5A 4PSPA 4JVPA 1HWGB 2J88H 4DCQB 1CDIA 3K6IA 4IHOB 1EJ6A 4LARL 3V6ZB 4U2YA 5I6MA 1NUNB 3RU8L 1KGCE 2HJKA 4XPTL 3X3FH 2J21A 5I6XB 4YIQB 2XVLA 1EDHA 2NTFA 2JQMA 4HV8B 3H0TB 4ZMPA 4QRPE 1L7TL 5IV2B 2R1WB 4JY5H 3PDOB 2OZ4A 4RZCA 2X3CA 4PRBA 5HJBA 3OPZL 2X9WA 2YKKA 3W3BA 4BE5A 5FHAH 4UIMA 2D4DA 4HCFA 5IROA 5ACLA 4KMTH 1SM3L 2X4TB 5A6MA 3DI3B 2H2PC 4CGTA 2R0LH 3MRQA 3QDGE 1AQ8A 1ZIBA 3N40F 3PP4H 4MAYB 2L7JA 3DK2A 2X2HA 2Z64C 3QDMA 1B2WH 3W2DL 1ADQL 2WN3A 1KC5L 1IEAB 2MQGA 3UAJA 5EO0B 5FPIA 3RZCB 1FJ1A 4QOKD 1XFPA 2ZOLB 4B6ZA 5I1JH 4OQ1A 2NY4D 1UT2A 3BCDA 2PXYD 5D1QC 3IM1A 4XX5A 3ZYJA 3D2UB 2OPCA 4WHCA 1GZPB 4HJ0D 4N8VG 3B2MA 4XC3H 3Q9QA 4K8RC 4W1TA 3DYPA 5DFVD 3DMMB 5DHVH 2BH0A 2J20A 3CD4A 4G11A 3LHAA 3SGKC 3L3OB 3TTSA 1A6VL 2X38A 5I1DA 3A4AA 3VGBA 3B9KD 1KCKA 3P0YL 4LHUA 3CDGB 1VFAB 1NM9A 1P53A 3MODL 4Z7VE 5T3ZE 3R06A 2Q86A 1NCAL 4X7CC 3B2UC 3PHAA 2IALB 4P3CL 3V0GA 3GTVA 3JWOC 3O3BB 3VXUD 2C34A 3LJ3A 3IAQA 3F64A 2D31B 1N5AA 2ZP0T 3GSOB 4QXUL 5DFAA 1F45A 4L9LB 1PLCA 2CO6A 1TJHL 1UA3A 4WLCA 4XVTL 4ZODA 3EJYC 4W9KC 3RY5A 3TZVC 2ICEB 4XPBL 3IMBA 4X5LA 1JK9A 3C87A 3BIKA 4JAMA 1Q1JL 4H5SA 3NSJA 4MGXA 4NBYB 5D7KE 2QHLA 4ZX5A 3ULVC 1BLNB 2BVQB 4C83A 5C1MB 1YAIA 1L9RA 2F1AA 1GZQA 2H5UA 1TFPA 4P4KC 2Y5EA 1B2YA 1F6AB 5T1KD 2YPLD 4NPYA 2H26B 3CC1A 1I1FB 2XU9A 3FYIB 1CR9H 3O8XC 4JM2A 4MRCA 4XNQA 1AZZC 4PJ8B 5BS0D 4G8GD 4XBEH 5BZWA 3KPRA 4BWUA 1PZSA 3BPLB 3H2PA 4PI2A 4X42A 5G5DA 1OAKH 3QJHA 4XPAH 3UYRL 4NLHA 1VACA 2WBWB 4DEPB 4ZZKA 3ZHNA 1BG1A 1JNLL 2WXGA 5M95B 2AJZA 3B7TA 4MJHA 2FO8A 4EIGB 4APQC 1F4WH 2ENSA 2X7LA 1J48A 5LCVL 5B7MA 2CLRB 5D2NC 5I2IA 1ZS2A 4BFRA 3AT8A 3BVTA 1P5VA 1KJMB 2BNQD 2YHGA 1E2ZA 2RQEA 4OGYL 3QJZA 4DP8X 2HH0H 2R2HA 3TZVA 4GI8A 5I74C 5AAWC 4GRMB 1WAAE 5CMAA 3IPFA 5J12C 5T5NG 4EIUA 4WJKB 2H1LM 1ND0B 4JRLA 4P4KA 3CFNA 2WQRA 4NZJA 4O02A 3L16A 2VQUA 3NCWA 2ESVB 1FBIL 2PWHA 4U1LA 5E8EB 5IOKA 1Z5HA 2J8HA 3C60B 4MNQD 3U0WL 1MCDA 2PCFB 4AIZB 2OZ4L 5E1AA 1BIIA 4D9LH 4YC2C 3WAJA 3K4DA 1ZVNA 2DIJA 2WQVA 1H15A 1CLYL 1H6EA 4Y4HC 2WMPB 3KYKH 5SWSA 4G71B 5D2NA 1JZDC 3TH4T 2P42B 1F6LL 4ZFGH 4B60A 3AABA 1R4XA 5IR1A 4ZK8A 4S1SH 4YLCA 4NN5B 3FRPA 2WCSA 1ZWIA 4XMXA 3CFJA 1B9ZA 1Q9WA 2W9DL 3C5ZA 5F89B 4FAAB 4OCMC 1RUKL 3F3HA 3MRFA 4XP9H 3BQUC 4HIXH 2NY3C 3CDZA 3GMOB 5D2LF 4NQTA 2WKOA 3MA7B 1GOFA 4OZHB 3FQUB 4X7DC 2VXQH 3OAUL 4K2UL 3CVIL 1P9MA 1JERA 4HFWB 3EBHA 3GSUB 2B2XL 2EXTA 4UWQB 4JO2H 2VDNL 3IDYC 2BX5A 1M6UA 3RPKA 2DBJA 3REWB 4AV4A 4JY6B 1NAKH 3RVWD 4N8CL 5C0EA 2V7NA 4ALAC 5AENA 4HYTB 4AQ8C 4CMHC 4M93C 2VDKB 1FORH 3PV7A 5HYQB 1MCWM 4AWJC 4BH7A 1BZ7A 2BVPA 4MD0A 2GFBA 1GS6X 3KPLB 2CIKB 3OLIA 3UCRA 1EO8L 2Z8SA 1NDMB 4XNXH 3KLHD 3CSYB 1FRGH 4KJYB 1BCIA 2GSGB 2Z9TA 4BQCA 1SXAA 1R17A 1PZAA 2IWKA 1NL0L 4JFDE 3BQUA 5B8CB 2F8IA 4H2CA 3TVMB 2R4SL 4J8QA 5FW6A 1XGRB 2M1KA 3VD0A 4M6MH 4B27A 1WT5A 2I5YL 3S5LA 1MRFH 4JQIH 2I85A 5ABAA 1XR9B 3QI9C 4K8RL 4QHMB 1Y18B 2WW8A 3HCVA 4HP5A 3VXRE 1IBBA 4NZTL 4XN1A 4CN6A 2F53E 5ERWB 2I32A 3CE1A 2B3RA 3OD3A 1FH2A 4OY9A 4XN2A 3FO2A 4ZPVB 1C8QA 1PNDA 4AQ8A 1SF5A 4PVMA 3JWOL 1JZ8A 1ACYH 1DQVA 4FFZH 5GQBA 4N86A 1SVBA 2VR9A 4E41E 3TEYA 2R83A 3IXTB 3PS6A 4MMYA 1ZT7B 4GPVA 4P23A 3SE6A 4TUKH 1CE6A 2DH3A 5J56B 1WSST 3C5SB 4LDLB 2R2BB 1FG2A 3RNQB 2WJ5A 4LLUB 3SDAD 1G7PB 1BQSA 2KDGA 3D52A 3MRNA 5DJXA 1DQLL 4F7MA 3ULVL 2XN9A 4PJIE 4XPHL 4RRPA 4Y1SA 3H7BB 3UZQA 4TXVB 3QFDB 4I48A 5K1VA 3QI9A 3OZ9L 3WUZA 1NEZB 2PWDA 1JFHA 4Q6KA 3SODB 3EOBB 4MCNA 2OBGA 4Z8FH 3MDJA 5KS9E 5EEYA 4AVKA 3RUGE 5L4MA 1HH6B 4KXDA 3BUBA 2WD0A 3EAKA 3QIUD 2ZCHL 1NDGA 1QW9A 3MNDA 4YHML 4HJJL 4G9FA 4P2RE 4RMQA 4YSAA 1DSYA 3BE1H 4WJ5B 2DQHL 1JWUA 4CUCA 2F54A 2QQNL 3O45B 2E27L 3L3HB 4LCCA 5C9JB 2CO7B 4HXBH 3WDIA 1O7SA 3UH8A 1XF4B 1CFTA 3IJYB 1I8IB 5JORA 1AGCB 4LXFA 3HR6A 2WLZA 4ADJA 2PTTB 15C8L 3J8F7 5I66B 4HUVB 4Y8AA 4PJXB 5KAQF 1GGCL 2XV0A 5J89A 4TSBL 1IJNA 1BOYA 1JRHI 2GIXA 3L4VA 1BXUA 2FX7H 4IOSD 5ECGA 1ZEAH 4BXVA 1QNZL 2ZOOA 2EH8H 4EI5D 3S3PA 3INUL 1MPAL 4PCYA 4Q6IC 4O2FA 2KQNA 3UAEA 2OR9L 3ULUE 4OV5B 3BZEB 3LH9A 3P0VL 1A4KA 2WY3B 1EEQA 4DGIH 1J9CT 1A7NL 2FATL 1JK8A 5DVOA 3PQYE 1FQ9C 4JFED 2J2ZB 3MLTA 3IJHB 3HHMA 3CHRA 4OJDH 3UTZA 1BBJA 4HEPA 1XR8B 1HSBB 1IBYA 4NDMA 4JRWA 3NJIA 1IAOB 1MHHA 1KJ3L 3QEUB 4U1MA 2P24B 3NZHL 5H94A 1UJ3B 2W92A 3UBHA 3S4SB 1MCJA 3B9AA 1AGDB 1OP9A 1HXMA 1QR4A 5IHLB 2OYPA 1WE5A 1IIIA 3CLFL 5DJYA 1Q9OB 3P54A 3HG0A 1U95A 3QEQE 3A67L 3VGGA 1EA9C 4FQXB 3G6JB 4JO4L 3I02A 4FZEL 4Q6IA 1NEZG 3MUUA 3L6FB 3A3YB 3EYUH 1DQDH 1V7MH 4KPHL 5EZPA 4F58H 1E4JA 4BH8A 2YAHA 4KI1A 4NO0D 3FSOA 4LPXA 4YDNA 5E8DH 4ZMYA 2IDCA 4X80H 5IQ7L 3S96A 3RDTB 1SHSA 2PCYA 3GBNL 4W9CC 3AAZB 1HOCB 4AG4H 2ZUSA 5JHDB 3VWJB 4ZD3L 5DRXB 4ALAL 2WUCH 3DC0A 4OGAC 5C2BH 2XKNA 3AMLA 3LAFA 4ZT1A 4N2KA 3VXSE 3ZLQC 1EVUA 3UTSA 5E6IC 1I82A 2WNGA 3RY4A 1UXMA 3HZKB 2DTSA 5FUCC 4EKJA 1WC7B 3NQIA 1AG0A 3PFUA 1NJ9A 2FQFA 4LHJB 1NC2A 1XMWA 3D0LA 3IGFA 4MXVE 1M1XB 3S3CB 3QQXA 1JPGB 1OHQA 4KVCH 2MRYA 2R23B 4I18C 2JSFA 3ML9A 3V10A 43C9A 5ABDE 3K2MC 5E5MB 1IFGA 4RLDA 2VSKB 3S36H 3LVEA 2YQGA 4IKLA 2YGQA 4RGMC 1S7RB 3K2IA 3DRTB 3GRGA 3L13A 4B95C 5CP3A 5A6LA 1CLVA 5L2JB 2ORBL 1BD2B 4ZXBD 5F9WB 1A3ZA 1KB5H 2UZIH 1B4JL 2YD3A 1WAPA 3O4LE 3OB8A 4DO5A 3ESPA 1NCCH 4AEIH 5EUKA 3RFRA 1TCRB 3TASA 2DH2A 1NAMH 4AQZA 3GBEA 1XIWB 3UGEA 3K4ZA 3HBGA 4TUJB 5AVTB 3ZDYB 2OTWA 2K6ZA 1R3JB 2X6UA 2UZXB 5BW7C 1CD9B 3U2SB 1OGAE 3L3DA 3SOBH 3P4MA 4W9FC 5GGRA 4FKEA 1FZMA 3L3KB 4G6FD 5E6IA 3T65A 5DMJB 5J13B 1N4XL 4ZBJA 2GJRA 2GKIA 1H8NA 3ARTA 2VB5A 2PPDA 3BMVA 3S4SG 1T4KB 2EUVA 3ZE2B 5GRXG 3DURA 3F7YB 4F91B 2HLAA 5CCHE 1DJXA 1J9SA 4X99B 1AOZA 4LQ1A 5DD1H 3HI1B 3DPDA 4HUCA 4OM1H 1RJZA 4OCNC 5EBLA 4UOW0 3BEWB 3KEDA 3N40P 4JM2F 3QG6B 4H26A 1NLDH 4CVXA 1A6TA 2WWMD 3P1VA 4MA3A 4HAKA 1YHPA 4NNXA 1RZQA 4MCZA 4XNZC 1MELA 3VFTB 3G5VA 5K9KB 1UCTA 2C3VB 3IU3B 4XP4H 5J6HA 2L8AA 2V5TA 2FBJL 2B1HH 2BWQA 3QIBD 4XCCL 5JTWA 5B7FA 1X5ZA 2ILLA 2WYIA 3CSPA 1LQSR 4GRWB 4IBLT 4QMEA 2BCKB 2BVEA 4B53A 2IFGA 1HHHB 5DMIH 4POYA 2ODIA 5ANMA 2R0ZH 1NCNA 2X1PA 4DKDC 1PBYA 5BW7A 4HUXB 4GKLA 2AK4E 1DZBA 3NA9H 4YDVA 1AXIB 3BIBX 1YPZA 5I17B 2BP3A 2EDLA 1I8KA 4PJDB 2AITA 4ODWB 5TGBA 5INDA 3VD4A 1AS7A 2ZPKL 2PR9A 1XH3A 5EUOB 1VCAA 4APXA 5IIEA 1AR1B 2NYKA 1RKRA 3FTSA 1KELL 2BLFA 2J7LA 2VL5A 3APNA 5CFHA 4JFHE 6FABH 3NAAH 1G94A 4H1LA 5EPMB 2DF3A 3EO0B 3D30A 3Q2NA 5D7IB 4XC1H 5DVMA 3VGFA 4UDTB 1JGDA 1N19A 3KXFA 1MHCB 1U8QA 3Q8AA 3VFVA 5DD3L 3LZLA 3DIVA 3FUHA 5CSZB 5E6ZA 4L5FL 4FQJL 3TN0C 4KK8C 5CINL 1D7DA 3ECBA 1FLTX 1HNFA 1KYUA 1ZT4B 4NQCA 1HCFX 1FYTE 1O7DE 1Z9PA 5T5FH 4RAUB 4MS8C 1G4MA 2YSSB 3Q6FA 4LIQL 2MPAH 1BHGA 4J6RL 2JH2A 1CFMA 4WI0B 2BO0A 3KH4A 5FEBA 4ECNA 1NCOA 1YA5A 4BQ9A 3G6DL 1J9QA 3QORC 4BSVA 1MFCL 5IREA 1U8LB 1IM3B 2IV9A 1JNHA 2P5WE 2Q7YA 3FUDA 3MV9B 1T21B 1X5KA 1S7TA 4A6YH 1MW2A 2DMHA 1KIQA 1QWUA 2DL2A 3HE7C 1IQDA 2F9BT 5F7EH 2H0EA 5LG1A 4X4YB 4DN3H 4YDKH 2VW6A 4XMTA 3N43B 3V2AR 1HXYA 3IDIA 5E94A 2B59B 3NCJL 4QIRA 5E2WH 4AW4A 4W81A 3W1ZA 3NZ8B 4PGDA 3RWCB 1CICC 3D39D 1CU4H 3NK4A 3TNNA 4F33A 1FL3A 1OAJA 3QPXL 5A6IA 1J5DA 4KXBA 3RPIA 3O41A 3ZTJH 1P7BA 4WGVB 3HFFA 2ZCKL 1QBMH 3LY6A 4MJ5A 3UX9B 1ZGLM 4FXKB 3C6EA 4RGOL 1R5WA 3BKCL 4P46B 3DECA 4XXDA 5K39B 1NBZA 1TQCC 5D6CA 1NMCB 4MX7A 4BK5C 3D25B 5DJZB 3CXHJ 1U3HA 2YAMA 1HCVA 2LLGA 4YBHA 3QORA 5DLML 2J25A 4TL4A 4M48L 1QKZL 4NHCH 3MNMA 4PG2C 1T66C 3SJVB 2AC0A 4YBQC 5SWQB 4JHAH 2HXAA 2XTJB 5E8OB 2WP3O 2OSYA 4OI7A 1EHAA 3ARBC 2UY7A 2NY2C 4OB5H 2WXOA 4W9JC 5CJXC 4ORZC 1M9SA 4I0PA 1T20A 5DQ9B 1YY9C 2UWEF 3UERA 1F41A 1QLEL 1MRCL 4PJGE 3WL9B 1T5WB 1UEMA 5FM5M 1JV5A 3FB8A 3PWVB 4J2XA 1N0XH 4H88H 3SE3A 5I71B 1KN4L 4GQPH 4IJTA 4WU7A 3T3MF 1A21A 1FIEA 3GYRA 1I75A 3IN0A 3UZEA 4JY4B 2JKRM 2AMGA 1RI8A 5DJ0B 5AYUL 4GG6E 5GJSL 3ZQ9A 2X2IA 3V8OA 4XP1L 1N59A 2WWKT 1J7VR 2DM7A 4LGRB 4O4YL 1G9NL 3KBFA 3D09A 1J1PH 3F2LA 3DBXB 5J7CC 4Z7OB 3U48A 3K8MA 2QMJA 4KMLB 4EMZA 4PFEA 1UM6H 4PG2A 4IRZA 1RZ7L 4IS6A 1U8MB 5LAPA 1CLCA 4WEMB 3F00A 3CFCH 4KK9C 2F6AA 3C5JB 1HQRB 2IFFL 1O9WA 2JFCA 2NUPA 2MNWA 3MLXH 5GGVY 3VJ6B 5FUZL 3GKWH 1NGYA 4O9HH 2E7LA 1MVYA 4KXAA 2E7BA 3T0EB 1Q72L 4Y16A 2N01B 1O6SA 4DGYL 3IF1B 4A1RA 1VDGA 4PRPE 5CZRA 2PP8A 3N85H 3AU1A 6TAAA 1HEZB 1B0GB 2Y2YA 4L3ED 4KRNA 1OB1A 3QUMH 2K6YA 2O5XL 2WGXA 2WCGA 3H4HA 4MMXA 1UASA 1O9ZA 4PCSA 3BAIA 3V0FA 1WEJH 2OW6A 2A83B 3TO2B 2V33A 3A6CL 2CR0A 2CALA 3QAQA 4B9JA 1UD5A 1NGWA 3A24A 1KFAL 1T0PB 3ARXA 4CKVX 4HCRA 2NW3A 5EU7E 3NYKA 4R7LA 4KY1H 2Z4QA 3EHBB 3EFFA 5FDWA 1KBGH 4NFCA 3SPIA 5I1AA 2GUYA 4K3JH 2MEJB 2EDRA 3IRPX 3NGBC 4K5LA 4DGVL 4IIZA 5KW9L 3T0VA 4Z3EA 4U3SA 2XWCA 5FLUA 1EHKB 3PU7A 3BUIA 4QAWA 4CADB 4MA8L 1KIPB 4PB0L 5AOMA 3WOVA 2AQNA 4OCXL 4PWJA 3HG1D 1GGIL 1LMIA 2G9KA 1VFBB 2XBTA 4XMLH 2QV2A 3RKDC 5CEZL 4GKSA 4L4TB 4Y9CA 5AVYB 2AEWA 3H54A 3EGXB 3N0PB 1I9IH 2F58H 5HDQH 1L3WA 1OP5K 2DYPA 2EDEA 1KENL 4XWOD 3MXWL 2F19H 4PJ8D 5CBEB 1J8KA 1AZVA 4FULA 1A7QL 5ID0B 4YFLI 3ZSTA 5D5MB 4XHQA 3Q5TA 4GB9A 5FO8A 4L1SA 3C08L 2YA2A 4GUPA 4LAQH 3RZWA 3RVXC 1T6WA 3VDCA 1A4AA 1NANI 1NCDL 3AUVA 3DDGA 1DBBL 3FOMB 4WVRA 5F1IB 1HSAA 1U42A 1PSKH 1B90A 3GLDA 3QQ9C 3BUYB 3HB3B 4KUCF 3VFMB 5EZJA 4Y2OB 4ZG1A 4Q9QL 2QL1A 1A6AB 3EOTH 3TA3A 3UTQB 5CLWA 2AJUH 2OSLA 2VRQA 1MCSA 3MZGB 3SZ6A 3DOIA 4WNQA 5F9OH 3ROLA 1L0QA 3QXWA 2ZKMX 5CKAA 4U3HA 5IHZA 4Y0GA 5J3HC 3LEXA 1LDSA 4GQQA 2GBVA 4KNTA 3QP3A 5EOTB 3UACA 3CFDB 3MCKA 5DF0A 3S35X 2JIXA 3RWGA 2W88A 3UBXA 4AYSA 2K9UA 5DMYA 5JUEL 3MV8D 1Y6MR 2X28A 1N8ZB 4HIEA 4N2DA 2D9QB 3BESR 4JO1H 2BZDA 2QELA 2Y06H 2MQ3A 1KLUB 1NC4B 3VYNA 1N8OE 2HWZH 4EBQL 2X9ZA 3RWDB 3GB7B 5K9JH 2CNYA 1A14H 3NT0A 2ARJB 2E76C 2N1KA 3BLPX 4CW1A 4HEMA 1J8HA 3RHWF 5DT1L 3QRGL 1DUZA 3WTXA 1QZNA 2FLBT 3SBPA 4JG1L 3DVFA 3HKFA 4D0DA 4QI3A 1JGUH 4WKZA 5GIRB 5DMGC 3OKLB 1SNRA 2DI8A 4S0TD 5CM1A 1T22B 2J6EH 1M2VA 2H4EA 4G6KL 4K71C 3T71A 1HHIA 2PO6A 4ELME 3IDMA 5C0IA 4EEEA 4IRZL 4QHPA 1RZKC 1KACB 3TBSA 4PGBB 4I89A 2LFGA 3IU4L 4V1DA 4AYMC 3WNKA 3WFBH 3TO4B 5F3HB 4DNLA 2O93L 1PJ9A 2JJTA 3UJJH 4WDIB 3MGAA 2BNRA 5DZ9A 2KZKA 2UUDK 3FCTA 2MCPL 4ZFOA 3QH3A 3QSKB 1V54B 3N5AA 4Y4FC 3GXPA 4NRXA 4XMKH 4NZ8A 3RILA 3CH8A 4U49A 4ZOBA 4NOFA 3CZLA 4K3DH 2BIHA 5IP4A 2YFOA 1SYSB 2DPKA 2VSMB 2P4AB 1BQHG 1EPFA 3RVTC 1I9JH 3GMRA 1ZTXH 5JXED 5EU3B 5CLZA 5DURB 2FX9L 1J1XH 2FO4A 2GCYA 4YWGH 5IM7B 1MCRA 5DJCA 1EIBA 2ZZUT 5AOKA 1T1YB 4OJFL 3L1OH 4HCRL 1JGLH 1GYVA 4H13C 4F2FA 3JSSA 4PV9B 5HHOE 4Q9BA 1JYXA 3ZZQA 2HVJB 1I7UB 1DQJB 3JUZA 4QO1B 2W9EH 2EDFA 4BCXA 1MJUH 2DAVA 4X6DF 3ZT7A 4EN3C 3S34L 2XOTA 5D2LB 1M4KA 3PWJA 4LOVA 4UT6H 1OGSA 4JFOB 1KIRA 2V3DA 2X2JA 5KVDH 2VE6B 2MHAA 2XYBA 3FFCD 4K9EC 1YEIH 5ALCH 2XWDA 5KBLA 3QNYB 3WD5H 5FECB 2Q76A 3FULA 2VM9A 5AWNH 1LK3L 4PMFA 3WHXA 3TVMD 1XV8A 1LHZA 4WTZG 5FYJD 2R29H 4YX2H 1CT8A 3MYJA 2OTUB 1YUHB 3NIDB 4HDIB 4NWUH 2DKSA 3CVHH 2BM3A 4M1DH 4I3RL 4JPVL 1BGXL 4N2LA 2HYMA 5EO1B 3S35L 2Z31C 4IBTA 2FEJA 5AG9A 1WBYB 2FTAA 3TNMA 5C0JB 5ESQA 3US0A 4ZUUA 5BMFH 3BH9A 1TTBA 2EDOA 1A1OA 1U36A 2OMWB 2VQ1A 1R5VA 1SUHA 4JPKH 1A02N 3K2UL 3OLEA 4ABVA 1RJLB 5HVWA 4YLBA 2PYED 1RZGB 2QDWA 5FYKU 3T4AA 4LCWB 1WISA 5C07D 3L2MA 4G6JH 1K3IA 2DM2A 3IJ9A 3WXVH 1YMMB 5A7EA 1KMGA 1EFXA 3ASWA 2E4FA 4HD9A 4U0QB 5KBNC 1CDCA 3BSZL 1AD9B 1AQKL 4XNMA 4F9PA 5DJ6B 4EN3A 3BAJA 2DWXA 3FTVA 1UB6B 1ZVSA 2HKHL 4U1JA 3GEWB 4K07A 2DW5A 1HXKA 2Y1ZA 4Z7QE 2DQEH 1OM3L 2VLJA 3DDFA 1T1WA 3U9UB 1QFHA 2YWYA 3QT2A 4KI5E 2NR6C 4FXGC 5KSAC 1HINH 2DWDA 3Q8BA 4QYOA 2IEPA 3D5OF 3FQ4A 3Q1SH 2J55A 3C2AH 1CIUA 5MHSD 2OMTB 4ZTEA 4KXCA 3NFNB 2VDPB 5BVPH 1CXKA 2Z31A 1D6EA 5EC1B 4BDVA 1NCJA 3QFJA 1GVIA 2WO3B 1TMCB 5F6IC 2DI7A 4PUBH 2I7OA 1S7WB 2DLGA 4M4RA 1R75A 3B6SA 4GQZA 2VLKB 1FNEB 3EF7A 2G30A 5I1HL 4NQDE 3LB6C 3WY2A 3P02A 1PEZA 3CHPA 4PLKC 1E3FA 5AVQB 3ZGHA 5KVEH 3FAWA 2ZUYA 5ESAB 2WIMA 1OV8A 4M7JL 1IGJB 2RQ8A 1MCOH 3GI9L 4X8CA 1QRKA 4PP2A 2ROYA 1IGCH 2R2EB 1O5DT 2DQUL 3VSQA 3L8QA 4P4RB 2K0RA 1SXNA 3K71B 2DQIH 2VRKA 4ZTPH 3CN4A 1JPSL 3IFPA 4KGLA 3CFIC 2H6PA 2NR6A 1Y7VA 2IH9A 4FXGA 5KSAA 2ZOWA 4FG4A 4LLWB 2HRLA 3ZKXC 2YZ8A 4NERA 3V6OC 4O00A 5DR5H 1BFOB 2FWOB 4LLQB 4TNWK 4RDBA 4WEUD 3F65A 3ZDZB 4U1HA 2EICA 2FT7A 3BO8B 3WKYA 4W6YB 1TNNA 2K1MA 2KQMA 3QUGA 1A6ZA 1A47A 4GW5A 1NGXB 1TZAA 3SDYL 4JGJA 2G2RB 4JKPH 3X13A 5BRZB 1S7UB 3DYMA 1OOAA 1RZKL 3U30B 2AAVA 3H9SB 2R0LL 5E4OA 2NZIA 1KZQA 1QSEE 1XGTB 3VNZA 1DQTA 2BSSA 4OLYH 1KPUA 5AVXB 3DX9B 1Y0LA 3NFSL 4CC0A 1EZUA 1MCFA 2WWNA 3UIZA 1A0QL 4BELD 4JFUA 2P7TB 2EXYD 4KH9A 1H0DB 4FNLH 1TU2B 1UWXH 2Y7QA 4A55A 1S3RA 1EUUA 1LO2L 4FQXD 4DAGL 5I6NA 1C5DA 2BP8B 3IMRA 2B0SL 4U0RB 4WO4C 4G2AA 4LMQI 3MRBA 1F4HA 5ITBH 2R0KH 2I27N 1OE1A 5TE7L 2LLLA 2N3JA 3DETD 1PQZB 3AGVA 1KN2H 1BX2A 1XZ0A 3L2LA 1G1OA 4N8UA 2DLFL 3RDTD 1JZ7A 1V7NH 2HX8A 1MFUA 4HZLB 1WIPA 1OTSD 3ATDA 2Z0UA 3AT0A 1PG7H 3CK0H 3DSNB 1WA1X 3GIVB 5KUMA 3TESA 2YA1A 1U21A 1IAIL 1CBJA 3F6LA 2I25N 1S7XA 3P77A 2EDBA 5LWYH 4LSRL 4GBXD 2ZSVB 4LVHC 1AY1L 5AL0A 4Y4KB 3HFMH 4LKXA 3TYFA 4G3YH 4BQ6A 2H8PA 4JJHA 3FH7A 5DJ8B 3TXAA 2GUOB 1G6VK 5A2KH 2JELL 3QZMA 1XSOA 2YD6A 4K9EL 3L3IA 3STBA 2RCSL 2Z4TA 2ZAGA 4OIIL 4PJAE 1G1YA 2QADC 3PPSA 2ZNXA 1YNTA 2W9LA 3QDGB 1PY9A 2E9JA 3SPVA 4OI8A 1X4YA 1RURH 4JQIA 5K93A 4WO4A 2DBLH 3UPCA 2FZ3B 2Y36L 3VX1A 1E27B 2IWGA 3TU6A 1JZ2A 4UIKH 1G0YR 4OCWL 2CCWA 1EX0A 1LGVA 4TUOB 2VERA 4GQRA 3GNML 4IMLB 7FABL 4ETYA 3II3A 2ZXAA 4PJEA 4KKPA 1U91A 4NYLB 4O2EA 4UT9L 4LBEA 4X0KA 1XIWD 2WXPA 1TKWA 2NXYB 2ZF8A 2R4RH 2ATPA 3BCFA 4TVUA 2EYRB 1PZDA 1DQQB 1OL0A 2OR8A 3IKKA 5EWIL 4WKXA 5I0WA 1B4TA 2NCMA 4Q9RL 1MZYA 2WC7A 4IRJB 3US1A 4NQXA 3KBPA 4M1GL 1SBBA 1RUPL 4GOSA 2QPDB 2GHWB 5CS7A 5AYQA 5C0GB 1RP8A 2Y6TE 4Z7VB 1SXZA 3BWUF 4HC1A 1MUJA 4OFYD 5CGYD 1FAIH 2RMNA 4XB8A 3NCXA 5KN5B 1ORSB 2YMXL 1C1EL 3IMSA 1FH5H 1BM3L 4XCFH 4UNTA 2VDKL 4JRXE 3RWIB 3PWLA 5IMKA 2XZCH 5SX4I 3BVXA 1ITBB 3FSZA 4MD5B 2F0CA 4O51A 2Q2LA 5DJ2B 5I73C 5C0CB 5KYUB 4F37F 2VH5H 5DUBB 2Q7AA 4J3OD 2RJMA 4N1CA 4MDJA 3TM6A 5DRNB 3L4CA 1C5CH 1QSFE 1ZRUA 3D18A 1GS7A 3L5JA 3OXSB 4MAUH 4X6CA 5EU4B 4LDOB 4I5BB 3V5KA 3K1KC 2F7OA 2EE6A 4R7XA 5JHMA 1ZHLA 4ICXA 2RFXA 3GGWA 4JN2A 5E2JA 2W0LA 3HUJB 2EXSA 3PJSB 3TH2T 3AROA 4A2LA 1T4WA 3QDJA 4Y19E 1CZ8L 2HTLD 2Y23A 3UTTE 4BA0A 4GT7A 4P07A 4JFZL 2J5LC 1CFSA 1AR1D 4GS7B 5ADPL 1IIKA 1QW8A 2X4OA 4JLRA 5LGHH 4EI6B 4UT7L 4UAOB 1MJJA 1HFUA 1K8IA 4EDXB 2VJXA 2BRRL 3PJLA 1MIEL 3NCEB 4HFUH 5GGSB 5DWPA 5AL8A 3U25A 4NHUB 4RAVA 5DEZA 2ED9A 2VITA 4AE1A 1ZLWK 1VFMA 2NNCA 1NCGA 2LQRA 1AZNA 2COVD 2XX0A 3RTQC 1LE9A 1P1VA 1RMFL 5C8JB 2QQKH 3DX6B 4L4VA 4EVNA 3KHQA 2OXGB 3KPSA 4KVPA 5I8KL 3UG3A 1DVFD 2FYYA 1TT6A 4POZC 2VKWA 1G6RL 1EERB 1BYOA 4FYSA 5LBVA 3DX3A 5DDHB 2UXGA 4GUCA 3GSXA 2AS5M 1T5KA 1GJUA 3QAZB 1VGKB 4I3GA 1OANA 2DIBA 1JWMA 2HRPL 3JVFC 1BXVA 1SYVB 5E5RB 5JDSA 2XWJA 4FLHA 4JANB 1SHWA 2VAJA 4G8AC 4MXQC 4P5TC 3NIFF 4KJQC 3ESUF 1DL7L 3QDME 2Y6SC 1RXLA 1DE4A 5JO5B 3EH2A 1JE6A 2NY7H 1TFHA 4P5KA 4UQ3B 1OP5H 2CRZA 3MRRA 5IFAL 3IEAA 1NIEA 3GLZA 1QUPA 3QXVA 3MRHB 1A8JH 1RSYA 3DGGB 3O0LA 4M8QA 1D5BA 4JKKA 4PRIE 4HKJA 1IL1B 4YPGA 4AH2A 3VMOA 3MRLB 1VERA 3RTQA 3G7TA 3SBWC 3W57A 2R1YB 3MOAH 1OGTB 1VFUA 3P9MA 3ARVA 5LQBL 4P46D 3BEVA 4HSQA 3SO3C 3OJDB 3MLPA 4N9GB 5AG8A 5GRZA 4RFEA 1OB0A 2V8LA 5EOCL 3D69B 2ADYA 1BOGB 3ATAA 1QO3B 1ACYL 3T3PE 3NCBB 4XVSL 2G60H 4KVNL 5L8LB 2KLSA 3BGFC 1H8SA 4QKXB 2UV3A 1ESOA 4WWPA 3RIKA 3FCSB 3QIWA 3RX8A 1MHEB 1NBQA 1MZZA 2NSQA 3K0WA 4R0LC 4M6NH 2J6WA 1AXTH 4GMSL 2ITEA 4ZUTB 5FYKE 1FC1A 1UCBH 4HC1L 5G55A 1A7OL 1EZVX 4JDEB 4U7MA 5CEXA 1I3RA 3M1BA 1T03H 2YO3A 3EJTA 3OLDA 3IFOA 1T3FB 4FL4B 3UYPA 2DQTH 3ME0A 4G6MH 5I19H 3TV8A 1W80A 1I3UA 5IKCB 2OYKA 1P1ZB 5GRWA 2VZTA 2DLEA 1KB5A 1KG0A 3HHRB 1AIFA 3QYCA 3CFUA 3SDDA 4ZMAT 1K85A 4P9HH 2W07A 2CSPA 4NZUH 4LVEA 4P5RA 5TE6H 1EGJA 3V0JA 1X9LA 3CZGA 4JFDB 1ICTA 1UD8A 5D1QE 3D4GA 1KJ2B 1KJVA 4P06A 3VFSB 4FKKA 1UXLA 5C86A 3T2PA 1NAMA 4DF9A 1X4ZA 2FT6A 2Y7LA 2J5WA 4JZJC 1UATA 4NN6B 4HUMB 3TOPA 3RGBA 1OK8A 3X17A 1FL5B 4XPFL 4JR9H 5ESVB 4IGBD 5L6YL 1X44A 4LLDA 2NY4C 3KPRE 4QHKJ 5K33A 3IAGC 5FO9B 3NACH 3IETA 3QNZB 5FK9B 2W65A 2YOCA 3VXRB 2VDML 3O6FD 5A3IC 2F53B 1L9QA 2JKLA 4HJ0C 5FW8A 4L8SB 4XAWH 2DWTA 4DVRH 2HFGH 4XTRD 5DFVC 2XQBL 1E7VA 3BWSA 4N0YL 5H37G 3TS8A 5EHFA 4MQSB 2DL9A 3HZVB 2EKSA 3T0ED 3B9KC 3LRGA 3D51A 4QXWA 1BM7A 1BP3B 4UILH 5AW6B 4E41B 4HOZA 2TAAA 2P43B 3AXIA 2H41A 1GAFH 5G4MA 3P3TA 4KO6A 4C54A 3KMDA 1BFTA 3U0PA 4H8WH 4QTIL 3B1UA 3C9NB 4BJLA 4Q0XL 4ELDA 2PYFA 3MTXA 3ULVE 1FF5A 4FX5A 1DDHB 1OE3A 2O5ZL 2BRQA 4M6OH 4Y9GA 4Y5XB 1JBJA 1ZJAA 1XH0A 2XIIA 5EA0H 4IRSB 1BVNP 4L48A 4QOKA 4LEBA 1UKQA 3MLRH 5HD8D 1PU0A 1RCYA 3HG2A 5HGGS 1L0PA 3SY0A 2WXJA 5KS9B 2PXYA 1SJHB 5FYJH 2FX8H 4LT7A 3RUGB 3PGFL 1YAZA 4YO0A 3ECVA 1GTFA 4IQHA 3MRDA 5HPMA 1YEJH 3IDJA 2ADFL 3IMTA 1FL6A 4MWFA 4W6WB 4DUXA 2XLLA 6PCYA 4LEOA 5SWSE 5J6GB 5D2NE 2YRLA 3S98A 3DPBA 4O2CA 3B9KA 5FUOH 2A99A 2FEEL 4URTB 4NAJA 4YFLF 3QO1B 1DFXA 4CAGA 1TQBC 4OZIF 5B1CA 3TLRA 3JQOB 2XWZA 1NPUA 1OT4A 2AJSH 3VXUA 5E8DL 3WNOA 4PJCF 3CVCA 4KZDL 3TBVB 5A2AA 3MLYH 4U1NB 5T5FA 2Y07H 2BDNH 3UJIL 3M6DA 1AS8A 3CZSA 4JGNA 1HIML 1AZBA 2FB4L 3F6IA 4B0MB 4HUUB 4A7TA 3MLZL 2CPUA 4PI0A 4PS4L 2YEZB 2O5YH 1G7MB 2FH6A 4P57B 1FFRA 5MENB 3EW3B 1TTCA 4PRHB 1ROCA 3V52H 5J1AA 1JF6A 1NBVH 1MFEL 3GZPA 3HB3D 5AKRA 2D7TL 3PQYB 3F85A 4M8RA 5T1KA 2YPLA 4XNYL 5DXWA 4LDEB 1NOLA 2HB0A 4L8BA 5DZLA 5JQ6H 1CS6A 5BS0A 4WV1B 2R1XA 3O11A 4OVUA 5I8EA 4LCYB 3WLWD 4G8GA 3KNBA 2PUQT 5FO7A 4GG8B 1FPTL 4FFWD 2H6OA 4DQOH 5FB8B 1T6VN 4FI7A 2C9RA 2WLLB 4FG6D 2YXVA 4GRLB 3O6LL 2X4SB 3ABMB 3CHOA 4FFVD 4ZTOH 1NC4D 3U7WH 1EGJL 4NO3B 4UYPA 2CBOA 3D4ZA 4HCIA 2DYSB 1CE1H 3QEQB 1A3RL 2W38A 12E8L 3N50A 3PAZA 2J8OA 2BNQA 2WCPA 4C8XA 1AGFA 1DBAH 4S10A 4F8LA 1B4RA 3ZJAA 2ZAIA 4M7LL 4FTDA 5KSUB 4G7VH 1KCRH 5HDRA 2VMEA 2FDBP 5E2VH 4JFFD 1P7QD 3KCWA 3DSFL 1C7SA 4HJIA 3FZUD 2FGWL 2XG5A 4NO5A 1RY7B 1YNTF 2AI0L 4G6AC 4PG9B 3H56A 3TO4D 1DQML 1ZLDA 3IDNB 5IB3A 3H3KA 4P2QE 4Y9EA 4PJ5E 4QHLB 3VXSB 5BV7B 2BSDA 1MF2H 5E8NA 4MNQA 5I1GL 3FO9B 2BS9A 4FTVD 4R97C 4LQFH 4FEIA 2YXFA 2ZAHA 3RVWC 2OK0L 3VXOA 1CF8H 3ZK0A 3GHEL 4PJEF 4X9GA 3WMSA 2FRGP 3KCPB 1PY4A 3HTLX 1SFHA 4HH9A 4ERSH 3NABH 2XN9E 4XN8A 3WIIL 1CL7H 3LKNA 3VXMB 1LDPH 3PXJA 3ARYA 1BVLA 2IV8A 5TDNB 2R0ZL 5E1IA 3KLHC 2F8VA 4MQTB 2E46A 5DURD 3LN9A 2Q8BL 3NJFA 3UTPE 2WLMA 4C57C 4CILA 2EEAA 2A74C 3GSWA 3O4LB 3MUGA 3F83A 3P4LA 2JWYA 4FGMA 5IBUB 2KS0A 1XF3B 2XRAL 3VE0A 4YMPA 5HJ3B 3MJ7A 4XR8C 3NOIA 4G9FE 3V4UL 1HN1A 1JXFA 2F7PA 1KY6A 2HJLA 5CKGA 1JDAA 4YDJB 5IMMB 4PJBE 3PYCA 3KGSA 1G7LA 5I75C 2F54E 5BCAA 5HVFB 5IJKC 3IT8D 5D55A 5F9JB 1OGAB 1MIML 3VTAA 1DEEA 4XC1L 2IBZX 1KCUL 5E6SB 2QR0B 2C4XA 3N41B 3QA3A 3C6SB 1OSZA 4KTYA 4ZI8A 4DUWA 2SODB 1MRDL 4JFYB 1NLBH 3V4VA 4ODUB 4B9FA 4PWIA 3BQVA 5K9QI 3QUMA 2FNBA 4H8UA 3WIFA 1UXSA 2K7QA 2D7OA 3EJSA 4JQVC 4X4XB 5CZKA 4D9QE 4GI9A 4GIAA 2XJLA 3P3YA 4PJFF 3K46A 4UOJA 2CDFB 4N6RA 4N5ED 3RYMA 3VRIA 4F80A 3ZUNC 4XT1C 3QQ3A 4XO8A 1TYRA 5EFIA 1I1YB 3SDAC 5F3BB 3CZNA 3HPJB 5IHUL 4Z9KB 4X6DB 3I6KA 1Q90A 3AXLB 1IC5L 2XV2A 3POCA 4A2EA 5I6PA 4LCWD 4YSSA 1FDLH 3NCYS 4QHUB 4JRFA 3D3VD 5C0RH 3G5YA 4YFDB 3MQIA 3N1QC 4G82A 2APVA 4RA0C 2XI9A 3B3IB 3DROB 5IEHA 4CVZB 1IT9H 1ZVYA 5DQDH 2Z65C 2BP5M 4TOYH 5IJKA 4AYID 4WWNA 2MQ0A 2AK4B 3E6FB 1CFNA 4BHUI 3QIUC 4OLUL 5KYXB 3MAWA 2NZ1A 3QWNA 1C12B 2LTQB 4LNRB 3VH8A 3H1ZA 5IJVB 2VN4A 4PHZA 4BZ1A 2GTWB 5JIDA 4N25A 1OCRB 2RAMA 1F8TH 2DTML 4G42A 2OMUA 3OR7A 4J23A 4DFIA 4M62H 3BT0A 1BAWA 5J6SA 3DUUB 3VI4A 3OKOA 1UT9A 1HJBC 4ABQA 2VLME 1BF5A 1MAKA 2AK1L 3ZPDA 3MRGA 1HZHL 2YD7A 2Z92A 4L5FE 3V6FA 3SDAA 4BWTA 2BOCA 3QJOA 4HS3B 2QVTA 3WFDH 1Q0XL 2NW2A 4HS8H 1WLHA 1F3JB 5IBUG 3SYOA 4C4KT 1JFQH 2B5IC 5D70L 3GJEB 4N4YB 3VQMA 1RJYA 1FYTB 4LIQE 4EI5C 1GC1L 2DWEB 1Z9OA 5JPMC 1SVZA 5I76B 3BDYH 2YBRB 5I5JA 5BOJA 1HNYA 4ENED 4FABL 1ZXQA 1WA2X 3S37L 1PKQE 3UTSE 1XXDC 4KROC 4EIBA 4AQAA 1JPTL 4YHIB 1R3KA 2C8NA 2FSEB 3QIUA 4L37B 5JIMA 3MPCA 3MUZ1 3GRWH 4GRWH 3K3QA 3WHE0 2P5WB 2ERJB 4QTFA 4F57H 4WUUB 2MCMA 4HIHB 2L7UA 3QARA 3WLBB 4B9CA 3R7QA 3RJQB 3R1GH 4M56A 2ENYA 4W4NA 3STLA 3H6AA 4PTUB 5JXAH 5JIIA 1UGKA 1W6LA 3FB6A 2X89D 4U4IA 2VDRL 2N4IA 1CFVH 4JCLA 4BWWA 1YC7A 1FLRH 4NKMB 4X6BB 2OJ1A 3DGCR 4GP5B 4M1CD 4B9YA 4PVBA 2NUTB 4F7TA 4LP4A 3WN6A 3I2CL 4YDIL 5AW5B 4M5ZL 4AGOA 3FH8A 5CCKL 2H3KA 5H8DA 3OHXB 5C0BE 2O6FA 1WJ3A 1GYCA 4IOSA 1R3HA 4NIKB 1LK2B 4EI5A 4ACPA 5JPMA 3BJ91 3ARQA 4WY7H 2X5PA 4ZDHB 4HZ1A 4JZNA 4JG9A 1UEYA 2DJSA 4B9PA 3MR9A 3RURA 3WKMH 4HWBL 1S8DA 1IAMA 5FUCE 5E56A 1CIDA 2XZQH 4N2AA 2EIZA 4JFEA 4XE0A 2LFEA 5CHNB 2OI9C 4IU3B 5I1CH 1TJXA 4PJHA 1ZLWH 1H6TA 4TPRH 5KG9A 4JGUA 3FB7A 2F7QA 3RL2B 4FN0A 3WO4C 3O3UN 4JG0L 4UM9B 4DW2H 3V4VL 1SOSA 3ZHFA 3L3JB 2OX5B 1FYHB 2VKXA 2VERN 3ZO9A 1WWAX 2ICWJ 3JWDL 2A1WH 2YA0A 3GMQB 2EKJA 3QW9A 2W1NA 1FGVH 5C6PB 2IAMB 3MRJA 2CMRL 2Y7MA 4WCYL 4PJGB 1NCWH 1YRKA 3QXUA 2R8SL 3MRCB 2BSTB 3FHEA 2DQ6A 2YKLL 2EINB 4F3FA 1SEBB 4UU9B 1AJ7H 5EU5B 2ED8A 3KYNA 5KSBA 1P84K 1CCZA 2AVFA 2ICWA 3FB5A 3F7PC 4S1RH 5ANME 4ZXBC 3OAZK 5F70A 4Y4KD 1B0RB 4NO0A 2PTUA 4PP1D 5EO9A 1KTDA 2UZPA 4LCIH 1FFOA 5GS2D 4UT6A 4XO9A 1PYWA 3NZUA 3EYOA 1RZFH 1YPZE 3KPPA 4GFTB 3BAEL 2JE8A 1UD4A 1QVOB 4Z95H 5E6UB 4QHNB 5GRJH 2IGFL 5F93C 2EABA 1TJIL 4BZ1L 4OJYA 4F5CE 5CP7B 4N0FB 4WTQA 4NCDA 2R29A 3MLSL 3KVDD 2CDGB 3ALPA 1CK0H 2F2HA 3V5DB 2K70A 2A6JB 3DIFA 4J4PD 3NFPA 1KTLB 3CVHA 3MNVA 3NJJA 3KXFE 1FIGH 3C6LB 4C58B 1X6LA 4GAFB 3VFOA 3D12B 4MDRA 2YPKB 3B8YA 1JNNL 3BVWA 5E7BA 1RZ8A 4PRPB 2NDFA 1H5BC 4ORGB 3LXAA 3V0VB 1QA9B 1PZUB 4D7BA 1UVQB 4HMDA 2WNWA 1SVCP 3EOTL 4DKTA 2ITDA 3QQDA 2VWEC 4IRJD 1F2XK 4ZXBA 5J0BA 1EHLL 5DD0H 4XXCA 2Z35A 2GJ6E 2ICCA 1AKJD 2QJDA 3F58H 3R4RA 3V9EA 3MRIB 3QIBC 3GXDA 2GTZB 5IW6B 2KZBA 4F93B 4OTXL 1JXJA 1NGPL 2GPZA 4HBQA 4HWNA 4NAMA 5MI0B 1NEPA 1BBDH 3FUMA 4PGJA 2XWBB 5FO2A 3HLAB 3TONA 3HJEA 3PP3K 1INDL 3MBED 2Q1EA 5AUMB 3WTWA 2AXJA 4Z7WA 5HDWA 4U31A 2ZCLH 3PL6C 3QUKA 4TQEL 3O3DA 4CSTA 5CCJA 5EN2A 5HHXH 3FMGL 2JKSA 3QXTA 5GSVA 5C0CD 4K9JA 2IDTA 4CJ0A 1QPKA 2X53A 1XGYL 1MQKH 3MLUH 3OKEA 3QXDA 5D7KD 4XGZB 3E6HB 2IADA 1H5BA 1KPVA 5CEZE 4NNPH 2CQVA 1IC4L 4JB9H 3I84A 4YXKH 2DQCH 4QTHA 3LN4A 3ARDB 4UB0H 2H1PH 4OD3L 4R90H 2PTVA 4PY8I 1U6AH 3VDBA 1RVFH 2L7QA 2FJGB 2LU3A 1DQKA 2X3BA 3QIBA 4R7DB 4UQ9A 4QRUB 5E9NA 4I85A 4UV4L 4CN1A 3ELAT 4AL8C 1M71A 4BHUA 3ZHKA 4I9WE 5B4MC 5K9OA 4XMKL 1C8PA 4L1LA 2I7SA 1A6WH 5KVGL 3P4NB 4RFNC 1E9PB 3Q01A 1T7ZA 2Q6WB 3P2DA 3CSTA 5AVSB 3JTSA 5FCSH 3CLEH 2ZNWA 3WNNA 1RK1B 1ERNA 1H3WM 2Y5TB 5EULV 2RBLA 1QABA 5LDUA 2EZ0D 2XV3A 4ZW3A 1ETA1 2OCCB 2PCPA 1B6UA 4JFTA 4JPWL 1JMZA 4GSXA 4ETQA 4K7PY 2Z3FA 5JLZA 3MREA 3CUPB 3AM8A 5EZIL 2ZKYA 4WW1A 3O2VH 4OUOA 4PY7A 2BC4B 2UXTA 5IF0B 4OLZH 4Z5RA 3KH3A 2AV1A 3TF4A 4XNAA 2OCJA 1EBAA 2BHUA 1M42A 5FR3A 1N64H 1OSEA 2E8ZA 4N6QA 1QFWM 3MCLH 4BRVA 2V5RA 3BVUA 1Z9SA 4NLAA 4CN4A 3DVNB 5MEOA 4UT6L 3QQ4A 3SEPA 3E3QC 1E9QA 4GYBA 4MYPA 3H42H 4RGNC 4CL7A 2AJ3A 2CG9X 5E6RB 1PD0A 1QUNB 4ELMB 3GSVA 3BPCB 3P30L 1ACCA 2X70B 4NB7A 2PETA 4GUOA 3MHZA 5FLVA 4GO6B 4N1HB 2R29L 4ODHH 1RIHH 3O0RH 5FKAA 2J44A 4GQ9H 1HAUA 1Z3RA 3GLEA 3GHBH 2X4NB 3ATFA 3CVHL 1CB4A 4WWKB 3CBJB 3I9IA 4G1MB 2VMDA 4KKCC 4WNSA 1EXUA 3EGDA 3UTSB 5D1ZB 3CC5B 3JTTA 2XPGB 3VO0A 5KOVC 4TVPL 1TENA 2FL5B 3Q8FA 3WJJC 3WUWB 5I15L 4I4WB 1IFRA 1LL1A 2K4WA 2KLRA 3CFBA 3V4LA 4BM7A 1NUFA 4G6JL 2ATAA 5B39B 4E0RB 4KBPA 1T0NB 4I1PA 1A1MB 4FNTA 4P2OB 1ZK5A 1W91A 3D39A 4G1EA 2E59A 3ZT6A 4TV3A 1E5BA 3BMWA 3N9GH 4N2MA 1E6OL 5GJTL 2J8UA 4PLJC 2L4OA 1DSWA 5HYJE 3UJTH 1EEZA 1JHLH 2HFFB 5KVFL 3EJPA 1UA6H 1SZNA 3BRFA 5HGAA 2A5UA 4BFNA 4E9XA 1IRAY 4OLXH 1KYFA 2QHRH 2GG1A 4FD0A 5HHOB 5MEQA 2J73A 2OYLA 3RNKA 4HX1A 2R69H 2HKFL 5L0QC 1LWJA 3L95A 3HS0C 3U7YH 3K6NA 2ALAA 4Q2ZB 5L88H 3VYPA 3QJRB 4PJ6A 5ENWB 4MBRA 4YSQA 2V2WA 5A16A 5T3XD 2E9WA 1FNSH 2X9YA 3DVGA 1JV2B 3E8UH 5DQJA 5H4ZA 3EG9A 4HS6A 4IOFD 1XGUA 1JF1A 3WJJA 4OD2B 4AQEB 4L4JA 5T1MB 2HCZX 1PZ5B 2Z1PA 4ZMVA 4G8FB 4JDVA 1MHPH 2FO1A 1DVTA 1LO3H 2UY6A 3SE4C 1XXFC 4ZOEA 2A77L 4YGVB 5KJ7E 4RWYH 4FHKA 4IHOA 3QJFB 1A3LH 1UQSB 3OX8B 3V6ZA 2V5SA 4OT1H 3VXRD 3GMMB 1E65A 2F53D 2CH8A 2H32B 3SKOB 3TBTB 3SKMB 5TTRA 3AS2A 3NQKA 1ANUA 4A2MA 1X5IA 3KZ8A 4HJTA 3ZL1A 2BY1A 2VN3A 3ZHDA 5KJRL 3GK8H 3FQWB 1O7VA 3LNIA 4JHVA 2V7HA 1NFIB 2N0MA 3CMOH 2CDEB 3L45A 3FFDA 4JDTH 1QYGL 4WO0A 3LHPH 3PDOA 4Z18A 3L7FA 3HS0A 3U4EB 2CK0L 1L0XA 4MD4B 2EEDA 1H9DA 1IGFL 2QTEA 4N0CC 3FNKA 3WXWL 4ONHB 1KEML 5I9QB 1RU9L 1DLFL 2CKBB 2PR4L 4Z7QB 2VJ8A 3OHMB 4JDZA 5EEXA 3U46B 3WUWG 1GPOL 4JNXA 4L1DA 4AQ1B 1A6PA 2CBTA 1G9HA 3CZJA 2BFGA 1GJIA 2QGBA 1IEAA 1E4HA 5GHWH 1TZIB 5EO0A 4IRSD 3N44F 1JP5A 4PBDA 1GJWA 2N0KA 3MV7D 5B39G 2IH8A 4HEME 1SOKA 1J8HE 3TEXA 2ZOLA 2OYMA 3QYMA 4HJSA 4HF5H 4F7CB 1JZIA 1IVLA 2NY6B 2X88A 4QY8A 2XNAA 4L3EA 4XZUB 1RUQL 4FNQA 4AL8L 2CM6A 1XVSA 1A6UH 1OAZH 3GUTB 3BZFB 2VUKA 3QPQD 1MH5B 4JM0A 3H9HB 2KZ1B 3LKQB 2BNUB 1UWGL 2BIMA 3PGDB 1S78C 1EZSA 2EC9T 3B8SA 4HKZB 4NQDB 4OZ4A 2WVUA 4TRPH 4V1DE 4ZQTA 1QZ1A 3L3OA 3UBGA 4NQVB 1S9YB 4I1NB 4XNUH 2RACA 1P4LB 3KPNB 4PJ7A 1RIVL 4PY8J 1JZEA 3P9WB 4G8EB 2IALA 2HVBA 2WOYA 3O3BA 1V3MA 1WYJA 1AYOA 1XT5A 1PCXA 4FI8A 4BQBA 5T3ZL 4AKPA 3GSOA 1NIAA 1RUAL 3H4FA 1T89C 4F7PA 1DLHB 1SY6L 2AJVL 2F08A 4OUUB 3FQYA 4X7SH 5LAXB 4NSKB 2NXZB 2WPGA 5MEND 1HI6B 3MUJA 4PRHD 2OV0A 1F97A 3HG1A 4R4BB 4X7TB 1NSNH 3SQBA 3DHUA 4L1HA 4PV8B 4H40A 1G7IB 3X11A 5E4AA 2YMOA 3OQ3B 2FD6L 1MFBH 3S5ZA 2V2XB 4XCYA 4YQXH 1E4XH 1I1FA 2VDPH 4OKVB 4E5XB 5MEPB 4PJ8A 1IC1A 4HWZA 2ITFA 3U83A 1QSEB 3U0TB 2VR8A 5I24A 5KYWB 2WGNB 3VVVA 4LEXL 4GRLD 4W70A 2OMYB 1MNUL 2OJZH 3EH3B 1NPNA 2YWZA 3G08B 4P9HC 4Y8DC 5T1DL 3MJGX 3DRQB 2ZICA 3ABLB 2CLRA 3ARFB 5E2UL 2HP4A 2ETWA 5KSBF 3OJVC 4LKCA 5GXBB 3QEQD 1CL7I 4WW2F 4NZDA 5D1XC 2HJFB 1KJMA 1EEUA 3VGAB 1QI4A 4OD1L 3CWGA 3VFRA 4YN3A 1ILUA 3MV8A 4CGUB 2YPVH 2ADIB 2X41A 3NIGB 5E03A 3O3EB 4NKOA 3SDCD 1ZHNB 3MYZA 5CAYB 3N55A 4LP8A 3FO0H 3LXBA 4OLWH 1XMEB 5F0PB 1ND0A 1F13A 1VKXB 1W0YT 4EN2A 5D7HA 4NC2B 1GHFL 3QJQB 1LM8V 2LV4A 5IQ9A 1H3XA 4G72B 3QZWB 5E8EA 3NTCL 3QR0A 5JXEC 3O3AA 4KTEL 5AD0B 4AC4A 4AIZA 1TZGH 1WZMA 1QQDB 5PAZA 2BJMH 4IOIB 3AG3B 4YHZH 4RFOH 4Y2DC 2ZJSL 5FM8A 1AQHA 2VLJE 1RLBA 4BGDA 2J1YA 1D3CA 3EYSL 2EUZA 1RH8A 1DFBH 3ARGD 1C7TA 4PJAB 3KYMB 3T8VA 3VXMD 4L29B 5CILL 2PW2B 5GGUB 1R0AH 1PAZA 1F90H 1M1SA 1A1NB 4OCSL 5IK3B 1N0LB 1R1CA 2BZ7A 1EMTH 4YZWA 1KPRB 1S5IH 4D9RD 1BVNT 2RA1A 3UTOA 4ZFZB 2IIJA 3AWFA 3H9ZA 4MMZC 4AGQA 3T4YA 5I1IH 4FYRA 3GFUA 3MA7A 1S9WA 1VPOL 3VU2A 4OZHA 3FQUA 4YXLL 1RK7A 2JKNA 4ONFL 4HJEA 3HAEB 3PAVA 2JI2A 5GRVL 4E5XG 2CJ3A 1JGIA 2C9UA 1HC1A 1DJHA 3U9PL 5LXGH 4ODVH 2CHXA 4ODTL 1FG9C 3RE0A 5JXEA 5DYOB 1IC7L 4KZ0A 3REWA 3MNWB 5DCCA 5GISH 4D94A 1TO4A 4OF6A 3PIQB 2AJYL 2XBDA 3WFCL 1IMHC 3SCMB 3WJLC 1ZA6B 1P7KB 1HILB 3O6KL 1FO0A 5E2TL 2JKXA 5BXFA 5CGMA 5HYQA 3EF4A 3W0WE 4HZAA 5E23A 5LN8A 1SJEB 2CKNA