1NCAL

Refined crystal structure of the influenza virus n9 neuraminidase-nc41 fab complex
Total Genus 53
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
53
sequence length
214
structure length
214
Chain Sequence
DIVMTQSPKFMSTSVGDRVTITCKASQDVSTAVVWYQQKPGQSPKLLIYWASTRHIGVPDRFAGSGSGTDYTLTISSVQAEDLALYYCQQHYSPPWTFGGGTKLEIKRADAAPTVSIFPPSSEQLTSGGASVVCFLNNFYPKDINVKWKIDGSERQNGVLNSWTDQDSKDSTYSMSSTLTLTKDEYERHNSYTCEATHKTSTSPIVKSFNRNEC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase(o-glycosyl)
molecule keywords INFLUENZA A SUBTYPE N9 NEURAMINIDASE
publication title Refined crystal structure of the influenza virus N9 neuraminidase-NC41 Fab complex.
pubmed doi rcsb
total genus 53
structure length 214
sequence length 214
ec nomenclature
pdb deposition date 1992-01-21
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1ncaL02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1ncaL01
5IB3B 1NC4D 4K3DH 3O41A 1XCQA 4LEOA 3MGOA 2ZOLA 4FG6D 5HPOA 4QGTA 5TQ0H 2JIXB 3ARVA 3U0PB 2I07B 2GTWB 4M00A 2BOBB 3X13B 3U2SA 5DJ6A 2GFBA 1KENL 4HCRH 2JELH 4HEME 4TRPL 1DVFB 1U8HB 5CINH 4F2MA 3D3VA 1GZQA 4S1QL 2BSSA 3SN6N 4JQIL 1S7SB 4GAGH 2DQIL 1KCVH 4MJID 3NMEA 1XF5B 4S0SD 1PX4A 3LB6D 4KXZH 5ADOH 1NGWB 4LNRB 1EK3A 3OB8A 5J89A 4TTDC 3LPFA 2FLBT 1DP0A 4POZC 3E3QE 3SE9L 1LK3L 3BKJL 2H3NB 4HIJA 4RGNC 3MUGB 2FBJL 4R3SB 1I9RH 3TJHC 1CFVH 4L3CA 2O61B 3MV8A 2ILLA 4ZPTB 4D3CH 3JZ7A 5BZDA 3CMGA 3P11H 5DJAB 2W9LA 3AB0C 3O11A 4F7MA 5KG9B 5EH1A 1F45A 1FVEA 3RHWF 2HTLC 1I1AB 1FGVL 4MA3B 1NH6A 3INUL 1A47A 8FABB 2D3VA 3GGWA 5ALCL 2G9HB 4YEFA 5EIVA 2H9GB 4F3FA 5TQ2L 4YFLF 1RU9L 3D9AL 1QG3A 5EU7C 3GSVA 5FYJU 5F9AC 1I7ZB 1CXLA 2NNAA 4HT1L 4P5TA 4OZFB 3OAYK 3UDWA 2ESVA 4YDKL 1CD0A 2R2HA 4JDTH 1BFOA 3G9AB 5IMLA 3BSZH 4U1HA 4OCYL 5CP7B 2Z8SA 5C07A 2WAHA 1IQDA 2Z8RA 4WTZG 2YRZA 1V05A 3FO1A 5F6HI 1K5NA 3C5SA 2W0FB 3LN4B 3QUMB 4GSDL 3QG6B 1U58A 4MSWA 3SE3A 4JFYB 1EHAA 5E6IB 1XGUB 1F13A 2VN7A 5TDNA 4U0QB 2CDGB 3R0NA 1G7IA 2BDNL 1QQDB 5B38G 3V52L 3BD4A 3VXRA 2HVJA 1YUHB 3DSFH 4O9HL 4ODBD 4QNPF 1T7YA 1HHKA 2WBWB 5F97E 2X1PA 3G6JB 2BNUA 2NY3C 2VDOH 4FQPA 1GXEA 1P7KA 1R3HA 3WFDL 5CEYA 5F1IA 2V9TA 3JWNC 2APWA 4Y16A 2X4PA 2FGWH 5T1KB 1W8OA 4X7SL 1OB1A 3L95B 4NSKB 1VFUA 2XKNB 1U95B 2ATPB 1Q9OA 5GJTL 5DD5L 4DGVL 1A6WL 1BGXH 3VXUD 4U49A 5C0IB 1UM4L 5KANI 3G6JE 2YPVL 5DJDA 5J9PA 4HW6A 1XF2A 4NBYB 1T22B 2CR3A 4A6YB 4KJWD 2F53B 4Q74A 4B7LA 5I6XC 3SKNB 5T1MB 2VOTA 4CN6A 2YD8A 4YNYA 3QUML 2X9XA 2VDRH 4MCYA 1ZSDA 4KPHH 3NA9L 3TBWA 1A9EB 2WWKO 2WUBH 2CXKA 4JFHE 5FM4A 3E6FB 5T3XH 4YPJA 2KZWA 4OZ4A 1Q9KB 1MIEL 2QQNH 2X42A 5EU3B 5F9WC 4M1DL 5JZ7C 4TTDD 2DL9A 5IVXB 4POZD 2F53E 1J8HB 1BIIA 4ALAL 1HZHH 3LKPB 1ZS8B 4RGND 2HG5A 3EOYG 5DEFB 2DQDH 5DJYA 1LO3L 1IGTB 1L0QA 1MCLA 1XMWA 4OM1L 1I3RA 4OKVA 5B22A 1A6UH 4QNPE 1F8TL 3KYMB 3RVVC 1PQZA 2BVTA 3B8SA 4JB9H 5E2WL 1P7QB 3RRQA 43CAB 2HTLD 4ENEC 2DOCA 1G9ML 1VFAA 5K9JH 5L0QB 5IVXE 1QRNB 3ULVE 2E6QA 1JGEA 4KV5E 1UYWL 2B2XH 1LO2L 3VXSE 2FJGB 5DTFB 3QUKB 4F15B 3CNKA 5IJVB 4G9FD 5DFTA 1DQLH 4DW2H 2BC4B 4NJAH 1F11A 3EGSA 3VG0H 3T77A 3DX8A 3FO0H 3UJTH 3QUZB 4EDXA 2VQUA 4M7ZC 5LQBH 1BREA 4R8WH 2WZPD 2FB4H 4GT7A 1RVFL 3MRIA 3ARDB 1S8DB 1QRNE 1RULH 5MEOA 1NMCB 2MCPL 1AO7B 4FQHB 3D69B 4XX1E 3ULVL 4OUUB 4G8GB 5B39B 2GY7B 4O58L 2HKHH 3GKWH 4NWUL 1C8PA 2ARJB 4XI5C 4P57A 3BFOA 4XP5L 3QDMB 1F4YH 3IDJA 3KPPB 4OCXH 1OAZH 1A8JH 2NY1B 1MPAH 1MCNA 1FO0A 5HYSB 1Y18B 1BD2B 3HMXH 4KGJA 5CGYC 4NNXB 5FM5M 1R3LB 1WT5C 4QCIB 3ES6A 4K9EC 3OKDB 4HXAH 1KBGH 1R3JA 3DO7A 4PR5B 1AO7E 3MSPA 4J1UB 1CDBA 2UZXB 1HILB 3PJSA 4G8GE 3BWAA 4PGBA 3O6MH 4L1HA 2NY3D 5D70L 3PDOB 4K3DL 1FLTX 2EKSA 2IAND 3G5XA 3QDME 5LAXA 1FP5A 2D2OA 5FO8A 5D1ZC 4EI6B 2DDQH 1BD2E 2JELL 5CINL 3HZMB 4LLUB 1AGBB 4KJYA 2OL3A 1HSBA 1CD1B 3GSOB 3AROA 1FN4A 4OV6F 4Y2DA 3MRQB 5AD0B 1F6AA 2PYEB 2R1XA 5ADOL 4L1DA 3EFFA 2B1HL 1DJSA 3RZCA 5HHOD 2BSRA 4P2RB 3DHMA 5EZJB 4UT7H 1YA5A 4MAUL 3MREA 5A2LH 1GYAA 3ARGA 1CFVL 2HJFA 4XBPB 3ARPA 2FX8L 4D3CL 4Z0XB 5BRZB 1MSPA 4G8EA 1ZHNA 3LRSA 2QR0B 3LKQA 3QEHB 4H0HB 1MEXH 3TYGH 2PYEE 3I6LD 4Y4KC 2IAMD 3K74B 3QO0A 3UXFA 4KK5C 1E27A 5JZ7D 1LGVA 3MRMA 4NZRL 5J7CC 2VERN 1INDL 1TMCB 3MJ7B 2DJUA 1BWMA 1NMBL 4PJCA 1FZOA 2F54A 1M7IB 1AD9B 1UACH 1UXSB 1VGKA 3WHE1 4OZGA 5T5NG 4XHJC 1U8QB 3LQZB 3OKLB 4XNZC 4DUWA 5E99H 5BRZE 2AKRA 3RVVD 3I02B 1T5WB 3W81A 2Q8BH 1H0DB 5J8OA 5EORH 1V3MA 4ENED 5FB8B 1ZVYA 1MFBL 4WHCA 1GC1H 4DKDC 3EUUA 1PX3A 2X5PA 1CTNA 1IC4H 4XZUA 3K4DA 5D7LB 2VC2H 1RIHH 4GRMA 3QRFM 5T5FL 4EI5B 5K9OA 1SM3H 2GKIA 2DWEB 4L8CB 3QI9A 3NZHH 1KIQA 3QO1A 2NR6C 5SWSA 1UCTA 3GSUA 4AIZA 4MAYC 4GG8B 3TVMA 3VXQB 2XFXB 3AU1B 4U0RC 5ESAB 5DK3A 5D1XD 4CDGC 5GGVH 1EHLH 3UTTA 4QY8B 4WGVB 1JTOA 5D7LE 4NKOA 5GSVB 1C7TA 2VDOL 3V6ZB 2ZUWA 3ARQA 3DSNA 1KPVA 2VDNH 3C2SA 3MLTB 2DAVA 4CNIB 5JHDB 4AZ8A 3LKOA 2FGWL 4HDIA 4KVNH 4QRQA 1G1YA 1SBSH 4LF3A 4N9GB 4LRNH 4LOUC 3S88L 2ZUVA 5CGYD 2Z0BA 1S7TB 1K8DB 3EYVB 4LSRL 3Q5TA 1CIUA 3DROB 2O93L 1ACYL 4XPGL 3QA3A 4JJHA 2NMSA 5H2BB 4OSUH 1LP9A 4X6CF 4MHHG 5E7FA 5FDWB 1HHIA 2WP3T 2HLFC 3O6FD 5JHDE 2WIMA 2YK1L 3RUGB 3ALWA 4RAHA 3T0EB 4CVZB 1QPXA 2D0HA 2VDRL 2XZZA 1IKNC 4MJ6B 4NNYA 1AP2A 4UI2A 3QPXH 3IFPA 2FIRT 5KS9A 4BFIB 1IMHC 1MRCH 3LKSA 3EYFB 1UGNA 2A9NL 3MRJA 1PD6A 2FDBP 4PJ9B 4TUOB 1QHOA 4JRXA 5HHXL 3VJ6A 4F9PA 1ZHKB 3ARTA 1KELH 2VYRE 3U0TB 1HZHL 2P5ED 3T0EE 1WC7B 3SKOB 2GITA 3MRLB 2MHAB 2HT2C 3X3GL 1A6UL 2J4WH 2VB5A 3UTPE 3KG5A 1EA9C 3UBXB 1HXMB 4JB9L 4ZFFB 2NY2C 2VZ3A 3DX6A 5GGSB 1H3VA 4Y4KD 1Y6NR 3KLAA 1UJ3B 3O2DH 5K9JL 4KK5D 1J8KA 2NTSP 3IAPA 2JB6A 1IQWL 4KY1L 2W60B 3O9WC 2DM2A 4TUJA 2M2DA 2DWDB 2R1YA 2C3XA 2B2XL 5FKAB 2LFGA 2D31B 3BP6A 3AS0A 3NGBB 4P3WA 5D5MA 1TVBB 5FYKD 1DQLL 4DW2L 1RUKH 4XHJD 4NJAL 3NCYS 4LLYA 1AD0B 2X44D 2UVFA 3UJTL 5I16B 1P4BH 4PRAB 5LQBL 3WUWA 2GTZA 3BPCB 4JREC 2FZ3B 2J8OA 2XQBH 3OJDB 4HJ0C 4PY7A 3D85D 3MLVH 3O4LB 1RULL 4NNPH 4Q58C 2DBLL 3DWTA 4TNWF 4OCRH 2RIKA 5GGQL 2AABH 4MD0B 4WEUD 3OAUL 2ZG1A 4YPGB 1FVDB 2IWGA 2ZSVA 1F4YL 2NR6D 5E03A 1IZKA 4OCXL 1OAZL 3MTRA 5KBNC 1MPAL 5FA4A 1KCKA 4MAYD 3HMXL 1EERB 1WITA 3FFCB 1OAUH 5EBWB 1YY8B 3HPLB 4LVOC 4RNRA 2I9LA 4HXAL 3O4LE 1T5XB 1QR1B 5FEBA 1JYXA 3BZFA 2WK2A 1Q94A 4I0PC 5HGBB 4ZUWB 1HKLH 4KKLC 4L5FH 1WIPA 3IDYB 3NVQA 4MLSA 4M6OL 4MX7A 5F9DC 4AEFA 4WEMB 5C0DB 4X4XA 4JN1H 4LOUD 3NPZB 3BD3A 2JKXA 3FFCE 4Y4FC 5ID1A 2P45B 4NQEB 1A2YB 1OM3L 3WL9A 1DEDA 3MA9L 1S7RB 2HMIC 1LMKA 1MHHB 4YBLC 5ITBH 5DA4A 1LE5B 3UTZB 2CRYA 3QHTC 4LCCA 2XN9B 2Z4QB 3RGVB 3CPLA 4NKDB 3VW3H 2OP4H 1JMXA 1YNLH 4DTGL 1ADQL 1IGYB 2CQVA 2EXWC 2PXYC 3DX9A 4P5KB 1UEMA 1HEZA 5EC2A 5IMMA 5L9DL 3G5YB 3S5LA 2QBWA 1NPUA 4C56B 4GW4A 4NQEE 4F8QA 5L2JB 2UWEF 2NTFA 1N5AA 3PHOA 2KZ1B 1MEXL 5F70A 4L9LB 4RQQB 5ALBL 1N8ZA 3EO9L 4HC1A 5GS2D 2XN9E 4P3DB 3NBNA 1CE6A 4K3EH 3VGAC 4OFPA 2Q8AH 3QWQB 5IW1A 1XIWC 2CKBA 5IHUL 1C5CH 4WW2F 3BHBA 4C56E 1NFKA 2HT2D 1SEQH 5E99L 4AEIH 1X7QB 5CZXC 1JHTB 4A2MA 4BK5A 1CDCA 1NCWL 2NY2D 1OAKH 3WJLC 3HCVA 4ELMB 5L6YL 3B9KC 1OWRM 1EJ6A 4HFUL 1GC1L 3T2PA 1DSFH 1MCRA 4H1LB 3MV8D 3MV7D 4OF0A 4WI4A 1IC4L 2ICCA 4OQ1A 2AQ1A 2VC2L 1HDMB 1SM3L 5HDBF 5DJXA 3C08L 2DS4A 3TJEH 4RWYL 4IRZH 4MLIA 1JGDB 1IAKB 1NBYA 4JN2B 4QXTB 1NKRA 2EIEA 3R8BB 3AREB 2NY5H 2HP4A 1U2CA 3S37X 5I8EA 2I27N 3RWEB 3FQUA 4HWZB 4JZJB 2GHWB 2FHCA 3UYRH 4ELME 3SQOH 4HJ0D 1EHLL 4PIRF 2UV3A 5EUOF 4OCSH 3EDDA 4M61B 5DUBB 4GG6F 2VDNL 3C60A 1IM9B 3D2UB 1I8MA 2GK2A 3QEGH 1FFRA 4UAOC 2ID5A 3S36L 1JWSB 4MJ5B 1IBGH 3WLWD 4QO1A 4LRNL 4RAVA 2YBRA 3PQYE 4KGLA 2UWEE 1CT8B 4B5EA 5HYFA 1GIGL 4OBRA 4Y5YA 1FCGA 2Z31B 3KXFA 1BIHA 2DYPA 1UB5A 1BMGA 1K2DA 2Q86A 4HWBA 4WUKL 4UQ2A 4Y0GA 3RZWA 2XOTA 5C0AA 1RZGB 4LCWD 2CK0L 5FKPA 1NLDL 3CSGA 3BQUC 3G9VA 3FT3A 3DVFA 3WDIA 4KJPC 1N6VA 2PR4H 3VXRD 4KKLD 1NGYA 1VFMA 5DQJA 1HI6B 2IEPA 3HZVB 4G6FD 3SGEI 2IPKB 1TJIH 1WK0A 5I1DB 4ODUB 4Y4FD 3MXVL 3SGDH 3UZVB 3WNOA 3FZUC 1TTGA 1SEBA 1MRCL 2YKLH 1KYOK 3KHQA 4FFZL 4FTVB 3EIFA 1UWXK 2VH5H 1E4XI 3CCHA 2R0ZH 2HMID 5E8EB 3QZWA 4NZTL 3SOBH 5B8CC 3I6KA 1OF2A 2XZCL 1A6AB 4JG1L 4OLXH 5HDBE 1SYVA 4NN6C 1VPOL 4YQXH 4YHKL 1KELL 1QO3A 1UWGL 5FGBC 3KPSE 2P7TA 1CL7I 1CLYL 3JWOH 3CFBA 1LEGB 2PXYD 2EXWD 3HC0B 2WW8A 3KNBA 4Y2OA 4GKZB 3ZKQD 5C08B 5AUMB 1NJ9B 2J4WL 5F7FA 3BIKA 4FTVE 4PREB 2GYSA 2M8XA 1A4JB 4JM4H 1YEDB 5IHLB 5IW6A 5HGAA 5J11C 3O2DL 3ARFA 5HGHA 5DQ9B 4ESKA 5IM7A 3HKFA 3JV5A 5D1QA 5DR5L 3P2TA 2ZWLT 1XIWD 3SCMA 4GXVH 1DQTA 4PJ8A 5HXMA 3FO9A 5EG6C 4QHUA 3T8XB 3MJ9H 1U8IA 4BFEA 1RUKL 1YQ2A 5C08E 3WN5B 2IFGA 3U1SL 2EE6A 5CZXD 3OJ2C 4FQLH 5LGJB 1P4BL 1QHPA 2W0KA 1LK2B 3UCRA 4M93C 1GCFA 5CILH 4KK9C 1IEAA 2QSCH 3B9KD 2XQBL 4FQXA 4WTXA 3MLVL 4NNPL 2FO4B 4X6DA 4E0RA 4U1GB 4P9ML 3ZL4H 2CRIA 3IAGC 1SJEB 4U6HB 4OCRL 1QFWL 4R90L 4OJFL 2EDYA 5FYJD 3VA6A 4YIQA 4FQIH 3DURB 4UILH 1UB6B 4Q9RH 3M17A 3PWPD 3V6FB 4N0FA 4E41A 5E9DB 4QTHB 3T09A 3QQ4B 1F6FB 1N3NB 3QUXC 4X9FA 2ICWJ 4JVPA 3RJQB 2VLKB 3ZKMD 1MCWW 2DQFB 2OLDA 3ESVF 4ACPA 3TIDB 4NN7C 2EDJA 5IF0B 3HZKA 4QGYA 2QHRH 2HFFB 1OAXH 5LJYH 4NQTA 4PRID 2HLAB 1TPXC 2I24N 1JYNA 1LO4H 1LO5A 1VEMA 4RIRA 3TT1H 3GK8H 4CADB 3DRTA 3MR9B 2J3SA 4ZUUB 5E9DE 4NQCA 3O2VL 1JV5B 2ZPKL 1VEOA 3HR5B 4NC1E 2VLKE 4M4RA 2Y5TA 3NFPB 1ITCA 5ENWB 3GMRB 1OTTC 4CN4A 3OBAA 3UP1A 1AQDA 5ITBL 3GZKA 3BQUD 5HVHB 3CLEL 5CD3B 1FFNA 1MAMH 4KJPD 3QCTH 1AFVH 3VCLB 4MVBD 3T1WA 2F8VA 4LRIA 1ITBB 3AMLA 2HFGH 2OP4L 3MLZH 1JWUA 1CD9B 3BMWA 5KW9H 2IGFH 4OD3H 5IMOB 5ICYB 1I8KA 3WMSA 2GCYB 3FHAA 4UNTA 2VDPH 4I48B 3DMMD 3FZUD 3RTQC 2AEPH 5IJKC 2YZ1A 4XMKH 2NXZB 2UY7A 2CPCA 3RIAK 1WTLA 2NYYC 4Z7WB 4X6BA 1KTLB 3BMVA 1TZIA 2XXCB 2VXSH 3NTCH 1A6ZA 4XP9H 3BEVB 3SDAB 2P24A 2H26A 1FG9C 1C5CL 2DD8H 4DN4H 4UT9L 3DUSB 3RL1A 3GSNA 4EDWH 4YWGH 3GSXB 3DRQB 3RZCD 2R69H 4NDMB 1OP3H 3TBTB 3MRGB 3RWJA 4LHJB 5I8OH 2VXTH 4HUMB 4Z7WE 5IW3A 4F7TB 1T1YA 3CSYB 4O02H 3I3DA 4Z0BL 4UOW0 5IB3A 1EAJA 2MWCA 3CFCH 1TIUA 3F12A 3MLYL 2JIXA 4QHLB 4Y8AA 3U0PA 2I07A 2GTWA 5E6ZA 4PJAB 2BOBA 3X13A 2XY2A 1F90H 4N8VB 2Y06L 1TVDA 1DVFA 4IIQC 4IRZL 4QRSB 4AK1A 1S7SA 4MGXA 3STLB 4K2UL 3VXMB 4WNQB 1XF5A 3VGGA 4JQVA 3ARRA 1C12B 1SYSB 3SBWA 5JMOC 2F54D 1NGWA 1MELA 3UYRL 4LNRA 4KK9D 4FXLA 5DEGB 4PG2A 3SQOL 1FZKB 2GSIB 4OCSL 3MUGA 1Z6JT 1MIMH 1YEKH 4R3SA 4B53A 2O61A 2VQ1B 5BV7B 4ZPTA 4WFFE 1LQSR 4AMKL 3PDGA 1VFOA 3QIBB 5DJAA 4HUVB 5L2KB 3VXME 4K23H 5KG9A 1WF5A 4JG0L 5TPWH 5JIPA 1I1AA 1X5LA 2AJYL 2EIZB 1D5IL 1A1NB 4GW1B 4W4OC 1WZMA 3QUXD 4MA3A 3JV0A 3L3DB 1FCCA 4P9HC 8FABA 2AAVA 3N0PB 2G9HA 1KJVB 1I8IB 4S2SA 3QXDB 4LMQE 4OLUL 3EDEA 4EZMA 4GQ9L 2H9GA 1S7VB 3R8QA 4U6XB 3MOBL 1PSKH 5JNYB 1CZ8H 2ARJQ 5L2KE 1FIGL 1I7ZA 5C0CD 1TJIL 4OZFA 5FCSH 5DO2C 3SO3C 1K85A 2EDDA 5I71B 4NFDA 2YKLL 5HVFB 1G1CA 5CP7A 2R0ZL 3SOBL 1OTTD 3HZYB 1MI5D 4I4WB 3B5GA 2DLTA 5DZOA 2W0FA 3LN4A 3R1GH 4JKWA 3QUMA 3QG6A 4JFYA 4FQJH 1B9ZA 1H3GA 5E6IA 4LLVB 3JWOL 1XGUA 3MV9A 4GKNB 1S5IH 1QD0A 4U1NB 1V5JA 2CDGA 4XH2B 3RL2B 2GEEA 1QQDA 1ZK9A 1CGXA 1P6AB 1NGXB 3D0VB 4I8DA 3BZEB 1XT5A 4ERSH 1PZ5B 1YUHA 3RTQD 3Q5YA 2J2ZA 5T1LB 1J11A 1OWWA 3AY4A 3G6JA 4PJXF 2X4QB 5GIRB 3NCCB 2NYYD 3HNVH 4IMLB 3MRCB 2GUOB 1U8OA 5FO7B 3VE0B 1E6JH 2V7NB 4GXVL 5T1KA 2IALB 2L7JA 3L95A 3MJ9L 1JIBA 3U4BH 4PS4L 4NSKA 4PGJA 4ZSOB 2XKNA 3U7YH 2ATPA 2FHFA 3IDNB 5F7UA 1AI1L 4FQLL 4OGZA 5C0IA 4MYWB 4HWNA 3C8DA 5TE6L 2CRMA 4YDJA 5CILL 1OGAD 1HQ4B 1T22A 2ICWB 4MNQB 2BK8A 2F53A 5GS0H 3MODL 3ZL4L 4L3AA 3SKNA 5T1MA 1ZHLB 3T4YB 1U3HC 5E4IA 4ZPVB 4NIKB 2IQAA 3SDXF 1P2CB 2OK0L 4HUXB 3Q3GB 4FQIL 1A9EA 4UILL 4ZSOE 3OGCB 4LGPB 1UKTA 3E6FA 3UJIH 4U33A 2YPLD 3THMH 5I8KH 3BYYA 1KLGB 5EU3A 4QHKI 4YEEA 4ONHB 3I50H 4MNQE 5IVXA 3K2UL 4YK4B 4QOKD 3EYUL 3TBSB 5C0BD 1CICB 1ZS8A 3NOIA 3IFLH 4XPAH 3BYTA 3L5WA 5CUSH 3VXSA 3GIVB 2QHRL 4UT6H 3LQAL 5DEFA 3UYPA 3GJFB 3I75B 1IGTA 5IB4B 5D7KE 3TT1L 3KYMA 1WISA 3LMJH 1P7QA 3RHWK 43CAA 3MBXH 3E2HC 3LPWA 5DA0B 2NY0C 1YN6B 4XPHH 1QRNA 1JF1B 4IRSC 2B20A 2B7DT 2VDKL 4N8CL 2XTJD 3B43A 3HE6C 1ED3B 4G3YH 2FJGA 4KMLB 1RUQL 1MAML 4CDHA 3QWRD 1JUFB 4XCCH 3ZKXC 2MQ0A 2PO6C 3QUKA 5IJVA 2HFGL 4MXVF 3D25B 3BXNA 2BC4A 3C8KB 5IVOA 3PL6B 3MUZ1 5KW9L 3MRRB 4BQ8A 2EDNA 3OKEB 3QUZA 3JTTB 5DO2D 4Y5XB 5GRVL 2VE6B 2VDPL 5A16B 3ARDA 4XMKL 1FJ1B 1S8DA 5DD3H 5JOPD 1YEHH 5B3JF 1AO7A 3D69A 4OUUA 3CH1B 5B39A 1BBDL 3WCYA 2A6IB 2VXSL 3NTCL 1JL8A 5DLML 2ARJA 1MVUB 2DQCH 3DGGA 4FXKB 3QJHB 4XP9L 3QDMA 3KPPA 1RI8A 3U4EB 3TGXA 5HYSA 5DMIH 2DD8L 1Y18A 4DN4L 1BD2A 3FRPA 3CZJA 4NNXA 4O2FB 4EDWL 1R3LA 4QCIA 4HIEB 5IOPB 3OKDA 3TNMB 1DQQB 4PR5A 1T0NB 5INCB 4J1UA 4DEPB 5I8OL 2VXTL 2W1NA 5HYJD 1UM6H 4LLWA 4MMZC 5F1NA 3SDCC 4O02L 3PDOA 4IRJB 1NDGB 3CFCL 3D39D 3RWDB 2Y9RT 4XAWH 1BQUA 4JPIB 3CD4A 2WINB 2X1XR 3RAJL 4DK3A 1EUUA 1ZWIB 4XNXL 1NC4B 1F90L 1UM5H 3LEYH 4M5YH 4EI6A 1RMFL 3PWJB 4MDIB 5E5RB 4HH9B 2DIBA 3HZMA 1AGBA 4LLUA 2BCKB 5AZ2L 3GSOA 2RB8A 3MRQA 5AD0A 3HNTH 2PYEA 4GOSA 3VI4E 4MJIB 5DI8B 5E4EB 5F6IB 2BMKB 5M94B 2EICA 4DKEH 1D7FA 1G6RH 3ILPB 1I1CA 5EZJA 2VZUA 4MXVE 1H8NA 1U3HD 3ULSB 1MIML 1J05B 1YEKL 4PJEF 1OQOA 2X4TB 4XBPA 3KYNB 1NCUA 2VISB 4Z0XA 2BVQB 3X17A 5BRZA 3PHQB 4EQ2A 2QR0A 5GZOC 2HT3C 3QEHA 4LU5H 3F6IA 5TPWL 4RFEB 5E24E 4XXDB 3IJSB 4MJIE 4O2EB 4H88L 3SQBA 5DUMH 4JGUA 3MJ7A 1I85C 1XH3B 5FUCC 1CBVH 4EUPH 2VSCA 1CFSB 2ZNXA 1M7IA 5F7EH 1AD9A 4Y5VB 3HG1D 1CGSL 3UJJL 3BAEH 4LEXH 4PJIB 1QTYT 1U8QA 3LQZA 3OKLA 1KTKE 4MWFA 1NBQA 3I02A 1LEIB 1T5WA 3VFMB 3UTSD 1T1XB 4N90D 4ELKB 5GGRA 1MWAB 1H0DA 4NBXB 1AR1C 4NO0D 5FB8A 3D1MC 2NY0D 1R5WA 1RK1B 1G7JA 5TE7L 4IRSD 5TDOB 5D7LA 1SJHB 2OR8A 4EI5A 4TVPD 4DVBB 3DARA 2DWEA 4YXHL 1UVQB 4WRLA 4L8CA 1A0QL 4PJIE 5SWZD 5E2VH 4GFTB 1GGCH 4GG8A 4XVTL 4ODHL 3VXQA 2XFXA 3AU1A 1PLGL 4WU7B 5ESAA 1I7UB 1YQVL 1C08B 3HR6A 4QY8A 3F7YB 4TTGA 5GSVA 1QSFD 1VGEH 2XZQH 2MOVA 3V6ZA 1HQRB 3HNVL 3MLTA 4CNIA 5JHDA 2YPKB 7CGTA 4N9GA 3TF7C 2HN7B 3IXAB 3U4BL 5CZKA 4JFED 3RQ3A 5IB5A 1K8DA 4JKMA 4JKKA 3EYVA 4PY8I 3JTSA 3DROA 3CAFA 3EYOB 1MWAL 3K8LA 1RFDL 1C16B 3GHEL 5KOVC 5H2BA 4PGZA 3T4AB 6CGTA 2VL5B 4WFED 3VXUB 1PVHA 3SDCD 5FDWA 32C2B 1UZ6F 1Q0XH 3WS6A 4TOYH 3T0EA 5DUPH 3CXHK 4WI2A 4YXKH 1VB9A 2AJXH 1DLFL 3ARFD 1RZKC 3KR3H 2E9IA 4BFIA 4KRPC 3EYFA 3THML 3NACH 5DWUL 4I3GA 1RUPH 4ODXB 1DN0B 2Y07H 2W0PA 1T03H 4NQXB 4TUOA 1CXKA 3LS4H 4I2XB 2AVGA 3VXUE 3SHSA 1ZHKA 3E1F1 5E2TH 4I9WD 3ME0A 2LVCA 3U0TA 1M6OB 3ROOB 3L6FB 3HNSH 1WC7A 3K81A 3SKOA 5KVGL 4UT6L 1JZ5A 3GUTB 4L8BB 3PP3H 2P8LB 1ZT7B 1H3UA 4RGNB 3MRLA 4M43L 2MHAA 3EFDH 3HMXA 1QA9B 3UBXA 5GZOD 1HXMA 2HT3D 1BJ8A 3LMJL 3EW3B 2VLRB 5GGSA 2DLFH 1UJ3A 3MBXL 1JNNH 1N6QH 3TT3H 3AB0B 4PRHD 1RHHB 4JPWH 3MUJA 4MNHB 3U9UB 2W60A 5E8NB 1ND0B 4OD2B 2DWDA 1J1PL 5FKAA 2QKIA 2D31A 1EEYB 1OW0A 1TVBA 4RGNE 4MB5A 1IAIM 4NRYB 2UYLB 1AD0A 2PTVA 2QQQA 1JFQH 2F5AL 2GY5A 1NBVL 1YEJH 2JJTA 5I16A 5I0DA 2VLRE 4G9FB 4PRAA 3U46B 1AR1D 2FZ3A 3OJDA 2XKUA 3LN9A 3LQMA 3O4LA 1YEHL 3O0RL 3QCUH 1UZ6E 4EEEA 1JNJA 1B4JH 4JY5H 3N1FC 5IFHH 5C0FB 4YHMH 1G9NH 3V0AC 4AG4H 4G7YH 4MD0A 2DQCL 4YPGA 1ADQA 1FVDA 4ZS6C 1W0WB 4F33B 2MCG1 1JZ2A 3LSOA 3VH8B 2CXGA 4G9FE 3FFCA 2R2BB 1Q72H 3O3UN 5EU7E 4UTAL 4HS3B 5EBWA 1YY8A 3HPLA 4F37F 3NCBB 1T5XA 5EA0H 1QR1A 1NC2D 3MGTB 1UM6L 4JO2L 5HGBA 3A6OA 1PG7H 4ZUWA 4N5UA 4XAWL 2LVEA 4PJDF 2DI8A 3CH8A 2NY3B 5C0DA 1T1ZB 1NAMB 3HC4L 2GK0B 1DQMH 1TJHH 1F5WA 2FBOJ 4HV8A 2IANB 5DJZB 3KLDA 3RKDC 4NQEA 1XZ0B 2GW5A 1M71B 2PF6A 1PKQB 1S7RA 2BVPB 2WBJC 3D0LB 3MLXH 3HNTL 5GS1C 1MHHA 2CH8A 1LE5A 2HYMA 4PTUB 2AJVH 3UTZA 3MNZA 2XN9A 2Z4QA 3RGVA 4PJHF 5HDQL 1T7XA 3MJ8A 1ULVA 4NKDA 1JZ6A 1AQKH 3BGAA 5KSAC 5CIPB 1SQ2N 1IGYA 5FM8A 4P5KA 3CMOL 2YA0A 1A7NH 5INDB 5I6XB 3G5YA 2IANE 1UKQA 3BZ4B 1Z3GH 6FABH 4C56A 2C3VB 4JKPH 5L2JA 4ZYKB 3HI5L 1PKQE 5ADPL 1BX2B 2CIKB 1ORSB 4L9LA 4RQQA 1YMHB 2JIXD 4M9PA 1N4XL 3OKOB 4Z8FH 3UO1H 4P3DA 5DUML 3ZDYE 3GSRB 5F9WB 4PJDB 1PFCA 1KOAA 3CK0H 1EEZA 3RWIB 3DI3B 1IAMA 1CBVL 1MJ7H 2KPNA 2MQ3A 2EYRB 5F7EL 5E8DL 3NABH 2VZVA 4LEXL 4DAGH 1NAML 4GXUN 1T89A 3ZE1F 4RRPA 2QADC 1X7QA 3OXSB 1LDPH 4XCEB 1FL6B 4ELMA 4LLDB 4ETYA 4K71C 2EEAA 4H1LA 4R26L 4OI8A 3PXHA 3I6LE 4PJHB 3NFSH 4PJDE 2JJVA 4JO4H 1HDMA 4OT1H 2V17H 2YWYA 1MAJA 2PNDA 3EOTH 2J12B 3SGJA 4ODSL 3WIFB 1JGDA 1IAKA 4JN2A 3IS1X 4QXTA 3RI5F 3PQYA 2UWEA 4P23A 3HE7C 5HTSA 5D6DC 1GGCL 3OMZA 3S36X 3RWEA 4WCYL 4UU9B 1U8MB 4HWZA 4JZJA 4PBWD 4RISL 5E6YA 5EN2B 1A3QA 4MNGB 1U8NB 2WM0A 3MUY1 1PAMA 4HK3J 4PJHE 3WXWH 4M7ZB 4KKAC 5LGHL 1CDHA 4M61A 1VGEL 2XZQL 3FN0H 4J3TA 4TNWK 5DUBA 5J6HB 4F57L 4P5TC 3DOSA 2QJDA 1IM9A 3D2UA 2B5IC 1OL0A 5GS2H 3X14B 4LDOB 2VUOA 4XVUC 3WD5H 1JWSA 4MJ5A 4ZS6D 4KRLB 3A6BH 1W8NA 4JEGB 1KN2L 3IJHB 1CT8A 3CZFB 1A7BA 5DJ2A 2ITDB 3RY5A 2Z31A 4PV9B 4PYHA 4PRDB 1U8KB 3O2DA 4M3JA 4TSBH 1RZGA 1GPOH 4Q9CA 4DN3H 1CS6A 3B9EA 1L7TH 3KPSA 4G6AC 1Q0XL 5FYLH 4XCFH 4TOYL 1HI6A 3ZE1E 2KKQA 3HZVA 3PV7A 4YXKL 2IPKA 5I1DA 2AJXL 4ODUA 3KR3L 1CL7H 4EN3C 5J13C 5D1ZB 1IKFL 4V2CB 2OXHA 4FTVA 2DQJL 4LSPH 3NACL 4OFYA 2WBJD 5E8EA 2EDRA 5DJ0B 1T03L 2D7NA 1JGLH 3LS4L 5F7MC 1A6AA 4LARH 4UOJA 3QR2A 3P0VH 3H42H 4ZFGH 1XGYH 3HNSL 4RMTA 5KSAD 4D94A 4GMTH 1LEGA 4PG9B 3QCVL 4JJ5B 3HC0A 3A67H 1V7NL 4GKZA 4LKXB 5C08A 1NJ9A 4FNLH 4EBQH 3KPNB 4DKFL 3TIEB 1A4JA 4KRNA 3RBGA 4BSWB 1YEDA 1J7VR 4AIXA 2DLFL 4XWGH 4ZQKB 2BFVH 5E1HB 1TNMA 5DQ9A 3TT3L 4JPWL 2VQTA 5CJQL 3SJVB 4K9EL 2OBGA 4WHDA 4XNQB 3NH7H 2F8XC 4FQCH 5FA3B 5GGRY 5E95B 3T8XA 4DCQB 4PLNC 5I1EH 1KIRA 3GBMH 2P5EE 2IPTH 3WN5A 1JFQL 2QADD 2NQCA 1J8HD 5LGJA 2EIBA 1LK2A 4UV7H 4XNZB 3ECBB 4NGHH 5IG7B 5F7YC 2FO4A 3CU7A 2B4CH 1UH3A 1H3XA 5IFHL 1SJEA 4YHML 4U6HA 5JR1H 3VFPB 1QLFB 3BH8B 1P7QD 3I9GH 5IBTL 1ZT1B 4CRPA 4R96B 1UB6A 3S5LG 4MQTB 4Y88A 1JK8B 2R4SL 3HE7D 3F62A 3U36B 2DM7A 4RGMC 5E9DA 5FYKE 1Q72L 3MZGB 3QQ4A 4K7FB 4YFLI 3GO1H 1N3NA 5HVWA 2VLKA 2DQFA 1NKOA 4MAYB 2VDQH 1YECH 2WUCH 5EA0L 1PEWA 3TIDA 4KKAD 5IF0A 1KJMB 4U0RB 2HFFA 5C9JB 1PG7L 2HLAA 3QP3A 3QUZD 1N64H 2CUIA 4S1RL 4XVUD 2YOCA 2VMFA 4OI9A 1U91B 2AQ3A 2UY6A 2DQGH 1DQML 4CADA 2X41A 1TJHL 3MR9A 4ZUUA 1FDLL 2EYTB 1WIUA 4MQXC 2G75B 4POUB 5L88L 1KSRA 5EBLB 4G8GD 1JV5A 3HR5A 4IMKA 5FYKL 3S34H 4IDLA 2ADJB 1NCDH 2N56A 3MLXL 3NFPA 5E2UH 5ENWA 3GMRA 2FRGP 1A7QL 4LSVL 3V0VB 3G5VB 2IFFL 5CD3A 3D5OF 3FQNB 1P5UA 2AJVL 4HKXB 2OCFD 3VCLA 3QDGD 2CD0A 2IBBA 4G6AD 2Y7QB 2Y36H 1U3JA 2OXGA 1AQKL 1KACB 5IMOA 1CLZL 2GT9B 5ICYA 3VFUB 4XWOC 2GCYA 2DIAA 4QRPD 4Q0XL 1OSZB 1Z3GL 6FABL 1A14H 1HH9B 3NAAH 4HIXH 4NQVA 1WVZA 5FYJH 4I48A 4JKPL 4EN3D 4JRYD 5DYOB 1FC1A 4Y1AD 2RCSH 2P5WD 4TQEH 2BXYA 2XT1B 4WVRA 4Z7WA 3Q48A 4LSUH 1F3DJ 3UO1L 3SKJL 5A2JH 3IKCB 3KLHC 3LKNA 1KIPB 2JCCB 1RZJC 3BEVA 5KVMC 3MNWB 1MJ7L 5GGSY 4A2LA 5HHQA 1PG7W 1F3JB 3D87B 3NABL 4JQXA 1CYGA 3H9HB 3DUSA 3Q6GH 4DAGL 1I7RB 3GSXA 3DRQA 4OCWH 3BESR 2VNCA 1UCBH 4NDMA 4P2RD 3RWCB 3TBTA 2DQTH 4X5LA 3MRGA 5J56B 4M6AA 4ONGL 1CF8H 4PRBB 4F7TA 5K9KA 2NY2B 2JCCE 1Q9WB 2G2RA 2B39A 4TSAH 4JO4L 4OT1L 2V17L 4I5BA 4QHLA 5JO5B 2FL5A 3MV7B 3O9WB 4BUHA 3EOTL 1DL7L 4N8VA 4UB0H 5CSBA 4KXZI 2AEIT 3AVEA 4Y4HC 4QRSA 3S3SA 1EVUA 5C6PB 3STLA 2JJSA 5B38B 4NUJB 3VXMA 4WWKC 4WNQA 3CFDB 3GB7B 1FYTD 3PIQB 1C12A 1SYSA 3EYSH 2HKFL 5DEGA 1FZKA 1KEMH 3IS0X 1AXIB 1FPTH 2DL2A 4K55A 3WXWL 2A6KB 3SKUD 2GSIA 4JREB 3WSQL 2XKSA 4GMSH 1DBMH 4LQFH 3MV7E 3ZE2F 4YHPB 2VQ1A 3Q1SH 1CLOH 5GRUL 4D9RD 3QIBA 4HUVA 3A6BL 5L2KA 2OL3H 3ARWA 4NCC1 5IESH 1N2RA 1T7ZA 1N5YL 4J8RA 4CMMB 2H2PC 2EIZA 3RX5A 1PEZA 4HD9A 4L4TD 4GW1A 4MJ4A 4B41A 3L3DA 3HMWH 1U8JB 3PABB 4ZXBC 4TSBL 3V6BR 4XP1H 9CGTA 1I8IA 1KJVA 3LH2H 4LVOB 5FGCE 3AM8A 1JZ3A 3LD8C 5ESQB 1S7VA 1L7TL 1HN1A 4LCWB 4U6XA 4XCFL 3V7AE 5JNYA 1J1XH 2V5MA 3MJ9A 1F4WL 4I0PB 1BBJB 4P5MB 3AS2A 2X7LB 1BWWA 5CJXC 2ICES 4GH7B 1DFBH 3MMEB 4H5SB 3RVUC 1CDGA 4G6FB 2YMXH 2BJMH 3BW9B 2NY4C 4Y4FB 5DQDH 3HZYA 3IGAB 1JGLL 1G7MB 4I4WA 4LARL 5AEAA 1RK0B 3QEQB 5F9JB 1HOCB 5EU6D 4UDUB 1X5FA 2KDGA 3WO3B 3GSWB 5L8KB 4LCWE 3P0VL 3H42L 5K59F 3F58H 4YBLB 3TH2T 4LLVA 4ZFGL 1XGYL 4FMFA 4GKNA 2X4SB 2FNBA 4GMTL 4U1NA 4XH2A 3RL2A 1GGIH 1DCLA 1OP5H 3A67L 3KYKL 3BZEA 3D0VA 4XWOD 1RZ7L 3L3OB 4R6UA 5BXFB 1KCLA 2PXYB 3O6KH 4CJ1A 5T1LA 1A1MA 2E7BA 3VRLF 5J3HC 1IRAY 2X4QA 1FH5H 2OTPA 5GIRA 1KFAH 2R23B 3QEQE 3PHSA 1CD8A 4JGMA 3KLHD 4IMLA 3MRCA 2GUOA 3V79C 1WZLA 1U0QA 1WFNA 1U6AH 1PY4A 3VE0A 1ZLSH 3NH7L 2V7NA 2D9CA 1Z9OA 2W38A 1WSST 3QQ3B 4FQCL 2FH8A 1OT1A 5KSVA 3VGAB 3GBML 3CVHB 4PJ9D 2AXGB 1NUFA 3STBA 4ZSOA 2XWTB 1XIWB 4YR6B 3HRPA 1T21B 4D2NA 1YEGL 3IDNA 4JPKH 2YD2A 4XPFL 1FNHA 4UV7L 1FYHB 1HQ4A 3MJ6A 2X70B 4NGHL 1BPVA 2ICWA 4MNQA 2XRAH 5AZEL 1CFQB 1GL4B 5CKAA 3GIZL 3IF1B 3MOQA 1ZHLA 4JE4B 5EFIB 3T4YA 3B9KB 3TA3C 5IWLA 4ZPVA 2JTDA 1P2CA 3SDYH 4HUXA 3Q3GA 4ZDHB 4Y4HD 3RGHA 4RBPH 4WWKD 1PZUB 2O5XL 1Q0YH 1KLGA 1BVZA 3GO1L 1EMTH 2FX9H 4ONHA 3PWPB 1YECL 3TBSA 1CICA 4MQSB 4RGOL 2I60H 3AREC 3GIVA 3GJFA 4UTBH 3I75A 5IB4A 2CUMA 3NCYP 2CO7B 3CVHL 4PRIB 1D5BB 1I3VA 2X40A 1S7QB 1XFPA 5FYJE 5T5NF 2P42B 3V8OA 1MHPL 1VENA 5D4QA 1CFBA 4UAOB 4X0KB 1MFCL 2D7QA 2H2PD 5H35B 1SJXA 4BUGA 4U6YA 3S34L 4HX1B 3PWPE 1YN6A 1JF1A 4JPVH 4ZXBD 5E2UL 3BI9X 3V2AR 1NUNB 1ED3A 3ZYIA 3UX9B 2MKLC 1JUFA 1QFUH 5KN5B 2XI9A 3IVKB 1W0VB 1BHGA 3BQUB 1DTUA 2D7TL 2Y36L 3D25A 4DVRL 5HBBA 3C8KA 3PL6A 2X4RA 3MRRA 1NMAH 4PRIE 1J0YA 4EXKA 2R2CA 3OKEA 5IKCB 3L3HB 2V5SA 1IGIH 5EBGA 3M8OH 3JTTA 3TYFB 1A14L 4Y5XA 2VE6A 5FYJL 3BJLA 5A16A 3RVUD 1FJ1A 2ZG2A 3VFTA 4JHAL 2NY4D 1H15B 4TQEL 5JQHC 3QXAB 4HPOL 2BY3A 2A6IA 1EHXA 1UKSA 1MVUA 5B8CB 5J0BA 3UBXI 4FXKA 3QJHA 1P4LB 3FQTB 4NN6B 3U4EA 4OZGF 4PUBH 3Q6GL 4O2FA 2OZ4H 3NCJL 4HIEA 4OCWL 5GS3A 1CU4H 5GRVK 3RGVD 3TNMA 1DQQA 2DQTL 1T0NA 1AHWC 5J3HD 3QQNA 1DEEB 1L4IA 4B7IA 2VR4A 4NZJA 2CR6A 4IRJA 1NDGA 5J11B 1M1SA 4P9HH 4CW1A 2WINA 2HAZA 1A3LH 1ZWIA 3U9PL 4U7KA 1NC4A 3PWJA 4OM0H 4MDIA 1K3IA 3SDDC 2BCKA 5HYQB 5E0QA 1NGZB 1U8PA 4OBSA 1HWHB 5DMJB 3DUUB 3EYSL 4OLYH 1OP3K 5TJWK 4MJIA 5DI8A 1B90A 3H0TB 2BMKA 3TZVC 3WKNA 1KEML 5C1MB 3U0WH 1FPTL 1KCUL 2P43B 3O2WL 5I17B 4YDIH 5GRYA 3ILPA 4M93B 4AT6B 4LHQB 2VLLB 4XC1H 3ULSA 3TA3D 1J05A 2IF7A 1DBML 1D9KC 4GMSL 4LQFL 5EULV 2X4TA 3KYNA 5IK3B 3Q1SL 1CLOL 1IGMH 4WFHD 1EJOH 2CDFB 2VISA 2BVQA 3MLSH 4GJTB 3PHQA 5IESL 5IV2B 4RFEA 3FMGL 4MZ2A 4PPTA 4XXDA 1EEQA 3IJSA 1JHLL 2W0LA 4GAJL 3G5ZB 2E9WA 3L1OH 3BKYH 4O2EA 1BZQK 1K9TA 1MJ8H 1OAQL 1F6LL 3QULB 3TWCL 1OQXA 2X1QA 2BHYA 4JFZH 1XH3A 5IP4A 4XP1L 1FAKT 3QUXB 5SX5H 3ARED 5FF6B 1CFSA 2F8OA 3BUYA 4Y5VA 3MA7B 4CU7A 4EVNB 3S96B 4M7LH 4NN7B 4PJIA 2ZCKH 3QSKB 2CDEB 5FAAA 4KROC 4P2OC 1TPXB 5C6TH 1LEIA 3VFMA 2AI0H 1T1XA 3V4VH 5KS9F 4ELKA 1MWAA 4E5XB 4H26B 2YMXL 5C0CB 1RK1A 2BJML 5F3HB 5C09B 5DFWH 5TDOA 5I73C 5SX4I 3MLWH 1SJHA 4G42B 2R29H 4DVBA 4ORZC 5DURD 2EDHA 4J3OC 1UVQA 3S37H 1N0XH 4LPVA 3F58L 1MI5B 2JE8A 3FB8B 2RGSA 5C2UB 3KPRD 4KWUA 3MFFB 5GZNC 1R24B 1X5AA 1Z2KA 5JXEC 4WU7A 4HKZB 3O6KL 5C0CE 5I1KL 1I7UA 4OIIL 1GOGA 5C09E 3F7YA 4L3ED 5IT2H 4RX4D 1FH5L 4FFWC 3G6DH 3RTQB 2IMMA 1FNSH 1HQRA 4PJ5D 3DIFB 1U3ZA 4FZ8H 2YPKA 1U6AL 1MI5E 1ZLSL 2NXYC 1SMOA 3CFKB 5D5MF 2X05A 2HN7A 4JFDB 1BQSA 3IXAA 3KPLB 3WNPA 2IQ9H 1LD9B 1CXHA 5KVDH 3EYOA 3RVTD 1QFHA 1C16A 4JPKL 1G0XA 4BM7A 1UADC 3T4AA 3F65A 2VL5A 2XRAL 2IBZY 3VXUA 3OG4B 3QUYC 3EHBC 1S7XB 1P69B 4X99B 5EWIH 1DBJL 4R4FH 3UC0H 1D5XB 1OGAB 5T1DH 2BY1A 1YYLL 3BGFC 1HINH 4WO4C 2WANA 4HZLB 4TVPH 3RWGB 1YEFH 3DETC 3SDDD 4X7TB 2FCBA 1B2WL 4M7KH 1TCMA 4ZG1A 4HWBH 4R9HA 4ODXA 4IIQB 4J3SA 1DN0A 3DO3A 1GGBH 4NQXA 3ZTJG 5BW7C 5FOBB 1MRFH 2FX9L 4PJ8C 2YPLB 2DMKA 2BVYA 2CRZA 1M6OA 1OGAE 1WAAE 2I60L 5I8CB 3ROOA 4KJQC 3B9DA 1TZGH 3L6FA 4JKLA 3GUTA 1D9KD 4QOKB 2W9EH 3VFVA 2P8LA 1ZT7A 4L29A 4UTBL 4YO0B 3P4LA 2XZAL 5I15H 3MLUH 2LU3A 2VLRA 3FONB 1A21A 2YPLE 1RHHA 4JPVL 4MNHA 4MS8C 5E8NA 1P84K 4FFVC 4OD2A 5I1HH 5DHXB 1A7RL 3C6LC 1BFVH 5E2JA 2SEBB 4QOKE 4Z7VF 1QFUL 2ZUXA 3CLFH 4LVNC 4GUPB 5E9DD 5C0BE 3F7RA 3UTQA 1FZJB 4J3WA 4R4NC 5EZLB 4M8QB 5DGQA 1MCSA 4NRYA 2UYLA 1AE6H 2GSGB 1NMAL 1TDQA 4KVCH 4KROD 4P2OD 1QP1A 3FAXA 1IGIL 4G9FA 3M8OL 2FJFB 3QAZC 5MERB 3PGDB 2CLVB 1QFWI 1ZA3B 1IEBB 2GJJA 3SO3B 4G6KH 5C0FA 1KLFA 2ARWA 5HPMB 3HFMH 4QXGL 4H8WC 4GKSB 5CSGA 5AWNL 1W0WA 4F33A 3JUYA 1UT9A 4DUXA 2DJSA 4PUBL 1UA6H 3VH8A 1MCPH 2R2BA 2OZ4L 1CDIA 5GZND 4HS3A 2CUHA 4HBCL 4PJ7B 5CD5C 1CU4L 3O3DB 1KF9B 4WV1C 3GMOB 5DD1L 5H37H 4FFWD 3MGTA 4WHYH 5JOPE 2BRQA 2DM3A 3N50A 5GHWH 4PGCA 4X7EC 3C5JB 4P9HL 1MF2L 5HYJB 3WIIH 1GOHA 3IKKA 4Y19D 1A3LL 1T1ZA 2NXYD 1NAMA 3D39B 4OM0L 2IANA 5DJZA 3NA4A 1XZ0A 3G08B 4FOMA 3O3EB 4PGEB 1FNAA 1M71A 1PKQA 2MSPA 3NN8B 2BVPA 3D0LA 4OIBA 4OLYL 4JCLA 3SDAD 2BNQD 2UZYB 3E6HB 4PTUA 1E0OB 5CJOH 4JVWA 3ABZA 3OR7B 4Q2ZA 4XC1L 1NANH 5HYJE 1V8HA 4WO4D 3VFGH 1MCOH 1JVKA 1NCBH 3D39E 3MYJB 5INDA 1DUZB 3MGAA 1IGML 3BZ4A 1U3HB 1EJOL 1YN7B 3DETD 2C3VA 4LBEB 2NY6B 3BRFA 3PWUB 3NIDF 5EPMB 4ZYKA 1BX2A 2CIKA 1ORSA 1BM3H 1YMHA 4K07A 5AG8A 4KK8C 1R5IB 1RJLB 3L1OL 1KULA 3BKYL 3OKOA 3LOWA 3S4SG 5HHMD 4DFHA 5JOEA 3MRNB 3GSRA 3PWNB 4PJDA 4JFZL 2C3HA 4OFDA 3RWIA 3FO2B 4KJQD 2EYRA 4TRPH 4PLJC 1QRKA 4M7LL 4S1QH 4JQIH 2ZCKL 3TN0C 1H5BC 4HF5H 4U1SB 3HG1B 2WLZA 5C6TL 3OXSA 1MQ8A 3V4VL 4F7EB 5HI5C 4XCYB 4XCEA 2YN5A 1FL6A 4LLDA 2VIRB 1LK3H 3BKJH 4GLRH 4PJHA 4MS8D 3CVIH 4Z9KB 3L3JB 4FFVD 4KHTH 4NO0B 4TPRL 2R29L 2NY0B 5L2KD 1WUNT 3VFRB 4IRSB 1N0XL 3HE6B 4N68A 1IM3B 3WIFA 4OGYH 3FB5B 3GSNH 3X3FL 5FYKU 1IL1B 3HI1B 3HG1E 2PO6B 2VAAA 3VGEA 1FGVH 5BO1H 5SWZB 2D0GA 1U8MA 2VZ1A 5E00B 4CVUA 3INUH 1EVTC 1RZKH 1U8NA 4LP5A 3UTSE 3GNML 4NZUH 3VI3F 4V2BA 2AK4B 1GHFL 4N90E 4E9LA 1CGYA 5J6HA 2V6HA 3IRZA 4IOFC 1FHGA 1FNSL 5TQ2H 2EXYC 1RU9H 4O2CB 2CJUL 2XG5A 4WI8A 1QSFB 3IDXH 4TVPE 3IJHA 4TULH 1F4HA 4DK6A 3CZFA 4YDKH 3KWWB 2ITDA 5I75C 4PV9A 5E7BA 5SWZE 4PRDA 5CD5D 1U8KA 4F37K 1U42A 2DTSA 2J88H 4HLJA 4H0GA 2Z93B 2AK4E 4NM8L 1WT5A 3DV4A 4CUCA 4KZDL 5EWIL 3WFHB 1URLA 1BZ9B 3UC0L 3SGDI 2ENSA 1QSFE 5D2LF 1HINL 1IAOB 3SDCB 1VSCA 4TVPL 1K8IB 1J0JA 3O6FA 4NO3B 1Z5LB 4YJZL 5D1ZA 3QDHA 4M7KL 1RQ5A 3IETB 1CR9H 3HPJB 4JFEE 3QIWC 5DJ0A 3BDBA 3JV6A 1J18A 3WFDH 3LEXB 4N0RA 5BQ7B 1P9MC 4WHTB 5HHVH 2ED8A 4KTYA 4WFEE 2E8ZA 4MXWH 2W9EL 5C3LD 2AXHA 2IPUG 4JJ5A 4PG9A 5D9SB 4XXCC 1IC1A 3X11B 3NPSC 2P5EA 2YR3A 4LKXA 4OZFH 4KHXL 4LL9A 4X5WB 5DD5H 4DGVH 1UJTA 5ACLA 4Z77B 4MNQD 3KPNA 1MCIA 1UFUA 3K3QA 4P48A 1UM4H 3TIEA 4BSWA 4X7FC 2FECL 5EIIB 1ZVSB 3O81A 2HVKB 1I9EA 4ZQKA 1ROWA 3EJYD 4QT5B 3OAZH 4XB7A 3MRFB 3H9YA 2DICA 4Y4KA 3VGFA 2X4NB 1HIML 4XNQA 5D2LB 3B83A 3NA9H 4I9WE 2W59A 4DCQA 2VXVH 1AKJB 4OF5A 4PLJD 2ZCHH 5JW5B 3TN0D 3PP3K 3ZT7A 3LS5L 1AE6L 4KVCL 1MIEH 1CIDA 4M1DH 4WY7L 3CU1A 4R0LB 5HI5D 1DANU 2E3VA 3ECBA 1WJ3A 5F72S 1K4CB 5IG7A 4ALAH 4UNUA 5ILTL 4BZ2H 4HG4K 4G6KL 5D2LE 2B8OT 5E1AB 3VFPA 1QLFA 3BH8A 4PD4K 4OM1H 2OQJB 1ZT1A 1EZVX 3QG7L 3HC3L 1F8TH 4HJJL 5FUCE 1RZIB 3RI5K 1PG7X 5A2KH 1JK8A 4IS6B 5EO9B 3U36A 1UA6L 3T3PF 1A9BB 4WWID 1MCPL 3PG2A 1LWRA 3JUZA 3KAAA 4OFKA 1FORH 5ISZD 4R2GC 4MAYA 4YDLC 4A6YH 1LO2H 1T66C 3LIZH 3BT2H 4IOFD 1KJMA 3T1FB 5C9JA 3RY4A 2EXYD 3MBEC 3RVWC 1IILE 1NC2B 5GHWL 2ICEB 3IB4A 5GRJL 5MI0C 4PGDB 3G04B 3WIIL 3K0WA 5DVLA 1U91A 2A2QT 2ZNWA 3P30L 1IJ9A 1QSVA 3FN9A 4TYUA 1TITA 3IDGB 2ICWI 4J2XA 2EYTA 4IJ3C 5CBEA 2G75A 5EBLA 1P4IL 1A4KB 3V95A 2MCPH 3T3ME 2ADJA 5BOPA 1TNNA 3ULVH 3G6AB 1RJCA 2VR9A 3V0VA 3G5VA 3PUCA 4O00A 3FQNA 4HKXA 4U3HA 4XP5H 1HXYB 5CJOL 2F5BH 2Y7QA 1MFEL 5IHBA 1OGTB 5CKGA 2W07A 4YFDB 5D2NC 1FNEB 1MCOL 1NCBL 2GT9A 3VFUA 1OSZA 2ZUTA 4ODWB 1HH9A 4LIQE 2V2TB 2P48B 3VRIB 3TH3T 4PTTB 5DYOA 5B3NA 1IKNA 3B6SA 1DBAL 1BM3L 3L5IA 3QIWD 4KRPB 1FQ9C 3C9NB 4JLRA 4I3SH 3IKCA 3JXAA 4P4RB 1KIPA 2JCCA 1UENA 1UC6A 2VXUL 3MNVB 4POYA 3GMQB 3MRKB 3MNWA 2XICA 2KUTA 4CAGA 3ALPA 1OD9A 3T3PE 1YDPB 3H9HA 1I7RA 3CDGB 4HF5L 1Y0LB 2D7MA 3VD3A 4LIQL 3RWCA 2K3TA 2YD5A 2GJ6D 2IJ0C 2B1HH 2MQCA 3JVGC 3ZT5A 1T20B 1QKZL 5C0GB 2V2WB 5CS7A 4PRBA 4Y8DC 4WTZA 3CVIL 4MAUH 4KHTL 3BEWB 1UZ8B 4HULB 4YC2C 5JO5A 1TZHB 3MV7A 5BS0D 5LBSH 2FX8H 2J7LA 4O5LH 3P3YA 3GI8L 3Q6FB 5AYUH 4OGYL 3WNLA 3GSNL 5EOCJ 3CC5B 4NUJA 5LWYH 3GB7A 1O0VA 4HEPG 2V9RA 5BO1L 2AJZB 3ILQC 4NZRH 1RZKL 4TSCL 1INDH 3G6JF 4NZUL 1IEHA 5ICXB 1NMBH 2A6KA 1NL0L 4FS0A 1WZ1L 4JFFB 4XC3L 4WEBH 3IDXL 3GRWA 5MP6L 1BEYL 1JE6A 4TULL 1JPGA 4P2QD 1MFBH 1QBML 5DMYA 2VR5A 1U8JA 3PABA 4R2GD 2J88L 2NW2B 4Z95H 5T5FH 1NLBL 1T66D 1Q1JL 1HHJB 5ESQA 4JFFE 3WLBB 3MBED 4LCWA 1OTUC 1YY9C 1EBPA 4RFOH 4I0PA 1BBJA 4P5MA 2X7LA 4JY4B 4ZUVB 4N9OB 3U79A 3MMEA 4H5SA 4G6MH 3L5HA 1CR9L 4Y4FA 3IGAA 1KLUB 1G7MA 5IVXF 3ULVF 2ADIB 4ZS7L 4M7LT 1RK0A 3QEQA 5F9JA 3NIFE 1HOCA 3GJEB 4UDUA 2WBJB 4KV5F 3GSWA 4APQC 5GS1B 3MCKB 3VD4A 5HHVL 1NQBA 3S88H 4MXWL 2X4SA 3T2QA 2BX5A 2HTKC 4EIGB 4WI5A 1DE4B 3P0YL 4LSRH 3FOLB 3L3OA 3DYPA 5BXFA 5KSAB 3MOAH 4YHOH 2PXYA 1ACYH 1YNKL 1CI5A 4XPGH 5ID0B 3OSKA 5IROC 2R23A 4NM4L 4BSVB 2CMRL 2NLJB 1IVLA 3O41B 2YK1H 2C4FU 3BOVA 1YPZF 1S7UA 4R4BB 2VXVL 1FVCB 3CVHA 5CEZE 2AXGA 2ZCHL 5GPRA 1R5VB 2XWTA 1XIWA 4YR6A 4HXBH 2A9NH 1T21A 2FATH 1QBLL 5D96C 3H6JA 1MFAH 3QFDB 3SE4C 3STZB 4N1HB 4CGTA 5HHXH 4IDJL 3EDJA 2X70A 4W68A 2QADB 2QQKH 3RY6C 2H6PB 1CFQA 3R4DA 4BZ2L 3IF1A 3WJLA 1ZT4B 4YHYC 5KSUB 5EFIA 3DBXB 3B9KA 4K71B 3TJHD 2VTFA 2ZP0T 2VLRD 1ZLWH 1JNLL 5F96L 2R0WL 3X3GH 5CCKH 3NCFB 4XHQA 3TO2B 5EC1B 4U2YA 3S3JA 3ARXA 3ILQD 1IQWH 1FORL 4KY1H 3PWPA 1A7OH 3HE7B 1J8HE 4A6YL 3DPBA 4PRPB 3ZYJA 3OKMA 2F15A 3LIZL 4W4NA 4Z7UF 3BT2L 3WEXB 1YPZB 3RPKA 1J1OL 5FXCH 1U8LB 4Z7QF 4C59B 4PRIA 1D5BA 5FV2A 4P5TB 4NHUB 5DRZB 5K93A 1S7QA 1IGJB 3BWUC 2B5IB 4L8SC 4RA0C 4X0KA 2R2HB 3NZ8B 5H35A 3BPOC 3GMLB 4Z5RB 1KXVC 1JMZA 1MRDL 2DBLH 4XBGB 4PRPE 4LPCA 2O26U 1Q38A 1YPZE 1X5JA 2WQRA 3C5SB 5GGQH 3EOBB 1A6TB 3OAUH 5EOTB 1WV7T 4KUCD 3IVKA 1W0VA 1KB9K 2F5BL 2FD6H 3GHBL 3BQUA 5T3XD 2XACC 4J3XA 3QDGB 4F7PB 1IARB 4DKAA 5IKCA 1UEYA 5DVNA 4Z7NF 3TYFA 3EAKA 3L3KB 2XQYG 5F7LB 4NYLB 2FGZA 3KLSA 4QRPB 4RDQF 2EC9U 2YUVA 1H15A 4Z7UB 3DMMA 3QXAA 4OZIF 5HVGB 4JRYB 4EN3B 4I1NB 5J13B 4Y1AB 4I3SL 5B8CA 2P5WB 4M6OH 1JPSL 4ZFZB 1P4LA 3FQTA 3QDGE 2HTKD 2PTTB 3P77B 1ACZA 4N0YH 2ADFL 1OM3H 3B9AA 4NQSB 3MA9H 1EZVY 4QRPE 1AJ7L 5J9PB 4Z7UE 4JRYE 1DEEA 4D9QD 4Y1AE 5BVPH 2EKJA 2V2XB 3O8XC 5EOQH 5A2FA 2P5WE 4GW5B 3WFEH 4DTGH 3R0MA 4Z7QE 1ADQH 5L9DH 5LBSL 1CCZA 4O5LL 5DZLA 1NDMB 4RAUB 5AYUL 5HYQA 4OZ4B 5LWYL 4EKXA 1NGZA 2Y5EA 5L8JB 2A1WH 1T1WB 3DUUA 5ALBH 1KJ3H 1KC5L 4OZIB 3EO9H 4LPWA 4G7VL 3H0TA 4P2RE 4ZO9A 1FYTB 1MHCB 5I17A 3RWFB 2P46B 1T89C 2VLLA 5IHUH 2NZIA 2K7QA 5IK3A 3DVGB 4WEBL 4D9LH 1I3RB 4Z7NE 2CDFA 4M1GH 2LAGB 2DQUH 1PQZB 1NCWH 2JJUA 5FUOL 5IV2A 2FLRT 5EOCL 5L6YH 2X9YA 4HFUH 3G5ZA 1DLHA 5KZCD 4OZIE 2VAJA 4U1MB 1FYTE 1RY7B 2R9HC 4Z95L 4RGMB 3OGOE 4L4TB 3MRBB 3U7WL 1EXUB 3QUXA 5FF6A 1QLRA 3LV3B 3C08H 4I0KA 5F9OL 5JORB 4RWYH 3MA7A 3RUGF 4EVNA 4ZTOH 3S96A 5SX4H 4RFOL 4JFPB 4I18C 3TO4C 4JANB 2VLJD 2NX5B 2CDEA 5I1CL 4BELD 4TUKL 4D9RE 3FB6B 3MRIB 4E5XA 4H26A 5C0CA 1KJ2H 3ALXA 4G6ML 4WW2C 1FAIH 3IRPX 5F3HA 3I6GB 5C09A 4BZ1H 4L4TE 5DHYB 4G42A 2QV2A 4XI5D 4P57B 2I5YL 4HKBB 3S36H 1MI5A 3FB8A 3VFSB 5EU6B 5BJTB 2NX5E 1GIGH 4JM2C 1J0HA 3BJ91 4XP6L 5TGBB 3K8MA 3RNKB 4LPXA 3MFFA 1R24A 5JPMB 2VWEC 1V3KA 3MOAL 4WUKH 4YHOL 1NEZA 5TE4H 4HKZA 4FQ2H 2CK0H 5E8OB 1NLDH 1OCWL 4H1LH 5I18H 3RX7A 3RTQA 5IJKA 2W91A 1KG0B 4JFOB 4QRTB 4PJFB 3DIFA 1T7WA 2GQHA 5LAXB 4OCLC 5ABDE 5D1ZD 2ZZUT 1X5ZA 1AGEB 5EU6E 4LAJH 3CFKA 3KPTA 3MXVH 3KPLA 1TVHB 4BQBA 2BVOB 4FFZH 1HYRC 1LD9A 4GBXC 4HXBL 1OP5K 4TNVK 2FATL 1WICA 2WNGA 3UPAA 1MFAL 4NZTH 5I0ZA 1MCHA 2XZCH 2R56H 4JG1H 5H94B 1QSED 1VPOH 5BMFL 4YHKH 2QQKL 1UWGH 1A1OB 4X99A 1S7XA 4PJFE 3O8XD 5EIQA 3RUGE 5DC0A 1D5XA 1OGAA 1WAAA 1CLYH 3BO8B 4MCZB 4HZLA 3TBVB 1CVRA 5T33H 2IH1B 1LO0L 3RWGA 4NWTL 3QRGH 1D3CA 5CCKL 3TPUB 4EJ1C 3WJJC 4X7TA 1B3JA 3SJVD 1M05B 3N9GH 1KXQE 4YHIB 3V0WL 2W9DH 2AERT 3FQRB 4IIQA 4Y4HB 3IU4H 3QNZB 4X7DC 4I77L 5FOBA 2FH6A 2D4FA 2J6EH 2YPLA 4WWKB 1A7OL 3BD5A 4JR9L 5DR5H 4OFIA 4PJCB 1RURH 1TENA 5I8CA 5I74C 1VCAA 4QOKA 3FQXB 3NIGE 5C0BA 4XT1C 4YO0A 4ORGB 3U1SH 4UOW1 1RZJL 4H20L 2OZ4A 3KYAA 1S3KL 4MZ3A 5KJRH 1E4JA 2EDEA 4WJ5A 3FONA 4RBPK 4HH8A 5EO0B 4HZAA 5DK0B 3SO5A 4P9MH 3RJDA 2R9HD 2BVEA 5EUKB 1RD6A 1O5DT 2EDTA 4M5ZL 2VZTA 1QFWH 4R90H 4W4OA 2YD9A 2W92A 1VERA 4OJFH 2SEBA 4ZXBB 4DZ8A 1CFNA 4GUPA 2LTQC 1FZJA 2FD6L 1BF8A 1KYOJ 2G5BB 5EZLA 4M8QA 4NC1C 4XB8A 3P40A 3QWRA 5JW4R 2GSGA 2DQHH 3LD8B 2AP2A 4U31A 4M8VA 4GRWF 2FJFA 1G7QB 1IC5L 5MERA 1E4KC 3PGDA 2CLVA 1ZOXA 3KPQB 4PY8J 1ZGLP 4JHWH 3KJ4C 3O3BB 1RJZB 4K3JH 3WYRA 2NY4B 1Z0MA 4P49A 1ERNA 1ZEAH 4GKSA 4LF3B 2C9AA 1BZ7B 2WP3O 3U6RB 2AK1L 2EDWA 1IAIL 4JM2D 5CZVL 3QFJD 3O2VH 2BVUA 3QEUB 4N0YL 2ZPKH 4PV8A 3MCLH 2RQ8A 2ADGB 3O3DA 3H9SD 5TF1L 1R3KB 4ELMF 3GMOA 3CLEH 1HK6A 2BRRL 3BPNC 3CGTA 1G7PB 5KANG 5HI3C 1TJGH 5BVPL 2HLFD 4Z7VA 4QLRA 1XF4B 5EOQL 4PRNB 2NY5C 4J4PC 3WFEL 3C5JA 1JWMB 5HYJA 1GVIA 3P0GB 3ZDZF 2R4RL 3D39A 4NNYB 3IFPB 4GRWB 4K94H 1AH1A 4GBXD 3G08A 3O3EA 5F71A 4PGEA 2IBGA 3MXWL 3NN8A 2A1WL 1SBBA 2GI7A 1KJ2B 4OGXH 1KJ3L 3GMNB 2ZUSA 2ERJC 3DTXB 1RJYB 3M07A 4HS8L 3E6HA 3HI6H 2XG4A 5JMRA 2YEZA 1F00I 3V4UL 3OR7A 4KMTL 4KC3B 4QF1B 2P47B 2VDMH 4UT9H 3MYJA 4PP2B 1DUZA 4D9LL 4GRWE 1MJUH 1U3HA 1YN7A 3DX7B 4M1GL 1S9WB 4YBQC 3TA3B 4LBEA 2DQUL 3PWUA 5EPMA 3OKYA 3KLAB 3U4AA 5HYIA 1R5IA 1RJLA 4Z0BH 1JGVH 3O9WD 3U30C 1F4AA 3MLYH 3MRNA 3PWNA 4D0CB 3FO2A 4FFYH 2Y06H 4ZTOL 2XA8H 4WU5B 4K2UH 2A0LC 4G9DB 3D48R 2C1PB 3QNYB 4U1SA 4OGAC 3HG1A 1FC2D 2P8MB 3VXNB 4F7EA 5C2BH 2A73B 2GTZB 4WFHE 4XCYA 4ZOEA 4BH7B 2PW1B 2VIRA 1KJ2L 4LLMB 3UTSA 1JPST 1FAIL 4P99A 4BZ1L 3IDIB 2NPLX 3L3JA 4NO0A 5JHLH 1OP9A 2DTMH 3VFRA 3ZDZE 4IRSA 2QLVB 5SX5K 4AMKH 1IM3A 4N5EC 3FB5A 5DURB 1IL1A 4JG0H 1W72H 2PO6A 4YAQB 2XPGB 4YGVB 1ZGLM 2AJYH 1D5IH 1MLBB 2E7LC 5SWZA 5E00A 1ZANH 2I9LB 5TE4L 3KPRB 4FQ2L 1ZA6B 4M62H 2AK4A 5D7JC 5I18L 3LPGA 4GAYB 2H8PB 4OLUH 4I0PD 4GQ9H 1O7VA 4O2CA 2EZ0C 1NCTA 3MOBH 4XNUL 4L3EB 5M95B 1L0XA 1G7LB 1I75A 1QSFA 2PN5A 4MX7B 1A6PA 1FIGH 4NO2B 1H3WM 4PJ5B 1Z9MA 3KWWA 1I9JL 2G5RA 3OF6D 3QEQD 1J88A 3KPRE 2XWBB 4JAMB 3HA0A 4ZAKC 2Z93A 4JFEA 2R56L 1OPGL 1MLCB 3FRUB 3W9DB 4RMSA 5HI3D 1SMAA 3QIUC 3WFHA 3MRDB 1BZ9A 4UDTA 4L3EE 4J4PD 1AHWB 5B21A 5BV7H 1IAOA 4LSQL 4PJ5E 3SDCA 2ZKHH 1K8IA 5T33L 2BOCB 1M7DB 3S5LB 3QRGL 4NO3A 4G80B 1Z5LA 1MCEA 2R39A 4NKMA 3N9GL 1JRHL 3IETA 1JZ7A 2W9DL 2L4OA 3SDDB 3HPJA 5JW3L 3IU4L 3GM0A 1TTUA 2J6EL 3LEXA 4IM8A 1YMMD 5BQ7A 3RA7H 1X5GA 5HDOA 3JBG7 1RURL 1KT2B 4WHTA 3WNNA 3TZVB 3VU2A 1BLNB 1NGPH 2X09A 5D9SA 4KTDL 4PS4H 1EH9A 4JGJA 4Y7MA 3X11A 1KV3A 4KAQL 4K7PH 4P46C 1AXSB 5FHAH 3SKMB 2DLGA 1HHGB 4X5WA 1AI1H 4U6VL 4Z77A 1D9KB 2P1YA 5CWSB 4KDTC 3WIHL 3A6CH 5TE6H 5KAQG 5KJRL 5EIIA 1ZVSA 2HVKA 4P2CG 3ARBC 4QT5A 3F7VB 3MODH 3V5DB 3MRFA 4X6EA 2A9ML 4EUPG 2X4NA 1RUAH 3PP4L 5D2LA 4CMHC 3EBAA 3EO0A 4PRHA 2OK0H 4ZO6A 1QPPA 2KQMA 3LDBC 3IAQA 5DRXB 2OSLB 5SWQB 1AKJA 5CAYB 3MV01 1I85A 5J12C 3N1MC 5JW5A 1OHQA 2H32B 2A0LD 1BQHG 2DQEH 2DQHL 3OHXB 4OGAD 5I8EB 4P3CL 5IB1B 4OAWA 2AV1B 4IOSD 1TQCB 3K2UH 1T7VA 1K4CA 1RZFH 3EYUH 3P73B 4KROB 4P2OB 2A77L 1B6UA 1XGQB 4V1DB 4JHWL 4Z7WF 4YE4H 3LQAH 1ZE3C 4K3JL 5E1AA 5LXGL 1I8MB 2OQJA 5I73B 8CGTA 1ZEAL 1MY5A 5J1AB 2Y4SA 3AMKA 3C09C 4N5ED 3U82B 2HWZL 1RZIA 1GJIA 4P4KC 4LASH 4IS6A 5EO9A 1A9BA 4EXPX 5IMKA 4Q6IA 5JDSB 3MCLL 1BJ1J 4XRCB 1S7WB 5C0AB 2VDKH 4N8CH 5FKPB 4NP4H 4V1DE 5D7JD 1RUQH 4H25A 3MQIA 3T1FA 1TJGL 1QFOA 1JNHB 2EZ0D 1NEUA 1NC2A 1Q8MA 1ZXQA 4ZFOB 4PJAF 2EDKA 3G04A 4PGDA 3M45A 3S35H 4M6MH 4LHUG 4G8IB 5DVMA 3RVXC 5IVNA 3IDGA 2I25N 3P9LB 4NN5C 3OPZH 4K94L 4PLKC 2K7PA 3MO1B 4LSSL 4Y19B 4CU8A 2NXYB 5ICZB 4QHNB 5C0AE 1DUYB 12E8H 4ZAKD 3G6AA 1FG2B 1BJ1H 4OGXL 1BBDH 1H3TA 2Y25A 1YZZA 3BISA 3HI6L 3HAEH 5DLMH 3VDCA 3QIUD 5HY9B 1HXYA 3RWHB 4HIIB 2P7TB 3GJFH 1Z9LA 4AH2A 5IFAH 2BNQB 4DJMA 4HJGB 1FNEA 2AW2A 2JJWA 2VDML 3QUYB 3KPOB 4GO6B 2MJWA 1MJUL 4ODWA 1W72B 2V2TA 3BGFB 2RHEA 4Y19E 3VRIA 4PTTA 4WO4B 3SGKC 1I1YB 1DDHB 4PBXA 2E6JA 1HSAB 2PW2B 3C9NA 1JGVL 2BSED 4P4RA 3MNVA 4YFEA 1J86A 3GMQA 2C3GA 3MRKA 3RAJH 4PJ8B 2BNQE 5JTWA 4XNXH 2A38A 2HT4C 5HHMB 4FFYL 3KHOA 1RMFH 5IVZB 3VXOB 4BQ6A 1U8HA 4ZFOL 3VD9A 5AZ2H 1GH7A 2XA8L 3BDXA 3OXRB 4X80H 2EH8H 1WBXB 2I26N 4P46D 3CDGA 3ISWA 1Y0LA 2BY0A 3CFIC 3LB6C 1B0RB 1HNFA 3HLAB 5C2BL 1IEAB 3MPCA 1T20A 3BRDA 2V2WA 4NQDD 1X6NA 3ARBD 2H3NA 4LGRB 3OZ9L 1CDYA 3MRPB 3B8YA 4JZNB 3BEWA 1UZ8A 1BFSA 2BNRB 2Q7NA 4PJAE 5JHLL 5IBUG 2DTML 1EFXD 1TZHA 2XWJB 5HHME 4MDJB 2HFEB 3Q6FA 4X9IA 5FGRA 3C6LB 3FT2B 2ZUQC 1W72L 4LVNB 4MD4B 1XR9B 4HUUB 4Z7OF 2AJZA 1ZANL 4H88H 4AEHL 2HRLA 4M62L 5ICXA 5IGXL 3QAZB 3HZKB 5C0EB 2BNRE 4E42B 5J6GB 3IFNH 1CGSH 3H9ZA 3UJJH 2E7MA 4JFFA 2Q3AA 5TF0A 5J1SC 3WDHA 4QRRD 5DVKA 4AEEA 1EPFA 1BVLB 1E6OH 5C09D 2BSTB 1U92B 1A02N 1INEL 5GS0C 5C0RH 3B9VA 1JI1A 2O5YH 5TE7H 1UH4A 2B1AL 1RHFA 3TNNB 3KVQA 5K9QI 2QHLA 1ZHBB 2P8PB 2X10A 3CSBA 1FFNB 2FX7H 4YXHH 1HHJA 4HHAB 2V7HB 4DGIL 3WLBA 4WV1B 1A0QH 1F02I 3J7HA 4HKJB 3VWJC 2MNUA 5BV7L 2ZOKB 2ZKHL 1I8KB 2CGRH 5D7IB 1WTGT 3ZSSA 4XVTH 4ODHH 3RVXD 5JXAH 3BKCL 1PLGH 4ZUVA 3C5ZC 4PLKD 4ZO7A 2X4OB 1FLRL 2N4IA 1YQVH 4HUNB 4YX2H 2AJ3B 4LPYA 1KPUB 1I9IH 5D6CB 4UMGA 4FN0A 4ONFL 2WMPA 3P9MB 1KLUA 2ADIA 4NUGH 1YNTB 3GJEA 4JFDD 5DT1L 2WBJA 4OV5B 3MX0A 3RA7L 5GS1A 3MCKA 2X1OA 3UROR 3JSSA 2H26B 1NGPL 4J12A 5D7IE 4OLVH 1U95A 3VRJB 1DE4A 5FHAL 2Q76B 1IT9L 4K7PL 3RBSA 4Z7OE 4G6JH 3FOLA 2HRPH 5F89B 3RDTC 1MWAH 5KSAA 1RFDH 1WQVT 3GHEH 4H8WL 3A6CL 4MHHI 5JA8B 3LRGA 5ID0A 5CGMA 4X98B 4A6YA 4KJWC 4BSVA 2NLJA 3F12B 4QXUL 2NY6C 3W0WD 1RUAL 1FSKC 3QHZH 4R7NB 2WBKA 2EE2A 1CQYA 2HT4D 2OMBA 4R4BA 1DLFH 1EO7A 1FVCA 1R5VA 1X5XA 5DWUH 2DQEL 1Q9KA 4OCMC 1XGTB 3QFDA 1JTTA 1Z9SA 3ELAT 1W0YT 3STZA 3TN0B 5GJSH 1H5BB 3ZTJH 1RZFL 1J8HA 1C5BH 3VFWB 2H6PA 2WWKT 3LKPA 3HAEB 1ZT4A 3OAZK 5KSUA 4PJBF 3DBXA 4YE4L 5KVGH 3MRHB 1QFPA 1LHZA 3OL2A 3BH9B 4BZYA 3WFBL 3W2DL 4M43H 4NZDA 5C86A 4W81A 5I1AB 2IADB 2EDOA 4DZBB 4LASL 2V9QA 3TO2A 5EC1A 3MACH 4JCMA 2P44B 4NCC2 2IH3B 3K1KC 3HE7A 5D6DA 3KYOB 1N7ML 1J1PH 5EZOH 4NP4L 4PRPA 3VI4F 4S2SB 3WEXA 5DTFA 1FNLA 1YPZA 4AL8H 5ISZB 1FE8L 2LE9A 1XR8B 1FBIL 5JUEL 1C7SA 1HNGA 3GI9H 5DMKB 1U8LA 1SVZA 2F5AH 3S35L 4M6ML 1NBVH 4KH2A 4J3UA 4NHUA 5DRZA 1IGJA 1X5HA 3OPZL 1JF6A 4N1CA 1NSNH 3NZ8A 5GS0D 1BQLL 1CWVA 3GMLA 3O0RH 4Z5RA 1I8LC 4XBGA 12E8L 4FQHA 5I75B 4G8GA 5HHPB 4PJBB 3CXHJ 4ZNEE 2V5TA 5ISZE 4RCAA 15C8L 3EOBA 4XVJH 1A6TA 5EOTA 4XPTH 5C70A 5IFAL 3FQWB 1WBZB 3VWJD 3MV9B 1ES0B 4DQOH 3ZYOA 1X4XA 4M02A 3QDGA 1BOYA 4F7PA 3JWDC 2EEBA 5L7XH 1KTDB 4UTAH 4OLWL 3L9RB 1T83C 3C5ZD 3L3KA 4LAQL 4NYLA 4N0CC 3NCEB 4QRPA 5IBLC 1HILA 4XNYL 4PJBE 4JO2H 4Z7UA 4EN3A 4JRYA 3UPRB 4Y1AA 4XVSL 3VG9C 1U8OB 3QIWB 2P5WA 1AGFB 4LDEB 1PDKA 3QT2A 3MV9E 3V7AG 3HC4H 4ZFZA 5DK2B 2COQA 4HWUA 3KDMB 3CJJA 4PB9L 4PJIF 2PTTA 3P77A 5DDHB 5GSRB 2DMCA 5CGTA 4X80L 2EH8L 1CD1A 4MQ7B 4NQSA 3RDTD 4W6XB 3W82A 4YDJB 2XNAB 3NPSB 3WBDA 5D8JH 5MEQB 2FYYB 1TETL 1D6EB 4P2RA 4PFEA 3N1QC 2GJ6B 2V2XA 5HDQH 1I7TB 3L7FB 3V6OC 1HHHB 4GW5A 2NY6D 2IQAB 3CMOH 4P0DA 3SE8H 3E0GA 3H3BC 1NDMA 3V5HB 4RAUA 3HI5H 5BS0B 5ADPH 2IAMC 1QZ1A 5I19L 1P6FA 1T1WA 2X4UB 1N4XH 1C1EL 3MFGB 4OZIA 1FYTA 1MHCA 2GJ6E 5I9QC 5L8LB 3RWFA 3VXSB 1CLCA 3L5WB 5EU5B 5TFSL 2FIKB 5E8DH 1UXSA 2BP3A 3IFNL 3HS0B 1EDQA 1JCKA 3H3KA 4OQTL 1NAMH 4R0LC 1INQB 5J1TC 3DVGA 3DV6B 4KTEL 1FZMB 3MJGX 2GJZB 5B4MC 5BS0E 3V5KB 1E6OL 4XMLH 2Q3ZA 2CSPA 5C0RL 4U6TA 4PJGF 4R26H 2O5YL 4ZNCD 4U1MA 4HLZH 4RWHA 5HDLA 4OF6A 3HE6D 4P2QB 4L4TA 3MRBA 3QDJD 1EXUA 2FX7L 3T0AA 3O4OC 4R2GB 3LV3A 5JORA 2PO6D 4YDLB 5F8RC 5CIPH 4C55A 3H2WA 4ODSH 3BXNB 2ITCB 4JFPA 4JANA 4XBEH 2NX5A 2CGRL 4U1KB 3MBEB 2AK4D 4L8DB 5JXAL 4WCYH 5MI0B 2KL6A 1FL3B 3BPLC 3FB6A 4RISH 4M48L 5D1XC 1FL5B 4YX2L 4I0CC 3FFDB 1I9IL 4OTXH 4C83B 3W9EB 1X44A 5LGHH 3I6GA 4IJ3B 4I13B 4P2QE 5DHYA 4F57H 4NUGL 2JLLA 3DGGB 4HKBA 1FRGH 1BJMA 3HHRB 3VFSA 1KN2H 5EU6A 5BJTA 4YHZH 4IOIB 1S7TA 4FQ1H 4OLVL 4WENB 4ZUSB 5TGBA 1YJDC 4BSJA 4D0DB 3RNKA 4G6JL 2HRPL 4WI6A 5JPMA 1BOGB 5D2NB 4JHZA 4PJGB 4N0CD 4OFVA 5IQ9B 2VZOA 3GSQB 5E8OA 5IBLD 4Y89A 2FO1A 4LLWB 5F1NB 3I3EA 4OKDA 4AIOA 4HFWB 1KG0A 3O6FC 4JFOA 4X9HA 4QRTA 5DEZA 4PJFA 3RUGA 1JYWA 1EEUA 2AXFB 4F9LA 5TQ0L 3N1GC 4CVZA 3QHZL 4WDIB 1AGEA 1HH6B 1D5MB 4MJ6A 3ZT6A 4Q9QH 4HCRL 1TVHA 4ISVB 2BVOA 1IKFH 4GAGL 1KCVL 2DQJH 5D2NE 4PJGE 4PB0H 1G9NC 4PJ9A 2N1KA 1TXKA 5I30H 3TCXA 5GJSL 5H94A 3Q2CA 1IGCH 3CSPA 1YC7A 1C5BL 1A1OA 3PF2A 2Y1VA 5CLWA 3BO8A 3ZTNH 4GRLC 1I9RL 4MCZA 3QCVH 4TN9A 5EZIH 1EBAA 3S7GA 1V7NH 3TBVA 2X6MA 2IH1A 3T2OA 3P11L 3TPUA 2UUDH 4YC2B 2Z35B 5K33A 4DKFH 4ZFFA 1M05A 1GZPB 4KUCF 4YHIA 3FQRA 3MACL 4Y4HA 3GFUA 2OI9C 4I2XE 2QQLH 3QNZA 5CJQH 4FP8H 4WWKA 1R0AH 4K9EH 3FT4B 1AKJD 5EZOL 3W5NA 2A6DB 4LHUD 4AL8L 3UEZA 2PYFB 3TBYB 2FECI 3FQXA 5F1OB 3U7AA 3GI9L 4ORGA 4MB4A 4MWFB 3ULUC 3BRGC 1ZLWK 2AJSH 5B4MD 4S10A 5GGRB 3BPCA 5EO0A 1NSNL 4JDTL 1R5WB 5DK0A 3BSZL 5F7NC 1G7JB 3BKMH 5EUKA 1I1FB 1S9VB 4Z76B 3B5HA 4XVJL 5IBTH 4UBDC 3ZDYF 4ZXBA 5K9QG 2VRAA 2OR7A 4XPTL 4PBVC 2G5BA 4UQ3B 1CGWA 1V3LA 4DQOL 2R4SH 1MREH 1OOAA 4HSQA 5L7XL 3DSFL 1G7QA 4YHNB 2HFTA 3ROLB 4LFHG 3DXAD 5CJXA 3KPQA 2CKNA 4J6RH 1UG9A 3S4SB 3O3BA 1RJZA 1WFTA 4QHMB 5D7SH 4S1RH 3WUZA 2DLIA 3I2CH 1BZ7A 3U6RA 4C57C 1FDLH 5L88H 4APQB 5IB5B 5T3XE 3QEUA 1F2XK 1A2YA 1MJJB 3JTSB 5FYKH 1LE9B 3PE9A 1BGXL 2ADGA 1QEWB