1NCBH

Crystal structures of two mutant neuraminidase-antibody complexes with amino acid substitutions in the interface
Total Genus 40
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
40
sequence length
221
structure length
221
Chain Sequence
QIQLVQSGPELKKPGETVKISCKASGYTFTNYGMNWVKQAPGKGLEWMGWINTNTGEPTYGEEFKGRFAFSLETSASTANLQINNLKNEDKATFFCARGEDNFGSLSDYWGQGTTLTVSSAKTTAPSVYPLAPVCGDTTGSSVTLGCLVKGYFPEPVTLTWNSGSLSSGVHTFPAVLQSDLYTLSSSVTVTSSTWPSQSITCNVAHPASSTKVDKKIEPRG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase(o-glycosyl)
molecule keywords INFLUENZA A SUBTYPE N9 NEURAMINIDASE
publication title Crystal structures of two mutant neuraminidase-antibody complexes with amino acid substitutions in the interface.
pubmed doi rcsb
total genus 40
structure length 221
sequence length 221
ec nomenclature
pdb deposition date 1992-01-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
H PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1ncbH01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1ncbH02
2IBZY 1U6AH 5FUCE 5DDHA 5K9JL 1VGKB 5IB4B 1QSFA 3LKRB 4UQ2B 4LSUL 4Z95H 3VFPA 1E6OH 1BQSA 4KY1H 3R8BB 5TE4H 1P9MC 2VDLH 4Q74A 1T5XA 4MQXC 1RVFL 4ZXBA 1PX3A 4E41D 2YSSA 2BNUB 4PJ7A 5ACLA 5E2VL 2N56A 3JWNC 4LLYA 4NZTL 3BEVB 4DGVH 4KJYB 3ARVA 1U36A 5DHXB 5TF1L 1GXEA 1O7SA 1TCRB 1UJ3B 4EI5C 1UKTA 1ZLSL 3H6JA 1V7MH 5D70L 2FL5B 4YHML 1A1OA 1CGYA 1N8ZA 3HUJB 4ZQKA 4KRNA 1UA6H 4OQTH 3IDXH 3VI3F 4KJWD 1LD9B 3QWOB 3F7RA 4QNPF 1YECH 1JCKA 3O8XA 4BQ6A 2PW2A 1BD2A 3HZVB 2FJHA 3HRZA 1EGJA 4WHTB 2PTTB 5AYUL 3RGHA 1AHWB 1R24B 4R26L 4L4VD 2D4DA 4QOKE 4XNZC 1ITCA 2VUYA 5EUKB 1OD9A 4NN6C 1P6FA 4XVSH 3B8SA 4EN3A 3OSKA 4F7MA 4XXDA 1GGCL 1HINH 5FGSA 3ULVE 3QI9C 4HC1L 3RTQB 1A02N 2WQRA 43C9B 3JVGC 1RFDL 1KIPA 1SBBA 4XP4L 2M26A 3FOLB 4L8SA 3GNML 1PW3A 2HP4A 5IF0B 4RNRA 2BVOB 3SGDH 3BHBB 3MRGB 1OVZA 1NBVL 3LKSA 2YK1H 3NBNA 3BZ4A 3O45B 5HY9A 3T2NL 2YXFA 2OJZH 4PY7A 2R29H 4F2MA 2E8YA 4NUJA 3O3EA 3QO0B 1E4XH 4BZ1L 2Q8BH 3CSBA 2L7JA 3HC3H 4FTVD 3DV6A 3IDYB 4PLKD 4YHKH 3UJJL 5EA0H 3EJYC 2CIKB 2Z8VC 5IVXF 1L6XA 4J3UA 4OFVA 1G1YA 4ZNEA 5FGBA 3TESA 2PR4L 4DWHA 3FT2A 1UB5A 1RUPL 3WL9B 3H7BA 5I18L 2MKWA 4PJ9D 4H1LG 4MHHI 1DBBH 4UAOB 4NQCE 4QRUB 2IPKB 3JXAA 5C2UB 4XC1H 4J3TA 1Z9LA 1RQ5A 3MRCB 1SY6L 1VFBB 2W0PA 3GHEH 4HJ0D 4PYGA 3UYPA 4KK8D 2AXHA 4E42B 5I8OH 1F4YH 2YUZA 4M43L 5ANME 3O3BB 3MV8D 2FX9L 3SCMB 5HYJA 5HI4D 3BKYL 3VXSA 4B50A 3EOYG 5CZVH 4R2GC 4MQSB 5CGYC 4PJBE 1PKOA 2D3VA 3HAEB 5JNYB 3LKPA 3WIFB 4XCNA 5EC1B 4X4ZA 2DB8A 1TZIB 5D2LF 5FYJL 5F70A 2ORBH 1A2YA 2FLRT 2Z91A 1DBKH 4MA3A 1G9NC 4OKDA 3FMGL 5DURB 5F1NB 5ID1A 2QQKL 1LO5B 1JN6A 4OV5B 1RJZA 3OKNA 1EUUA 1R5VB 3C60C 1KTRL 5JQ6H 3NFSH 1X5ZA 4BH8A 3UAJD 12E8H 4KROC 3GSXA 1WBXB 4Y5VC 2DLGA 3OKDB 5SWSA 2V2TA 3MV9D 4MD4A 1A3LH 1JRHI 3OXSA 4YPGB 2GUOA 4NQXA 4LP4A 5KZCB 2R4SH 5CHNB 3KPNB 4UOW1 4TPRH 3AM8A 3WFHA 5E8OA 1FORH 4KK9D 3BPLC 4GG6E 4P2RE 2P7TB 1A9BB 2FCBA 5FAAA 2VR9A 4MJIA 3MMEA 1BZ9B 4XVJL 1TVBA 4FG6C 4OZHE 1JNLH 1CIUA 3LKNB 5HHNA 3ABZA 1NDGB 3L9RA 4G8FA 3T65A 4YEEA 4BKLA 1FYHB 3VCLA 4Z7NF 4CVXA 3HLAB 1J8KA 3QUZD 2F58H 3UTZA 3LDBB 4C4KT 1QOKA 3KYAA 3QCVL 4JPKH 1G7HB 2NX5B 3UMTA 3VMOA 4X83A 3RP1A 3MLTB 5E4IA 4H1LA 1MJJB 4K55A 4K3HA 3ZZ1A 4P5KA 3SE3C 5LXGH 2EE6A 1NAMB 2VOTA 3KLDA 3M8OL 4DN4L 4YHOH 2V2XB 4PFEA 4KJQC 1B0RB 4UBDD 1JIBA 3E2HC 1TJIH 2B5IB 3ULUL 2V2WB 5E2WL 2FGWH 4DZBA 3ARPA 5DRNA 4RFOL 1KACB 1NGPL 3IU3B 2P5EA 3BWUC 2E9IA 3EFFA 4DK6A 4XGZA 1MCOH 3OF6A 2E8ZA 5I76B 4Q6IB 3WBDA 1N5AB 2XWJA 1P9MA 1D5IH 2UV3A 4ZS7L 5J56B 2RCSL 4KGJA 1KN2L 5D7IA 1VEMA 3ZDXF 3GMLB 4HLZH 4XC3H 3N1MC 1N3NA 4KV5E 2AV7B 4WFEE 1U8LB 5C0EA 5F6IB 1PSKL 1YN7A 4EI5A 4PGDB 4PRIA 1KCRL 3NABL 4UB0H 1S7SA 3FKUS 4LHQB 3OHXA 3L7FB 3REWA 5T1LD 1OOAA 3WFBL 3PGFH 2VDKH 4JR9L 4O2FB 5AG8A 5FEBA 4MD5A 1NUDA 3LEYH 3H0TB 3LS4L 3I3DA 5KS9B 5J1AA 5CAYB 4RGNC 5JIKA 3H42L 4TSAL 2AKRB 2IGFL 5DUBB 4WTZG 5EOQL 3BUTA 3B9KB 4PLJC 1F6AA 1SMOA 4WEBL 3OMZA 4WEUD 4YFDB 4ZAKC 5CEZH 1AGCA 3MOBH 8CGTA 1CFTA 5CEYA 1I1YB 2NY7H 3O6ML 4KWUA 3QI9A 5I73B 1HHIB 3JVGA 1CIDA 1QFWH 2GITB 1YY8A 4JE4B 1QYGH 1JL8A 2BNQB 1ACZA 4I3GA 3GK8L 3TFKD 3CCHA 4C56A 1KCVL 4Q2ZA 1X5IA 4YBQC 5I1EH 1TJHH 4QXGH 3BGAA 3DO3A 2VDRL 2APFA 5JORB 1H0DB 3QH3B 2FHFA 2PXYB 3QIWC 5DK2A 3ELAT 2A6IA 2X4QA 5EU6A 1FCCA 3BZEA 3CH1A 3OKLB 1EO8L 4LCYA 1FPTH 5IMMA 4LARH 1PAMA 5F9JA 1DQDH 4N0RA 1JFQH 3BP6A 5GRXG 3RA7L 1ZSDA 3FL7A 2JK5B 4JDTL 4ONHB 2HWZL 4WWKD 4FQ2H 1UFUA 4WV1B 5C6WH 5AG9A 5EBMA 1JTTA 2BZDA 5AUMB 4HULB 1J8HB 3GI8L 3VD5A 3DXAA 3IJHB 4LBEA 1ZGLB 3PGDA 4ZUVB 4IRJB 1PGRB 4JFZL 5T5NF 4NKMA 3D2UA 4OLXH 3MLSH 3U7WL 4Y5YB 3MJ9A 1MRCL 2X42A 2OYPA 3B2UD 3DX7A 3R8QA 5GGUA 3H9HA 4ZYKB 5TE6L 3QWQB 5GRZA 3TV3H 5BZDA 2X7LB 2EDWA 2PF6A 1P69B 3PQYE 2LABA 5FIEA 2YS4A 1Q94A 2CRIA 5C0GB 1PQZA 4YR6A 4JN1L 4RRPG 3VWJB 1SEQL 1FZKB 4GBXB 5DJ8B 5KS9F 1X6NA 4P46D 3C09C 3QDGD 5B3JF 1IZKA 1XIWD 4CW1A 5DD3L 4Z76A 2OI9C 2VQUA 1SVZA 4H25A 4NNYB 4K71C 4HCRL 2CUMA 4NHCL 3C60A 1NGQL 3PWPB 3IRPX 3E3QC 2DQUH 3LHPL 4BM7A 1X6LA 4Y5VA 1FVCB 1UGNA 3QNYB 3IFPA 5EU5B 4JG1L 5DMGC 3F7VB 5T3XE 1JGVL 4WU7B 1QR4A 4TSCH 1INEL 1UWEL 1FL3A 3HG1E 4DW2H 5F1IB 4FQ1L 4ZO9A 4HUVB 1S9VB 3L3KA 3REVB 2APWA 3DVNA 3KWWB 3QRGH 2R56L 4JY5H 3VGAC 1Y6NR 5C9JB 5F7WC 4M7ZB 1AGBB 4G6KH 1MNUH 3O4LB 3OR7A 5GGSB 4LLQA 1B88A 2C3WA 2HRLA 1T5WA 4HS8L 1Z9OA 2V7NB 4AH2B 4X7SH 1GCFA 1LWRA 4XX1G 4PRPB 2ICEB 2C5DC 2P8LA 1DQMH 5I19L 5CJQL 1MHEA 1J0YA 1MIEL 2Q7NA 4G9FD 3SE3A 1S7WB 4JFDD 1A7NH 4P9HC 2D03L 3LD8B 1VADB 3P0VH 5E8DL 3MJ6A 1MREH 4J2XA 3P40A 3GIVB 4J23A 3V7MA 2UY6A 5DT1H 1RZIB 4P2OC 3K8KA 5KBNC 3CX5K 1G0XA 1YMME 3NIGE 3CXHK 3MLVL 3LB6D 4RRPA 2B1AH 5D2NE 1G6RH 3H9SE 2R1XA 2WQ8A 3W81A 1H15A 2FO4B 5J0BA 3VXMB 3SDAD 2Y6SC 4Z7OF 3FQRA 3VXUD 3CFKA 4PD4J 4R4NC 5F7EL 4NCC1 1OF2B 2A6JB 2FECL 3DX8A 4U6YB 4NN5B 5C0CE 3MCLL 4YQXL 1D9KB 1JZ5A 4X0KA 3O9WB 5L7XH 4UOW0 4RAHA 4JHAH 4BJLA 1FZMB 5SWZB 3VFGH 5IR1A 1G7QB 3HS0B 1JPSL 4NUGL 1U8MB 3PWNA 4HDIA 2GTZA 3QEUA 4ALAH 4MXVE 4XRCA 4ZAKA 4D0CA 4LVNB 4QT5B 3RI5F 1UYWH 5FOJA 4RX4A 2R15A 4ETQB 4H20H 3DI2B 1KYOK 2DMKA 4BQ8A 1NQBA 2NCMA 3PDGA 2ZJSH 4MA7H 4EQ2A 1MIMH 2FR4A 3O11B 1QVOA 1JZ8A 5A2KH 3IDGB 4UV4L 1GZPA 3VG9B 4NKIH 5E2TL 2FEDD 1CL7H 3DUUA 1ZGLP 2VAAA 3HMXH 2DTML 5I1JL 4UILH 2QSQA 1S7RA 1NCWH 3V6FA 3KPSD 4X5WA 2H26B 5DJAA 1R5IB 5ILTH 3QIWA 2Q6WA 4J3XA 3V5HA 1XH3A 1UWXH 2B0SH 1GC1L 2NLJB 2OK0H 2AJVL 2ZCKL 5CSZB 4DZ8A 1YEIH 2IH3B 5DJ6B 3X3GH 4XHJC 1CFVL 3DX6A 3R06B 5JUEL 3RZCC 4ZSOE 2MHAA 5DF0A 2EYTA 1NGYA 3T2PA 4PREB 4U1GB 3GSRA 1C08A 2K1MA 4K8RL 3MRKA 1T2JA 2VKWA 3BQUC 5LVEA 1BOGB 1F8TH 5CGMA 2AK1H 4EKXA 3RY6C 4PG2C 5I8EB 3VG0H 2EXYD 2ZKHL 4Z7UA 3X17A 1G84A 2E3VA 5I30H 3UYOD 3U82B 2UYLB 1A6ZA 1C7TA 3QULA 4Y4HB 3TJEH 2FYYA 5E2JA 4JFFD 3QFJB 1AI1L 5EO0B 1OY3B 1N59B 4M1GH 1RZKH 2BY0A 2HFFB 1A7PL 3H9ZA 4OF7A 4HFWB 5KG9B 1LO0H 1A6AA 4F3FA 5E4EB 1XGPB 4MNQA 2XG4A 3ARGC 4KGLA 5DK0B 4KPHH 5E1AA 5JXAH 4FQIH 5HSFA 1JV5B 4M8QA 1VSCA 1NKOA 3LPFA 3U0WH 3KNBA 5F97E 3DSNA 4M7JH 4Y4KB 5FYKD 3MODL 3SE9L 1MWAA 3MREA 3ARRA 4MAYD 3WHE1 4XNMB 3C6LD 1Q9WA 1BVKA 4L3AA 1F3JB 4FQQA 1JGEB 2BVQA 5GJSH 3OJDA 3FFCD 1ZT1B 4MWFA 3K81A 3O0RH 3LAFA 4JFQB 5CIPA 4L5FL 1L7IL 3ZL4H 4OD1L 4F57H 4UTAL 2X10A 1UH3A 4KI1A 5ACZB 1IKFL 3GI9H 4C83B 5JR1H 1JK8B 1T04A 4JG0H 3TO4B 5GS1B 1DE4B 2B4CH 4BYHA 3WXVH 2H2SD 1OP5K 3QUXB 5IHLB 5DMJB 1MQKL 3B9DA 2A6DA 1HKLH 1QLRA 2YD4A 1NC4B 1FYTA 1ZT4A 1CLCA 1A7QL 1OAZL 5FDYA 3ALPA 3L5XL 2CRYA 4ORZC 2AXGA 3BKCH 3TGXA 3MJ7A 3QXWA 5D6CB 2ZPKH 5E8EA 1N0XL 1NBZB 2ATKA 5LGJA 2YUXA 1YQVL 3PNWB 2WWMC 1T0MB 1CXEA 3PABB 4I2XE 2AJSH 4XWOC 4WFGD 2XN9D 1D5ZA 4M6NL 1RU9L 1XCQA 3RDTB 3D0LB 5H8DA 4D3CL 5C07E 3MRLB 2R23A 1C5BH 1YEJL 2MPAH 1AFVL 4GUPB 3RL1B 3PHOA 3I85A 4JZOB 4JDZB 2LU7A 3DTXA 1T0NA 1YDPB 4WCYL 32C2B 1WAAA 4XBEL 4WO4D 2IQ9L 2DQFA 1U2CA 2DDQH 1M7XA 2IAMB 1DBAL 2A1WH 4P2OA 1NFKA 2BCKA 4WJ5B 4PJ8C 3TPUA 1BREA 1MAJA 1OARH 5FGCB 5HHQB 2X89D 3SY0A 1QSED 5ID0A 3GJFB 4WW2B 4P4KC 5FF6A 4XI5D 3P9LB 1ZEAL 4JHZA 2WINB 3TN0D 2OP4L 3UP1A 5F1OB 1FFPB 3DETC 1CXLA 4H0GA 4U3CA 4HK0B 4LNRA 5F72S 1ZANL 1WFUA 3QHFH 4HJGA 3JWOL 2CH8A 4BSWA 2HLAA 2MCPL 4M48H 3EDFA 3VH8G 4G7YH 1CD1B 5AAWA 5CEZE 2R2BA 2YUVA 2EKJA 3P0YH 2OL3L 1NEZG 5E6IB 1GL4B 5TDOA 2ZCLL 3ZYOA 1J0KA 2A9ML 3QG6B 3HAEH 4G8IA 3D3VA 1LEKB 2VQTA 4U2YA 3VFTA 3U9UA 4YK4C 3BT2L 3V4VL 4HSQA 3OGOE 3IXTA 5T33L 1FLTX 4N8PA 1S7UA 4ODSH 4QOKA 1UKQA 3HB3C 4J4PC 4DCQA 4NC0B 3S4SG 1RZJL 4AMKH 4IMKC 4TYUA 5MENB 5F93C 1P5UA 2ARJQ 5C2BH 1T4KB 5J1TC 5E9DB 4HIEA 3H3BC 3LEVL 5DQDL 2CUIA 5HHPA 3MGOA 4G8GB 2GHWB 4OF6A 3HE7B 4YHYC 5ADOH 3LEXA 2NY2D 4MDIB 1QNZH 4MXWL 4B5EA 1MCRA 4U1HB 5DC4B 3TWCH 1UADC 3MBEB 4HV8B 3OKOB 3GKWL 2PW1A 1MF2L 5IKCA 4LQFH 3BGMB 1ZLUK 1P4IL 1S9YB 4MDJA 4P4RB 5BS0E 4OBRA 3PDDA 5JOFB 4P48A 5HHXL 2CLRA 4X8JB 5DVOA 2VZ3A 4ERSL 4LPYA 2ICWI 3RZCA 1GGBH 2DYPD 4YHNA 3IU4L 2RBLA 3CDYA 3B9AA 4JRXE 2CK0L 4DGYL 2H9GA 4ZO7A 3HNTH 2GY7B 1K6QH 3BQUA 3EUUA 1QFPA 5M7QA 4G7VH 4KRLB 1XZ0B 1AO7D 3RY6A 2WUBL 4NQCA 4PG2A 3EAKA 4WW2F 1S7QA 2VR5A 2IC2A 3PHQB 2VLRE 1GOFA 4A2MA 1F11B 2QL1A 1XGTA 4CGTA 3GSNA 2X40A 1HH6A 3V0AC 3IETA 3VH8A 4TQEL 4D8PA 2R2HB 1NC2D 1KNOA 4PJCE 4JPWL 3HCVA 4UMGA 1CE6A 1NEZA 1NGZA 4PJBA 2P8MB 3TO2B 1KENL 3ARGA 4IOFD 1QSFD 4J7RA 5C8JB 1KB5L 2V5TA 4XHQA 4CJ1A 1OAUH 3JBG7 2YD6A 5IW3A 1MPAL 1XF4A 4ZXBD 5EG6C 1YEKH 4NZRL 1BEYH 1INDH 2ID5A 3P30L 4XP9L 4PRAA 4YPJA 5GGVY 2Q3ZA 4NKDA 4JRYE 1ORQA 4XNUH 4YEFA 4RWYH 3BEWB 4DQOL 3S4SA 3FOMA 5I71C 4LVHB 1IMHC 4XPBH 1UZ6E 1QR1B 2AK4E 4EUPB 4I9WE 2V7HA 3ARXA 1IARB 3OAZH 5J3HC 2P42B 3QXDB 4JZNA 1QBML 1EUTA 5EU7C 3BVNB 2X2YA 1I1FA 3CLEH 4GG6A 5D1QB 4P2RA 3HMWH 3T0EE 1RHHB 3V0WL 1KEML 3H2WA 1CU4H 4Y1AE 3VXRA 5FM5O 4K94L 3ILQD 4WHYG 2X70B 2CXGA 4JM4L 3U0PA 3EZ8A 4OZHA 2BOBB 3TA3D 2YPKA 3TYGL 4EN3D 4ODVH 3CFEA 3GMMA 4OGYL 2O26U 1OPGL 4DTGH 3D85B 3S88L 1U8NA 3WDJA 5IBLC 4I0KA 4K7FA 3MRHB 2DQHL 2A77H 4JHWH 2GSIA 3QUMA 2GIYA 1KIRB 4ZPVA 3CVHL 4L3EB 2GJZA 2EXWC 5EBWA 4ODWB 5JOPD 2P24B 2EH8H 3VXQB 4P3DB 1IGIL 1KG0A 5DFTA 4OB5L 3FRPG 1HXYB 4PJ8A 4MZ3A 1BZ7B 5DEGA 3U79A 4NBZB 3QQNA 4PGEA 1WZMA 4HUUB 1BBJB 4LGRB 4MJ6B 5D2NC 1T1YB 4RMWA 5CJXC 1HHGB 4OZIA 4X6DB 2X4OA 4P4KA 4NQTA 1QEWB 2BX5A 2MNUA 4X4YB 3WHE0 2YD1A 4N5ED 3BJLA 1ZLWH 3RIAF 1XFPA 1FZJA 4Q58C 5JPNB 2XPGB 4H26A 3DHJA 2CKNA 3MOAL 4YO0A 5HYJD 5DHVA 5C0RH 5D7KD 4AYFA 2R69L 5CLTA 5GRUL 1RIVL 5IMOA 5J13B 2MFNA 1C16B 3QEGL 1DEDA 4W6XB 2HRPL 2QADB 3F5WA 1SJEA 1KCKA 4MZ2A 5JPMB 4QRPB 2EIZB 5DQJA 1YY9D 4PJAB 4WUUD 3S35L 2UVEA 4ZOAA 4PP1C 3VI3E 1MHHB 4J4PA 5L9DH 1DQQB 3K4DA 5EWIL 1ZKAA 4M5ZL 3LN5B 4IMKA 5DRWA 5E2UH 1CBVL 4GAJH 4WFHE 5IB2A 1ZHKB 4HQQL 5HDOA 3B2VL 5SWSD 3EO9L 3JV4A 1A9EB 5EZJB 4FFYL 1I85C 2VNCA 3SDDC 4LLVB 4OZ4A 3S36H 5FHBH 5KSAB 4TVPD 1A6TB 5HGDA 1BQUA 1RUML 1KTLB 2V5RA 1UQSA 3KYNB 4ZFOA 1ZLVH 3QDJE 3OKYA 1OAKL 4PR5A 1BECA 3J8F7 1MEXL 3VMNA 3F58L 1B3JA 1JPGB 4YHLL 1DVFB 1LK2A 5D8JL 4X9BA 1LQSR 2BHZA 4PYHA 3GUTA 2B1HH 4K3DH 1WZLA 2BRRL 2DLEA 4HGWB 1J86A 4PJGF 2JCCB 3FRPA 4NHUB 1N2RA 4OCWH 4RMSA 3I3EA 4GG8A 4Y5XB 1NDMA 3HZMB 1DP0A 3PL6C 2VE6B 2F54A 3EGSB 4U6XB 5IVXE 1MCEA 4HAGA 3QEQE 5HHOD 2ADFH 4UINH 1RMFH 3QXVA 3MRRB 3VD3A 5F7HA 1SM3L 3AU1A 3QHTC 4K9EL 1KJ3H 1FFOA 4YDLB 1IGCL 4OCXL 1NLBL 1TJGH 2P5ED 4ZDHA 3AAZA 4TTDD 3PQYA 3HR5A 4X7CC 5CGTA 3OF6D 3NZ8A 4KDWA 4GKNB 3MLXL 4RBPH 1MCQA 1I7UB 2AJZA 3MA9L 4F58H 4Y19B 1EVTC 4LASL 5JXEC 4N0UB 4MQXD 3RKPA 3IDJB 2YPLB 2XXCB 3HUJE 3TVMB 3C5JB 4KZDH 3KDMB 5D71H 3STZB 1IQWL 5DYOB 2R1YA 2J6EA 4PJ7F 4EI5D 5KAQF 1NAKL 4PRID 4G3YL 4ZFGL 1WFTA 2EC8A 2ZOKA 4HKZA 5FV2A 3ZLQC 1WC7A 4UT7L 1KTDA 4DKFL 2NY1C 1F4XH 5C08B 3D9AL 2DQIH 4HUXA 4APQB 3G08A 1F6LL 1KIQB 2W60A 3GSWB 4OM1H 1SYVB 4DVBB 4PRDB 3HN3A 4H0HB 5D96B 1IT9L 3HG1A 3BPCB 3RNQB 1NBYB 3SGJC 2WUCH 4QHMB 2VABA 5FKPA 4NO5B 4W68A 1CGSH 1MHPL 2ZUQB 1I75A 2BRQA 3OL2A 1K5NB 3QUYC 4ZUWB 5B4MD 3PHSA 5IHZA 4R97B 3QI9D 1YPZF 5EUOA 1W8OA 3BP4B 5B38B 3RWJA 4AG4L 2JCCF 4FZ8H 4Y8DC 2DM3A 4P23A 2V5YA 2CXKA 1XGUB 4C56D 5FGRA 1WBYA 4ZFZA 5LBSL 1VHPA 5F96H 4LU5H 1HHJA 5DJXA 3QJFB 3BDXA 1X4YA 4ZODA 4Z7NE 2A83B 3ILPB 4K7PH 4NWTH 1P84J 3PXJA 5HDQL 1RUKH 3KPRD 2AJYL 2UUDH 2VLKA 4NO3A 5FYLL 2ZSVB 3C6SB 1Q72L 3F7QA 2DIAA 1WISA 1NCTA 1UWGL 2JJTC 4R0LB 4KK5C 1YMMA 1RJLA 2H6PA 2Z8RA 3O2DL 5GZNC 1X5XA 1JTOA 5AWNL 1AD0A 5TQ2L 3CNKA 1WBZB 4AEIL 5B3NA 1DZBA 2IQAB 5D2NA 3H9SA 3K2UH 2V17L 4C55A 5CJXA 3FQNB 4F7PA 4OUUB 5JHDD 4OQTA 3HRPA 3L6FB 5AZEL 4AL8H 2RFXA 1A6WL 5DD5H 2MCG1 3F8UB 4KKCC 5MEOB 3GBNL 3WHXB 5GS2H 1FO0B 3KPMA 4D0DB 5C0CA 2HAZA 4GW4B 5KTEH 4D9QE 4WI6A 5CINL 1MJ7H 3I2CH 4U1IB 3ZDXE 2FSEA 3ZHDA 5CGYD 5SWQA 1TTFA 5JLZA 3KG5A 5IMLA 3L5WA 1GIGH 3ZT5A 2GT9B 5JW4R 2YKLL 3KPQB 4M61A 1CG9A 4U1NB 4MA8L 5EIQA 5GQBA 2X09A 4Y4FC 1Q1JL 1IAIM 2HJKB 1D3CA 4LGPB 1E0OB 4PV9B 1S9XB 5ESVB 3MYJA 1CF8L 2VLMD 5TF1H 3VDBA 5FCUH 1EHLH 4Q9QH 3F7PC 4OTXH 2B20A 5FKAB 2EYRB 3V0VB 4X98A 1AGEB 3LRGA 5M94B 2EDDA 2X4TB 1R3KA 5IFJB 3C60D 4U0RB 3ZO0A 2K7PA 2Y36H 1UXWB 4X6EB 5I1KL 5DWUL 1LO4L 4KROD 3E8UH 4GLRH 3CFDB 3W9DB 1IAIL 4IDLA 1B90A 4V1DE 5KW9L 3T4AB 4YDJA 4LLDB 4TNVF 1TQCC 1IC5L 1I85A 1VFMA 3SDDA 1IM3B 4HWBL 5A2LH 3W0WB 5FYKL 4A6YB 4HIHB 3AMKA 2BC4B 1IAKB 1MUJA 1NFIB 1ORSB 1BFVL 1E4KC 4F7CA 4FXKA 1YEEH 2DWDB 2NX5E 4FG6D 3G04B 1YZZA 43CAA 2NZIA 4FQHA 4AM0A 3P73B 4FQCL 1NANI 5IBTH 1MAML 1RZ7L 1XR8B 4ZSOA 3IFOA 5I8CB 5L88L 2A0LC 1OW0C 2NXZC 3VFVA 1YEGL 5C6TH 3BW9B 2MQ3A 5L2JB 2J2ZA 1QG3A 3PL6A 3HE6C 2C1PA 1HSBA 3BPOC 1TCMA 4KC3B 3VRIA 3UZQA 3SGDI 3VXTA 4HT1L 3UYRL 2P8PA 4P2YA 1E28A 3MACL 4PV8A 4XVUC 2L4OA 3MRIA 1OGTA 2H3NA 3L3HB 4HLZG 3SOBH 4LLMB 1A6PA 3T8XB 3IKCA 1KJMA 5FOBB 5I1LB 1U92A 1PZ5A 3RWCB 4LEXL 1WUNT 3CFCH 1U8QA 1KIUA 2PO6B 3EO0A 4R7NA 4YX2L 4PJ5B 4F7TB 3WO4B 3HC4H 4UUJA 5AEAA 2I60H 3F65A 5JXEA 3QQ9D 4NJ9L 1VGEL 1I7TB 1IGJB 2HKFH 4PGBB 3HNSL 4OAWA 3CZFA 1DJSA 3GJFH 1KN4H 3RFZC 2XWBB 5DXWA 1P7QB 4ISVB 4XPFL 2HN7B 5KS9E 1N4XL 1NLDL 4M1DH 1QZ1A 5A43C 4FFVC 1FLRH 2PYFA 5ISZA 2IADA 4HXAL 4PB9H 3NGBB 1KLGA 1WZ1H 5TFSH 2R0LH 4L8DA 2CUHA 1MJUH 3MRNB 3MV8B 4RGND 1M7IB 3RWHB 3V5KB 1UXSB 3T0EC 4LHJB 4NNXA 3I6GB 4IOIA 2YRZA 4W81A 3SGJA 1U8PA 1JE6A 1WCBB 2IG2L 4PLJD 3UO1L 3IDUA 1F97A 3SKNB 4ZAKD 1KSRA 3S36X 3NACL 4RX4D 3RZWA 3KYOA 3QUYA 4M5YH 1RV6X 2VITB 3MLUH 4DJMA 4HUKB 3LIZL 5GRWA 4EQ3A 4BK4A 4UNVA 4JKPL 2G5RA 5MP6L 3S37L 3I3BA 1QBLH 3SBWC 3CC5A 4I2XA 5DUML 2GTWA 2CGRH 3V4PL 2I9LB 4YBQD 3NZHL 1Z3GH 4XZUA 5DQ9B 2LVCA 2DBLH 5C07A 3QT2A 4HKXA 3QIWD 4I5BA 1CT8B 1YMHA 2W9DL 2NY6B 5CD3B 4RZCB 4QRSB 1WQVT 3UBXB 3FO2B 3MXVH 4KI5F 1R3LB 3NTCL 1EEYA 5GRJH 2JJTA 2EZ0C 1U8KB 4XVTH 4AIZB 1DN0A 3S5LB 1P2CA 4HX1A 4GRLC 5B39G 4JN2A 2J4WH 1UH4A 5I1IL 4LLUB 5BV7H 1CFNA 4LMQI 3S96A 3OQ3B 5IEHA 1P4LB 5EPMA 1AKJD 2W07A 1IAOA 1AIFB 4I3SH 1GPOL 1KB5B 1ACYH 1R0AL 2VXUH 1F00I 4L8BA 4TOYL 5HYSB 4MA1B 3EYOB 3RU8H 4Z7OE 4BK5A 4JJHA 2KQNA 3OKMB 4I48A 1HWHB 4O9HH 3TH4T 3QNXB 3FCTB 3RGVC 4PRHB 5A3IC 2H1PL 3D69B 4Y4FA 2VDPL 3PWPE 2P5WE 1DSFL 1GHFL 3RWFA 2G2RB 4LSVH 2ZUTA 1GOHA 3JWDL 2NXYB 5ICYB 3BP5A 3L3IB 5CD5C 5KVFL 2Z31B 3DARA 5C0FA 1QHPA 1H8SA 4NSKB 4X4ME 4BQ9A 5HXMA 1KPUA 2EEAA 3CMOL 1DLFH 4YNYB 1FIEA 3D25A 3T0VA 4MYWB 3KS0H 4BSJA 2VDML 5IBUB 2XZQH 2MTPA 4WNQA 5DMGD 4UNTA 2I9TB 4KTDH 4PB0L 1A7OL 1FV1A 2J88H 4POYA 3MROA 3GHBL 3EDEA 3BRGC 5BQ7B 1NMCB 1A47A 1E4KA 4BA8A 1T1ZB 1FE8L 1RK0B 1L0YA 5BS0A 3O6MH 4NIKB 3EO1A 3GB7A 5HI3C 4PRPE 3O6KL 4YDVA 4ZOBA 2FX8L 2LTQB 1CD9B 3TH3T 1HQRB 2D7MA 2E5EA 5IESL 3KPLA 1ED3A 1OW0A 2VXVL 4JRXA 1CLYL 3V9FA 5B39A 1RZKC 5HVHC 3HI1B 1A6VH 4PTTA 5DJ0A 5D7JC 1R3HB 1KJVA 4X9HA 4HUNB 3HE6A 5I17A 1F58L 4QHUB 1EGJL 1RJCA 2VLJA 4F9LC 2HFGL 4BQCA 4WI8A 4ZNCD 4FXGA 5DD0H 4GQ9H 5IW6A 2VLRA 3BE1H 4I18C 3WFEL 4GRMA 3W2DL 4JLRB 3IFNL 5EDXA 2XACC 4TUJB 4CU8A 4XNQB 3NA4A 1TZHA 1NL0L 3PIQB 2NW3A 3NPSB 4QTIH 3GSUA 5EBLA 1OT1A 1S7TA 3HI5L 4HJJL 2EDQA 5E8NB 3VXME 4YXKH 2VXTL 1YJDH 4J8RB 4PJCA 3NOIA 1FFNA 3RX7A 1CTNA 2Y7QB 4HH9A 1QQDB 4ELMB 4HF5L 1UJ3C 2JJWA 2NW2B 5DJZA 2Q76B 5FO8B 1A14L 2Y6SD 3SDYH 1AD9A 3ZDYF 2AJUH 3OAYH 5IQ7L 4NM4H 5KSBF 4JRYA 2HVJB 1F4WH 5SWZE 3VD7A 2W38A 2B4CC 4Z77B 3GMRA 1JWMA 3IVKB 3SDXB 1FNEB 2C26A 1FNLA 1TTGA 4JPIA 3IAGC 1BVLA 2F53B 5FHAH 4OCSL 1AHWC 1ZWIA 3P11L 3CD4A 1QBBA 4FMKA 4RGOL 4XPHL 4LEOA 5MERB 5IIEA 1P1ZB 2LU3A 3T0EA 2LVEA 2DQCL 5KSUB 1NGQH 4JJ5A 3QO1B 4Y1AA 4CUCA 4MNHB 4QOKD 1R3JA 2NY5H 3TJHD 2QTEA 4MVBC 4X5XA 2YA2A 3C5SB 2YN5A 4P46B 5K9OB 3QDGB 2BSED 5MEPB 3EOAA 5ELIA 3ULVD 3GSVA 5ICZA 1I8MA 1E6JL 1EA9C 4P57B 3K3QA 5D72L 4P3CL 1HHKA 4U4BA 2HVKA 5L6YL 4G6FD 3SBWA 2ADGA 1ZS8A 3THMH 1CR9H 3IDYC 4NQED 5C09B 3CLFL 3MUY1 2C9AA 2XIDA 1REIA 2J12B 2P43B 3UJIL 2FWOA 2XKSA 5DJCB 5GGVL 1G6RA 5FECA 3MA7B 4TUOA 3UTPE 1UM5H 1OP3K 3V52H 4YHPA 1IQDA 4NRXA 4LCUA 4XHJD 3D39B 3O3DB 4UAOC 4HS8H 4KUCD 3EYSH 4R8WL 3RZCD 2HJLB 2HFTA 1ZA3A 1TZGL 1I1AC 2WBJD 4E0RA 2COQA 3UTQA 5E8PA 1JP5A 2HJFB 1G7JB 4JO4H 1IBGH 3U7AA 3SQOH 3VFRB 2R0ZL 1RIUH 3BQUD 4TVPL 4PG9A 1K8IB 3I50L 3QFJE 2NTFA 2AJXH 4ZD3L 1IKNC 4KHXL 4NQCD 1VKXA 3GIZH 3SCMC 3WIIL 5HYFA 1PKQE 2BDNH 3BH8A 3DROA 4ONGH 1MLBB 4GW5B 3UROR 3KYMB 1T66C 5C0IB 5IQ9A 3CK0L 2NZ9C 2CSPA 3LH2L 3TZVB 4WW1A 3SDXF 2GEEA 4U6HB 3T0AA 2YOCA 2O61A 1J05B 2DWEA 4GW1A 4M6OL 4XNXH 3GGWA 2FX7L 3ARGD 1V7NL 4MJ5A 1R6VA 4QRRB 5BVPL 1GYAA 1C1EH 4LSPH 3I6KB 3KGRA 4KQ3L 4CN1A 3KHOA 4LRNH 3W11D 1A0QH 4HIJA 3QCUL 1I3RA 1JWSA 3OZ9H 4M6ML 1CQKA 1S5IH 5A16A 5HYEA 5ERWA 1JRHH 4OCRH 4OJFH 1AY1L 3HMXA 1FIGL 3IXAA 5FK9A 4UIMB 5DJDB 2OMBA 3OKKA 4NN7C 5ALBH 3EOBB 3C5ZB 2B2XL 5KANG 4JFOA 3RUGB 3S97C 4LHUD 5K59F 5EZIL 3RNKA 3ZKQD 3V79C 1FJ1B 4OM0L 2VDNL 2KH2B 4MLSA 5EO1B 5TDPB 2ATPB 4HK3N 4NFCA 5T1KA 1T2QH 5BXFA 3O6LH 2DL9A 4NQDB 1DBJL 5F89B 4P2RD 5J11C 5INDB 5HJ3A 3QDJA 3G6DH 3ZKMC 5LWYL 3LKQA 1D7FA 4QTHB 25C8L 2D31A 1T7VA 3FT3B 4KMTL 2KL6A 5E00A 3CFJB 4L1DA 4R96A 3MRDB 1MFEL 3RX8A 4R4FH 2J3SA 1JGLL 1J1XH 4WI4A 1MCWW 3DVGA 1HCVA 3RKDC 2WWMD 3V6BR 5JO5A 4XCYA 5GSRB 5D7JA 2G75B 3RY5A 2CR3A 2Y06H 3VXNA 1S5HB 2B5IC 1J88A 5IVXA 1GJIA 4F9LA 3G6JF 3QEQA 4ZFFA 1QUNA 4HKBA 4LCIL 2VDQH 4I18A 5FGCE 4YBHA 5EO9B 1VGKA 3Q2CA 5IB4A 4DFIA 2D9QB 1JMZA 5TGBA 3O41A 4Q6IC 3OPZH 4FOMA 3PDOB 3KPOB 4ESKA 3I9GL 3K4ZA 2BNUA 2Y9RT 4EDXB 5BRZB 5ITBH 2ESVB 3BEVA 1Q8MA 4KJYA 3O81A 3KPTA 5F6IC 4TN9A 5CP3H 1TCRA 3SGEI 3GMOB 4P4KD 1FL6B 4KK8C 2FL5A 5JW4M 3DETD 3HAEG 3HUJA 4X8XA 3D18B 1M7DB 4KRPC 4WFED 5T1DL 4LLWB 5D2LA 1LD9A 2DTSA 3QWOA 4H5SB 4KKLC 1FO0H 4UU9A 2JELL 3HZVA 3FN0L 1QPPA 2PTTA 1ZVSB 1AHWA 5GISH 1R24A 3B9KC 1EH9A 5EUKA 4JFFB 3NCFB 4GKZB 4G5ZH 4FZEH 4GAGH 4QGYA 3NMEA 5MENE 4YGVB 2JIXA 4HK3J 5I73C 3MJ9L 4FP8L 5E9DE 43C9A 3P4NB 4G8GE 4XAKE 2EC9U 3FOLA 3DURA 2XXMB 4KVCH 4J4PD 5IF0A 3TT3L 3IDMB 4ONFL 2BVOA 3B83A 4L5FH 2YA0A 4G8EB 2FD6H 4OD1H 2M2DA 5DS8A 3F12A 4L4TB 3SPVB 5KN5B 3OJVC 2R4RH 1I4FA 4FQLL 2IPUK 3QG7H 5I66A 3ULVF 1MCIA 4LCWB 3IJYA 4LCCC 2CIKA 5EFIA 1DDHB 2RHEA 4NO0B 1CVSC 3NCJH 1G9NL 3KYKL 1OB1B 3D0VB 2H8PB 1A7QH 1RURH 5FM8A 3L5XH 4WV1C 4PP2B 1YEDA 4A6YH 2K7QA 3WL9A 4HZLA 4C58B 4ENED 3X11B 4MCZB 3D1MC 3TNMA 5FO7A 4PD4K 4HEPG 1HNGA 3ET9F 5DZNA 4QRUA 5DTFB 3HNVL 4HPYL 3MRCA 5ACMA 1VFBA 4EIGB 1I1AA 2IPTH 4X9FA 5EOCH 2EDJA 1AFVH 2VC2L 3O6FB 4YZFF 1FH5L 3MXWL 1IKNA 2LE9A 3O3BA 4FFZL 2Z92A 4IMLA 5HTSA 3SCMA 4U1JB 2RQ8A 3QIBB 2W9EH 5DLML 1FAIL 4JO3L 1N5YH 3HAEA 4I3RH 3O3AB 4OFKA 5F8RC 4C59B 5JNYA 2IQ9H 1TIUA 3T08A 1DBAH 2XQBL 5EC1A 4PS4H 4F33A 4GBXC 5HPMB 1TZIA 5T5NG 1DBMH 4KQ4L 2F5BL 1LK3L 4HS6B 1QSEE 3NAAL 1QSVA 5F1NA 5IGXH 3WN5C 3Q6GL 1LO5A 1NCDL 4EBQH 3NCMA 3ARSA 4OV5A 1G7IB 1R5VA 3X3FL 3DIFA 4BFIA 3WUZA 1SJXA 4HFUL 4JFPA 3QNZB 4X7DC 4YPGA 5DUPH 1D6EA 3K0WA 2YC1B 4J3SA 5CHNA 3KPNA 3DYOA 1HEZB 4JPVL 3MCG1 4ODTL 4XTRD 2WMPA 2VXSL 5I0ZA 2V9RA 2BOCB 2P44B 3TT1L 5J3HD 2X1XR 1P7KB 1FBIH 3MRFA 4V1DA 2GJ6B 4CVZA 1MY5A 5T3XD 3LKNA 3SKUD 2XI9A 1NDGA 5ADPL 4QHKI 3ES6A 3TCXA 1FG2B 2BNRE 3HG1D 4Q97A 3W9EA 3A6BH 5IG7B 4ELKB 1G7HA 2NX5A 3BDYL 3L1OH 4JGUA 1ADQH 4KVNH 3SO3B 3QJHB 1U95B 2DQJL 3T1FB 1VEPA 1XAUA 3IRZA 4L3EE 5D7LB 4TULL 5TPWH 3TFKC 4ODXB 3LD8C 4N0FB 5IBLD 5DSCB 2V2XA 5DR5L 4BFGA 1B0RA 2GI7A 1L9NA 1F3DJ 2V2WA 3CXDL 4LSTL 4PJGE 2NY3D 4FTVA 2O5XL 1NEUA 2WV3A 4HWEH 2EXWD 1OSZB 1HIML 3S8WA 2F19L 2JB5L 1W0YT 4Q6IA 4OLWH 1N5AA 1E27B 3L95B 5KSVB 4WWKC 1XEDA 3LMJH 3BMWA 3L7EA 3VXOB 3WJJC 4O58L 1U91A 1U0QA 3G5YA 1QFOA 1YMMD 3OKEA 4YFLI 4I4WB 3NIDF 1GOGA 2AV7A 3UPCA 1U8LA 2OTWB 5ESQA 3H9SD 4X4XB 1KCSH 5BO1H 1IGMH 1IFHL 3CUPA 1ES0B 3PWJA 1D9KC 1W0WB 4FQXB 3B2UC 1U42A 1UVQB 2NYYD 1NGWA 3O9WC 2FEEI 5CILL 1TMCB 4QRQA 5K9QI 3EYUH 4K23L 3CPLA 4TQEH 2C3XA 4UV7H 5KS9A 4NZUL 4QY8A 5C0CD 3QPQC 4J1UB 4QRPE 1OAQL 1WT5C 2YRLA 4PJAE 3B9KA 3K4AA 3N1PC 1G7MB 3BO8B 5D1XD 4LVNC 4RMUA 3E6HB 4Z0XB 3BKML 1YQ2A 2IANB 1I1YA 1AXTL 4HH8A 1X5JA 4Z7QF 4WY7H 1KPRA 1HHIA 1PDKA 4C4KO 2GYSA 2GITA 1FVDA 4IOSD 4PJIB 4PP1D 3VXPA 4YWGH 4LDLB 3VG9C 1J1OH 4K3EL 1T5XB 2P46B 2VH5H 1MRDL 3LZFL 1QBMH 3DNKA 5JORA 2FBJH 1I3GL 1H0DA 5J57B 4PJFF 3O2VH 2X41A 3QH3A 1T03H 3KR3H 3OKLA 3FO1A 4NWUH 4UT9L 1A8JH 4LCCA 1FDLH 1IGFH 1YPZE 3AB0C 1S78D 3WXWL 1M05A 1RPQA 4NQVB 4GOSA 1N8ZB 35C8L 4YXHH 1MWAL 2JCCE 2IFFH 2JK5A 4ZQKB 4ONHA 2Z9TA 1AXSA 4WV1A 1QBAA 3GDBA 4OGYH 4U1GC 5AUMA 5CBEB 2BP3A 3LQAL 1CDBA 4ZUVA 3O8XB 1BD2B 3LVEA 2FJHB 4PJHB 4DN3H 4JQIH 5I1CH 5E6ZA 2ZG1A 4XP1H 5CCKL 4R3SA 1NGXB 4Y4HC 1T3FA 2Q87A 4F7MB 4XXDB 3PL6D 1C5DB 5LG1A 3T4YB 4KZEL 1N6QH 4ZYKA 3HI6L 1KIPB 1AQDA 2DD8L 3R1GH 2EIBA 5HHVL 2C3GA 3RWGB 2XTLA 1HZHL 5E4EC 5C0GA 3KJ4B 3MSPA 4YH6A 4Y19E 4BELD 4GBXA 1QTYT 5DJ8A 5HY9B 3C8KB 4N0UE 3FO9B 3LB6C 2VLLA 4U6VL 1T1XB 4F2MB 3BX7C 2C3HA 3WS3A 3O3EB 4Y4KC 4X7TA 4QEGA 4LKXB 3RX5A 2NY0B 3WN5A 4NNPL 1RULL 4NNYA 1GGYA 1FC2D 4YBLB 4UDUB 4PJXF 5T3ZH 2P5WA 1TNMA 4XPTH 3W5MA 1KELL 4G6ML 1T6VN 1Q0XL 1B6DA 1IAMA 1FVCA 3UJTH 3FT2B 5H37H 5C08E 3H7BB 1G7LB 2UZIH 3ARQA 3QAZC 5IEKB 5EU5A 1K4DB 4PJIF 3F7VA 4WU7A 4X4MA 5GS1C 3QEGH 5F1IA 2YEZB 4AEHL 2NY1D 5FUOL 1QRND 1S9VA 5C7XH 5IFHL 3QUXC 4HUVA 1AJ7L 2HRPH 4QCIB 1R5WB 1VFAA 2ZSWB 1JF1A 5C9JA 2ITCA 3ECBB 3VXSB 1Z6JT 4PLOB 1T0PB 5GGSA 4C54A 4NP4L 3MLZH 2QQNL 4EJ1C 3SKOB 1CBVH 3RWEA 2VZUA 4GKSA 3VW3H 2N7AA 1ETZB 1J5OH 4JREB 1P53A 2WK2A 2E7HA 1ZLUH 2DQTL 4PRPA 2A73B 3QUYD 4S1RL 3RDTC 1A2YB 4H88L 1EJ6A 3PP4L 1IRAY 1PG7H 4PJHF 5FUZL 2VXQL 3BAEH 1S7WA 4D9RE 4CL7A 5ID1B 3TBSB 2B7DT 1JN6B 4MLIA 5FA3A 3C8DA 3GIVA 2WIMA 4HXBL 3GSXB 5C07D 1RZIA 2IAMC 4DVRL 2ZUYA 2H32H 4MD4B 3OXSB 2GUOB 3FZUD 2ENSA 4XP5H 1A7RL 4Z18A 5L0QB 4OT1H 3RBSA 5GS0H 4WWKA 5D93B 1NMAL 3CDGB 4WW2C 1BMGA 1CICB 3WJJA 2FO4A 3VXMA 3BDBA 2AI0L 4IM8A 1AGDA 4MJIB 4KK5D 4Y16D 3MR9A 2BY2A 2V5SA 4QXTA 3U36B 5HHOE 3V6ZA 2XICA 4UI2A 4UZGA 5HHNB 4IIQC 3T65B 1OF2A 2A6JA 4U6YA 3QCTH 4BKLB 4YDIH 4P2QE 1D9KA 3NIGF 5GSVA 3SKMB 4QYOA 5GJTL 3UTZB 3HFML 2XWTA 2C1OA 5KVGL 5E6IC 4AK1A 5E03A 1KJ2A 5HGHB 1CE1L 4KKCD 4N1HB 1FZMA 3GBML 5SWZA 3DBXA 1G7QA 1NJ9B 1MELA 3HS0A 5E6YA 1WT5A 5CEZD 2GAZA 3VFNA 4QT5A 1TQBB 5F3BB 4POUB 1D5MB 4Y4FD 5DRNB 4ETQA 3S3PA 3WJLC 3LS5L 3ARFB 1SBSH 4UTBL 2BXYA 5LQBH 3IS0X 5IB5B 3V8OA 2PTVA 3V7AG 2FJGB 3IT8D 2XRAH 3BP7B 3BGFC 1HSAA 3WFCH 3GSNL 3MLYL 5KVMC 4LF3B 8FABA 1IC7L 1Z0MA 4BSVA 2BSTB 3W0WE 2AV1B 5D7IB 5I74B 3MBEC 3D9AH 1MCPH 2RJMA 2H26A 2R8SH 3NCYP 3P9WB 2NLJA 1ZHNA 2IBZX 5CSZA 1RAMA 1II4E 1OSPH 5EC2A 4PRIB 1S7SB 1EMTL 1MCJA 3S34H 5T1MB 3ZDZF 5BCAA 4NKQB 3WKMH 3DVFA 4CMHB 1CFSA 5BS0D 3ZSSA 3ARUA 1S3KL 5BV7C 1I9IH 5E08H 5FV1L 1BOGA 3BKJL 5I8EA 4I77H 4MB4A 3GKZA 3CVIL 5E0QA 4P99A 1F6AB 2A0LD 4UT6H 2NXZD 1N6UA 2QQLL 3EOTH 3FB8B 1RZGB 4KI5E 1DTUA 4G9FA 4OLZH 3LPWA 5M95B 3ISWA 3QA3A 3QFJA 3U1SL 5EO0A 3ULVH 1N59A 4R90L 1PKQA 3M1BB 1JHLH 5KG9A 3DRQA 5FYLH 4M03A 4PJ5E 2VLRD 4K3GA 1XGPA 1RZFL 5DK0A 3CCHB 1KPVA 4GXVL 4XVUD 5F7NC 4CKVX 1W72B 4LSDA 4V2BA 1T7ZA 1BJMA 3MFGB 4JCMA 1V8HA 5DK2B 4Y4KA 2DLHA 5SX4H 2X4QB 3QYCA 5EU6B 5FFLA 3CH1B 3BZEB 3N85H 1PY9A 5ESAB 5JHDE 2YBRB 3QUML 3ALWA 5LGHH 2DMBA 3TN0C 1YA5A 5F9JB 1F3JA 1JGEA 3BP6B 4H8WH 4XMPH 1VPOL 3GBNH 2IFGA 1TVHA 4JFQA 4UIKL 1F90L 5EN2B 5IW1B 5EBMB 2AXJA 1MH5B 4JRYD 3DXAB 2ZUVA 3PGDB 3UDWC 1JK8A 5A1AA 4XPAL 2J7LA 2AK4D 3D2UB 4FFVD 5GS1A 1AQKL 5D1QC 2WW8A 4I9WD 3ESVF 3N9GL 3NIFF 4JAMB 4JY6B 3TBYA 1OTUD 3QUXA 3U4BH 4G6AC 5DZLA 4POZC 3RVVC 1AGFA 5GGUB 3H9HB 1NC4A 3LV3B 1Z9SA 4HIIA 3U0TB 5BZDB 2GQHA 2DQEL 2WIIB 4NGHH 1CZ8H 1CK0L 3QEHA 3T0ED 4R2GB 4NC1E 2PYEB 2X9YA 1EFXD 2V6HA 1NBZA 1PQZB 4Y1AD 3PNWA 1T0MA 3PABA 4GO6B 2P4AB 2EEDA 1X5HA 1IGYA 4OIIH 1IAIH 3U2SB 1RIHH 3RDTA 4L29B 2ZOLB 1UM4H 2NY2C 3D0LA 4GJTB 1FNSL 2X4RB 4Z76B 3MRLA 4KHTH 5B8CC 2VDOL 3T3PF 3IAPA 1S8DA 1I1CA 4JDZA 5CP7B 1YDPA 4NKOA 1YJDC 2DLFL 5EU4A 4Y5VB 1DEEA 1A3RL 2IAMA 2O5ZH 4WJ5A 4N0YH 5EH1A 5F9OH 2ZCHL 4Z7WB 5D7SL 1IM9B 5LCVL 4PGZA 1MAMH 3BPLB 5JW5B 3GJFA 4WW2A 2WSKA 4XMLL 1M71B 5LJYH 3P9LA 4P5TB 2ADIB 2EZ0D 1JZ4A 3RY4A 1RD6A 3DVNB 3QHZL 5IV2A 4GRLD 4HK0A 4QXUH 4P59H 1I9JL 3U9PL 4IIQA 1ZHBA 3FO0L 1TITA 1OCWL 4HT1H 4ZFOL 2XZAH 1CD1A 4LLQB 2Q20A 5DHYB 4CDGC 3QBTB 4NZDA 4RAVA 4JO1H 1T5WB 5J13C 5E6IA 3FAWA 5DMIL 5IHUH 4X6CF 4PRHE 3QZWB 1D6VH 3MNWB 1LEKA 3WNMA 3D6GA 3ZKND 2NY5C 3ZDYE 4TUKH 4DK3A 1HE7A 4MQTB 2XZCH 5ETUA 5KSBE 4JZJA 3GRWH 4NJ9H 1MCLA 4EOWH 1A6UH 3RGVD 1MFAL 2Y1VA 1DANT 3NA9L 2A9NL 1DL7H 5A3ID 3GMNA 2HG5A 2X4UA 3WJLA 2MJWA 5F1SA 5MENA 1T4KA 1CLZL 5E9DA 5KVDH 3C6LA 7FABL 2F5AL 4G8GA 4I0PB 4S1QH 4U3XA 4MDIA 3FFCA 1P84K 2E7MA 4A2LA 5CD5D 5DMKA 4U1HA 3NN8A 1EX0A 4XAWH 3S35X 1H15B 5KSAC 4OLYH 4I13B 5AZ2L 4WFHD 3MBEA 4HV8A 1RSFA 3H3PH 3TBTA 4DKDC 2Y5TA 1S9YA 2YPVH 1KCLA 2ZP0T 5GGTH 3DX8B 5JOFA 1OTTC 4X8JA 1F42A 3VWKB 1MVUA 4OGXH 1DVFC 1CGVA 2OXHA 4OIAA 4Y2DD 3ILQC 2QSCH 4IDJL 4X5LA 2UWEB 1PG7X 1WIUA 1UCBL 4X0KB 1EPFA 3G5XB 3TA3C 3MRMA 3FQWA 1LDPL 3QDJD 3SGKC 4XCFL 3FONA 2J6EL 4Y5XC 5F9WB 3ZTNH 1JPFA 5HI3D 4RSVA 4X99A 5MP6H 3EFDH 3PWNB 4HDIB 1N7ML 2OS7A 3FB5B 1BM3L 2GTZB 4MJ4A 1MFNA 4XRCB 2FJFB 2Y4SA 3PHQA 4D0CB 5T3XL 1F11A 1NCBH 5FM5M 4DKEL 5D7JD 5JW3L 4GFTB 3ARZA 4R9HA 3K46A 2C4FU 2R2HA 3CFBB 1XCTA 3F7YA 3TO2A 5T3ZE 2DI8A 2P8MA 1GZPB 4DGIH 4PTUB 4NPYA 2OR9L 1IVLA 1SMAA 2BFVH 3DUUB 5F3HB 3MGTB 1IJ9A 1KUMA 1S7RB 3V6FB 1J9CT 3WSQH 1ZK9A 1ONQB 2Q6WB 3V5HB 1GH7A 1MCBA 2X89A 1BBDH 2CIIB 1QSEA 5I1IH 1JF6A 1EEZB 4RFEB 4P49A 5C0AB 4DAGL 3ROLB 3AC0A 1U6AL 3TN0A 4PJCF 3SDXE 4MGXA 4Z95L 3DX6B 1E6OL 2PETA 5E95B 1FNHA 5TE4L 1JBJA 2EYTB 2VDLL 2F53E 3GMPB 2AS5M 3FB7B 4PUBH 3GSRB 2Z35B 5SV4A 3KPPB 2C3VA 2Q1EA 1PD6A 1XGYH 3IDNB 1F6FB 4APQC 3UDWA 1I8KA 4DGVL 3ETBF 5D1QA 2JB6B 5D96C 2ZG2A 1A6ZB 3LN9A 3QULB 5SX5K 2G9HA 1V7ML 2X70A 1X5YA 2PCPA 1DFBL 4JGMA 4WGVB 1NBQA 2BOBA 4PY8J 4ZUSA 1LO3H 4Q9RH 3B3IB 5KAQG 1UA6L 2PKDA 4OQTL 3IDXL 2AGJH 5DD1H 4R97C 3RTQD 2BNRA 1UC6A 2UWEF 1A6AB 1FZOA 4F3FB 1YECL 4MNQB 2BSRA 1F3RB 4N5UA 1JI2A 5E1AB 4P3WA 4MVBD 3K1KC 3A6CH 5IHBA 5C09E 5CUSH 4F9PC 4X7EC 3KNBB 1G9MH 2W59A 3WD5H 1KIRA 4XVSL 4XMKH 5D9SA 5FO9A 1KGCE 2BSSA 4L3EA 5B8CA 2EC9T 1HINL 5J8OA 1MWAB 3ARTA 1ZTXH 4MHHG 2GSGA 4XNYH 2P24A 4FQQB 1LO2H 4HWZA 3VXQA 4P3DA 3D39E 1F4HA 5FCSH 4PJGA 4G42A 4G80A 2YK1L 1HXYA 4R0LC 4Y0GA 5DFWH 3RWDB 1BZ7A 2OJZL 2R29L 4U1KA 4KTEH 1E4XL 3K80A 5ITFB 4O2CA 4MJ6A 4Y8AA 2Q8BL 1D5BA 3G6JE 3KAAA 4YHKL 5EA0L 4KAQH 4X4YA 4ZTOH 2A6DB 1AO7A 1B4JL 4XCEB 5F7LB 1S7XB 1FYTB 1Z0NA 3VGAB 3ULSB 4G43A 5JPNA 2AXGB 3VRLF 1HWGB 3SCMD 5IMKB 4PBVC 1HDMA 3WFEH 5F7DB 1PFCA 1DBBL 1EEUA 5LGJB 5I15H 3LN4A 1JHTA 3MRPB 3ZE2F 1CXHA 4XC1L 3PWLB 4ODHH 1C16A 3L3JA 2CJUH 4OCYH 2G5BB 3ALXA 3B5HA 2NZ9D 4NCC2 3GHEL 3X12A 2DQGH 4QRPA 4D9QD 3E6FA 2L0DA 2EIZA 2N4IA 5I8OL 1F4YL 3PHOB 2EDOA 3UZEA 5CZVL 1A14H 1DQQA 3ZSTA 4NOFA 3DGCR 3IKKA 2AW2A 2E27H 3LN5A 4U0RC 4P2OB 4V2CB 3RUGE 2BCKB 1ZHKA 5DC0A 1WV7T 1K8DA 1U41A 2ORBL 4WFFD 1WIOA 4YJZL 5KZCD 1PYWA 4L8CA 1DBKL 5ID0B 2VZSA 3FN3A 3CIQA 1SQ2N 1FSKC 3L5HA 3GJEB 4NQDE 4Z0BH 3UTSB 5KSAA 1A6TA 1WITA 4F80A 3P11H 3KYNA 5JQ6L 3AXLB 3M45A 3NFSL 2HMIC 4LNRB 1U3HB 4MSWA 12E8L 4V1DD 4LLAA 4HJGB 1J7VR 4PJDF 5LGKA 2HLAB 3Q1SH 3U4EA 1A3LL 5GPRA 1DVFA 4M3JA 4D0BB 2R4SL 5I2IA 1NANH 1YPZA 4TPRL 2BMKA 5C3LD 5IOPB 3TA3A 1FORL 5B38G 2JCCA 5TDOB 3SGKA 3ZKMD 4NHUA 5B4MC 2A6KB 2NX5D 2IALA 1Q0YH 4Y5XA 5EU3B 3D3VB 3HZMA 2I25N 1JWUB 3VFTB 3FQTA 3U9UB 5FYLE 4MNGA 1JNLL 4WUKH 4N8CH 1KLUA 1P4BH 3MRRA 2VISB 4NQEE 3RKDD 4U1LB 5INCA 1NCAH 3S6CA 1LDSA 3BIKB 1EHXA 2R1WA 4KI5C 4GSDH 2F58L 4JPKL 4HIEB 4F7EB 2Y5EA 3GZKA 5HHPB 3MGOB 4GRWB 1CLOH 5I6XB 4G6FB 3ME0A 5BRZE 2PO6C 2ESVE 1BQHB 4GKNA 1PX4A 1I7UA 4ZG1A 4YZFE 4Y19A 4N0UA 5T5FH 4YHOL 5HDBF 5JTWA 1OLLA 2C4XA 3TIEA 1TJIL 2I5YH 2R0ZH 2FGWL 2FATH 4QHNB 3KDMA 4KHXH 3STZA 1MCOL 4OLUH 4YHZH 5DYOA 1T6WA 2AXFB 1XR9B 4OFYD 2WP3T 1DLHA 1D5IL 1QFUH 3WFDH 5C08A 3QISA 5CBAA 4KRPD 3BZFB 4XC3L 1A4KA 1UKSA 4APQA 1J87A 3GSWA 4DVBA 4KKLD 4PRDA 2VZ1A 3HUJF 1BQLH 3PUCA 5IVNA 4O5LH 3BPCA 1FVEA 1NBYA 1BP3B 4UB0L 1ODAA 4QHMA 3B9KD 1XGTB 3EDDA 4QF1A 2FIRT 3PGFL 2VDKL 4EVNA 4M6MH 3LEYL 3VH8B 1K5NA 4ZUWA 3N50A 4WUUA 4D8PB 1KNOB 2F9BT 2B39A 5C0JB 3HCVB 3BP4A 1CE6B 4NC1C 5B38A 2LAGB 2APVA 2X1QA 2YRPA 3QUKA 4EDWH 4U7SA 5CWSA 2FECI 4LCWE 1SEBB 4F9PA 5J6HA 1XF4B 4JVPA 5CEZL 3V6OE 4ZTPH 1X3DA 3MOBL 2CDFB 4N1EA 2D7TH 4LL9A 2A83A 2PXYD 3ILPA 2NY7L 15C8H 1ORQB 1U8IA 4U1MB 5I8KH 3KJ6H 3S4SB 2ITDB 3IDIA 3FOMB 4NYLB 2CDGA 2CKBA 3M07A 1QFWL 3S37X 1QYGL 2ZSVA 2XKUA 1EHAA 2V7HB 3VMPA 3CGTA 3N1GC 2QR0B 1JMXA 1C5CH 4LFHG 2BERA 2QKIB 4GRWF 4KMTH 5I1EL 4R0LA 1TJHL 4QXGL 5CP3A 5ALCH 2JJSC 2E6JA 1J8HD 5BJTA 4WRLA 1WBZA 2IQAA 1AXIB 2CD0A 4ZUUB 1MI5B 4OUUA 1FPTL 4OFPA 3VXRB 1DQDL 1UCTA 1JFQL 4W6WB 3U0PB 3MZTA 2AEQH 2YPKB 3JUZA 5HHOA 5IT2H 5MEOA 1FO0A 2VSDA 4FQ2L 3GMMB 4G9DA 1UWXK 4Z8FH 4GW4A 4MD0B 4P2QA 3GBLA 2A74B 4HD9A 1V3MA 1U8NB 3NIDE 4WWID 4OLXL 3MLSL 3VWJD 3KPQA 3QUMB 3T2QA 4GBXD 4L9DA 2EO1A 3GSQB 2CO7B 4JY4B 1XF2A 1LEIA 1S9XA 2IH1B 4LSRH 5ESVA 4M7LT 5LAXA 3AGVA 1W72H 2ZG3A 4HHAB 5FKAA 1OQXA 2EYRA 3QQ9C 2HT4C 1AGEA 4FFWC 2NXYC 2X4TA 5IFJA 1JF5A 3U7YL 3PWPD 1MCSA 1INQA 2P5WD 1CXIA 1MOEA 1BX2A 4PJ8B 1BPVA 3W9DA 2HH0H 1KFAH 4W4OC 3A67H 3P3YA 1ZVHA 2M8XA 4U2ZA 2GJ6E 4K7PY 1FNGA 4OZIB 1IM3A 1HI6B 4Z7QE 3W0WA 4A6YA 5ENWA 1G7PB 1NMCC 1ORSA 2PNDA 3KXFB 4YIQA 3VFUA 2DQUL 2DWDA 5JHLH 3G04A 2YD9A 4H26B 2EDXA 4Q6YA 4DEPC 2LTQC 3T77B 1PG7W 2HT3C 4PJFE 4YFLF 5IMOB 5D7LE 1XR8A 3W39B 1XGQA 4WU5B 3MBXH 3MJ8B 4DW2L 2FIKB 3BW9A 3F5WB 2VRAA 1SJEB 4PRPD 4RAUB 3WYRA 4W6YB 4YK4B 3QRGL 4JY5L 1OP3H 3UC0H 2BJMH 4NM8H 4G6KL 1MNUL 1N64H 4LVOB 4S1DC 1YEHL 3L3HA 5IB2B 1X4ZA 4O4YH 1AR1C 2OXGA 3T8XA 3KPRA 3MLWH 3VFSA 1O5DT 1CTOA 5FOBA 5J06A 2OJEA 1DQML 3RWCA 2PO6A 4PJ5A 3S5LG 4F7TA 3NH7H 1X5FA 2J1KA 4KMQA 4YFEA 5HHMB 3P0VL 2YHGA 1KEGH 1U8HA 1UQSB 4KKBC 4ZFOB 1B2WH 1F4AA 3VXMD 2PTUA 4QRTB 4MCYA 4JFEB 4K3JH 5DT1L 1FH5H 1OT2A 3VFWA 5JHDA 3R4DA 1P7QA 4ISVA 1QLEH 1WEJH 5CMAA 3TCLA 2QHRH 1D9KD 2B1AL 5J6GB 1G6RL 2RGSA 2XQBH 3O9WD 1NDMB 5SWZD 4PJXE 1FN4B 4JVWA 2F54B 3DPBA 2IANE 2F74A 3QPQD 5H94B 2O93L 1M7IA 1UXSA 4J6RL 1NCDH 1U8OB 4RISH 1ADQA 4S1SL 4J3WA 4PJIE 1H3GA 2VSCA 5L7XL 2APTA 4HFUH 4JHAL 1N6VA 3VDAA 2VITA 4ZDHB 3VFGL 3PQYB 3HR5B 5CKAA 5E24E 2D7OA 4M62H 4ALAL 5BW7C 4YLQT 1YYMH 1UYWL 4H20L 5E94B 4JHBA 3CDCA 5IJVA 5GS0C 2EKSB 2E7CA 5ADPH 5CD3A 2ZJSL 5J12C 1KT2B 4MA7L 1MIML 1J1PH 4HKZB 1BD2E 5DGQA 1WC7B 4PJHE 2YD5A 1CL7L 3HMXL 2C7UB 3HTLX 1U8KA 3RWIA 4UILL 4AIZA 3S5LA 1KF9B 2BVYA 1NCWL 2JJSA 2VERN 5ILTL 2HTLC 4HUXB 4N9GA 5F9DC 3UTPD 2W60B 1FGVH 4FNLH 2B0SL 1EIBA 4LLUA 1QO3B 2OK0L 1SYSB 1A1MB 1WWWX 3HG1B 1YEIL 1YNLH 3X3GL 2EH7H 5GS2D 5TE7H 4DUVA 3NCEB 1P4LA 2CMRH 4EI6A 4Y4HD 2EDRA 3HR6A 3QFJD 1QD0A 3ARYA 5EUOB 5HYSA 3EYOA 1F8TL 3RWJB 4NDMB 3N1FC 4LRIC 4P23B 4X6BB 3VG0L 3FCTA 3RVXD 5I30L 2EDFA 1Y18A 5DFVC 2FBOJ 1MJ8H 3D69A 3TBVB 1HHJB 5FUCC 5H37G 3TJEL 3G5VA 4BZ2H 4Y4KD 4M1GL 1RZKL 1V3KA 1FQ9C 3ZT7A 5KSBA 1YEFH 2VLKB 3UBXI 1UEMA 1LO0L 4NSKA 2ED7A 4KPHL 3R0MA 5JXAL 4FQIL 4Q0XH 1Q9OB 1QACA 4NZUH 3U0WL 4OD2A 1ZE3C 2FH6A 4M7JL 4W4OA 1AD0B 5EZOH 5D2NB 2I9TA 4XB8A 5E1HB 2Q8AH 2I27N 5A2IH 3RHWF 1BJ1H 2RFXB 4U49A 4RWHA 1I7ZB 3MV7B 3QUXD 1T1ZA 5F7FA 5GJSL 3O0RL 3ZL4L 3KPMB 1NC4D 3FTGB 5C0CB 4F57L 1DR9A 2UVFA 3TC9A 2Z93B 1JHKH 4FQJH 2WANA 3GI9L 3TJHC 4JG0L 3P4LA 5SWQB 4NO2B 5JLZB 4KXZI 2B4CL 3WXVL 3LZFH 3ULVC 4GS7B 1CG9B 2IMMA 3BPNB 4NRYA 3OAZK 2R9HC 1HKLL 3T3MF 3RDTD 3MYJB 1GAFH 3ZDZE 4XH2A 4QHUA 4HBCH 5IB3A 3PV6A 2HTKC 3VJ6B 2X5PA 3BKCL 1R3KB 2ZPKL 4JLRA 4FQPA 2NY4B 4IHOA 1MAKA 3PIQA 3K2MC 2IAMD 4J8RA 4MJIE 5DJYA 5L2KB 3V5DA 3LQAH 4GQPH 4CRPA 1QQDA 1C5BL 2MPAL 4H8WC 3SDDB 5DRZB 3SGEH 1EZVY 4LNVA 2WBJC 2NW2A 2V9QA 3B6SA 4F7CB 1KULA 3ARWA 1TPXB 3UTTB 5LKNA 2DDQL 2A1WL 43CAB 4AM0B 4GMSH 1OARL 2EDNA 4AQ1B 5HHVH 3SDXA 3IVKA 2X6MA 1CGUA 3D48R 1AKJA 5E5MB 5FYJD 3P0GB 3IFOB 2F53A 3GM8A 4OUOA 3VFVB 1HQ4A 5E6ID 3OR6B 1MCNA 1PEZA 1L9MA 3BIBX 5CJBA 5HI5D 1X5AA 2C1PB 4XPGH 5MERA 2E6PA 1P1ZA 3QHFL 5JQHC 2ICWJ 4M48L 5KSUA 3QO1A 4G7YL 4L9LC 4Z6AT 1HILA 4PV8B 3UXFA 1RUQH 3V4UH 3MRIB 3W11C 2H3NB 3P0YL 3DLQR 2MOVA 2ERJB 2XFXB 5MEND 5MEPA 5FA4B 1PZ5B 3NIFE 2YMXH 4P57A 5E9DD 5KVEH 3EO0B 3MOQA 4G8GD 4U31A 4XAKD 3HE7D 2E9JA 4UUJB 5C70A 1BIIA 1P5VA 3MJGX 4N8VG 4S11A 2CQVA 4ODSL 1QRNE 2H32A 3LQZB 5C09A 5CFHA 2AQ1A 5BW7A 3V6OC 3K8LA 3MBED 5GGQH 4OF0A 5C2BL 2SEBB 1EVUA 3MRQB 5FYKU 1ZA6B 3U46B 1A7BA 3SKJH 2D4FA 2ZUSA 4NRZB 4LMQE 3ZKXB 5I1GH 3T0BA 5ADOL 1NUNB 2QQNH 3D39A 1F2XK 3O3DA 1QNZL 2VIRB 1ITBB 2X1PA 2PYFB 5ISZB 2NY1B 3T3PE 1W0VA 2DKSA 1BGXH 2MQCA 2DQTH 1TDQA 3M17B 2QEJA 2XKNA 3MUZ1 2HJFA 4L8DB 1G7JA 1BHGA 3JV6B 3VFRA 5FUZH 3BWAB 1K8IA 3STLB 5E70A 3G6JA 4NNXB 3ULUD 2ZUUA 3QIBC 1U8PB 1J0ZA 4IRSB 4AENB 1MLBA 2OBGA 1GGBL 3KYMA 2F8XC 1MCFA 4YDKH 5C0IA 1LP9B 3HNTL 2J8UB 2VTFA 2YN3A 1K6QL 1MRFH 2NTSP 2WLZA 4OI7A 2ZZUT 3ARDB 4G7VL 4LRIA 5EU6E 3CC5B 5C71A 3O3UN 4GRWH 1N0LA 3VRJB 7CGTA 2GTWB 5C0DA 3QXAA 3WE6B 4HMEA 3MLRH 4XZUB 5IFAH 3I6KA 1OM3H 2C4FT 4HKXB 4ACPA 4I5BB 1YMHB 1G6VK 3ZT6A 2JLLA 4X6CE 5I1HH 1UJTA 4UIMA 2GCYB 3QDMB 1EEYB 4JDVB 4JEGB 4MJ2A 3INUH 1WFNA 1OAUL 2X4NA 1B4RA 4HX1B 3S3SA 2B8OT 4JN2B 1BEYL 3FQXB 1INDL 2VO5A 1WWCA 5TDPA 1JGUL 2ATPA 2ICWA 4N8VA 1ND0B 3DO7A 1CFNB 4XNUL 5CZXC 4RWYL 4NQDA 4RBPK 1YN6A 5F89A 4YXLH 5D1QD 2OZ4H 4BH7A 4XPBL 2PYEE 5IEHB 2GJJA 4D9LH 3LS5H 1IAOB 4G6AD 4POZD 2R2EB 3RVVD 3N06B 4LPCA 5CJOL 6CGTA 1LMKA 3MRDA 2MQ0A 2BNRD 1OD7A 3CLEL 2HA1A 3T0WA 4M00A 3HMWL 2APXA 4RDQF 3D85D 1CU4L 5GSRA 4OI8A 4KUZH 4LHUG 2G75A 1VA9A 1HNFA 1S5HA 1JPTH 5C0NC 4ODVL 3QP3A 4L3ED 2AEIT 4OD3H 3MUGB 4NQEA 4K2UH 4DTGL 2EICA 1X5LA 4Z7WE 3HPLA 4KKAC 5D6DC 1H3PH 5C0FB 4O51B 1K9TA 3QR2A 2QSTA 3NCCB 3PDOA 4M93B 3KPOA 1LP9F 4IJ3C 2J8UF 1YYLH 2A77L 2X9XA 2WBKA 3D25B 4ENEC 5BRZA 5IK3A 4WNQB 2ESVA 1EAPA 1RI8A 3T09A 3LOWA 4WI3A 2QHLA 4HUWA 1ZVYA 1FV1B 1MCCA 2WBJA 4IS6A 1Q9KA 2I26N 3GMOA 5C0BB 1FL6A 2EH8L 4FQXC 4N90E 1WK0A 5DVNA 3UPRA 2RAMA 3D18A 4ODUA 2D0FA 3GB7B 4NQUA 5BZWB 1ZXQA 1L7TH 4H5SA 5A2FA 2UUDK 1DN2A 2AEPH 3C2AH 1EK3A 4JRXB 2NXZB 1ZVSA 5CEXA 1CS6A 5B39B 5ANMA 1NAMH 2XNAA 4JFYA 3EYQC 1ZHLA 5DD6A 3HE6B 1NCCH 3TBWA 2VLJB 2QADD 3QIUC 3SDCB 4QRPD 4DUWA 4YGVA 2CLVB 4KH2A 5IW6B 2CO6B 3MCKB 5C0RL 4L9LA 4GRMB 5F71A 1G9MC 5MEQB 2KPNA 1TZHB 2NW3B 5EORH 3AREB 3IDMA 4G6JH 5EBLB 5SX4I 4WI9A 5H2BB 5SV3A 3RJDA 4NT6A 3SPVA 3GO1L 4JB9H 4LSQL 1QKZH 3BMVA 4XTRC 3RAJH 4LHUA 3PWUA 4JFXB 4OLVH 4LCWA 3B9VA 3I75B 5KSAD 5L9DL 1DDHA 2UWEE 4NO0A 1EERB 1OB1A 3MTRA 3D0VA 5E2UL 1ZOXA 3DUHA 1HXMB 2H8PA 5BMFH 4GAJL 1DQJB 1JWMB 3UCRA 3N0PB 4MCZA 1OTTD 1DVFD 1ZT7A 4TSBH 4JPIB 4KKNA 2CPCA 1BVLB 5DTFA 1KCUH 5FHBL 1G0YR 1KB9J 1LE9B 2OQJA 4N9OB 3MQIA 5I16B 3EJJX 3J7HA 4U1JA 3QIBA 4MB5A 4JJ5B 4Y2OA 4F8TA 1IAII 3BH9B 3SJVB 1R3JB 4XBGA 1MFDH 3ULUF 1IGTA 2NY3C 1JUFA 3EOAB 1GVIA 4OCWL 1EHNA 4FABH 3GRWA 1HHKB 2HVKB 1YUHA 4HAFA 2Z8WC 5F6HI 2ADFL 3QPXH 4UINL 3VDCA 1RMFL 5C0AE 2NY0C 3WNNA 2OSLA 4YBLC 4M7KH 4Y19D 1G7IA 3VRLE 3BOVA 1CGTA 3NPZB 1JNNH 1KJ3L 3Q6FA 3WLBB 3BN9C 3U9PH 1TENA 1OGAB 1G6RB 5FECB 3IFLH 3ZE2E 4HG4J 4TUOB 1TJGL 2EEBA 4WDIA 1IQDB 4NRXB 2YC1A 3OJ2C 4XBPA 2GFBA 2NYYC 3DI3B 3ARBC 2DOCA 1DQLH 2ZUXA 5IB1B 2EDEA 2XA8H 1ZA3B 1LNUA 3OJMB 5GGTA 4F58L 4ORGA 3LSOB 3DSFH 4O02H 3WIHH 4HPOH 5E8PB 5C08D 1P7KA 4QGTA 2QSVA 2GJ6A 2NTFB 1BAFH 5DO2D 4APQD 4ETYA 4KZDL 5D71L 5BVJB 4HBQA 5D1XC 1MFBH 1FG2A 1YNKH 3LCYA 3DECA 1IC4H 1UZ8A 4MNQE 1CDJA 2BVPA 4JM2B 5IG7A 4ELKA 1F4XL 3QJHA 1U8JB 1CXKA 1U95A 1IEAA 1OAXH 4PJFA 5D7LA 1IL1A 4OM1L 4JO2H 1KJ2L 4PJDE 1FNAA 4ODXA 4N0FA 2ADJA 5DSCA 2WUCL 3OXRB 1VCAA 4KK6D 1CGSL 1F2QA 5I1DB 2DS4A 5ERWB 4D9RD 2VL5B 1S78C 4YUEH 5L0QC 5D6DA 1OLZA 1E27A 4U6TA 4K8RD 5HGBA 4FZ8L 4S2SB 2Y07H 4JFOB 5D93C 3HZKA 3VXOA 1CICC 2H41A 2DQDH 5F96L 4LU5L 2Y23A 4HMDA 3OAUH 4K7PL 4NWTL 5T1KB 2XTJB 2OTWA 1BM3H 2KKQA 1JNHB 1RUKL 2CR6A 5GGRB 1LEGB 2O5YH 3MUJA 1W0WA 4FQXA 4DKEH 2J8OA 3MYZA 5HJ3B 5E7BA 1UVQA 2GY5A 3G6AB 4MQ7B 2FNBA 2D31B 3H8NA 3VU2A 4P9MH 4X6DF 5HDBE 5GRYA 1T7YA 4P2QD 5JA8B 4NQSA 2OR9H 5GIRB 1EJOH 3B8YA 3DVGB 3K2UL 4F37K 4XCYB 5AD0A 3TNNB 1EO5A 4YC2B 2FB4H 3BO8A 3LY6A 3O2WH 4AL8L 3VXNB 1WAAE 1XF3A 4PJXA 1T1WA 2NNAA 3E6HA 4J3OC 5DD5L 3SHSA 4JRWA 5EOTA 3QEQB 3QIUA 3ARFC 4MS8D 4XP6H 3QQ4A 3FAXA 4WVRA 5KTEL 4I18B 1KC5H 4N68A 4TRPL 3TPKA 1MJ7L 3I2CL 2WWKT 3O41B 4OSUH 4PJIA 5TGBB 1CCZA 4JM2F 2GK2A 4KDTC 3P4OB 4HS3A 1QLFB 1GIGL 3C08H 4PJAF 2QLVB 3UTSE 5I74C 3RBGA 4JKLA 4R4BB 4W70A 3BYTA 2W65B 2KQMA 5FCUL 1EHLL 3BSZH 1FFRA 3JUYA 4OTXL 4Q9QL 2JJVA 1OTSC 1DUYB 1T20B 3W0WD 2AABH 5GHWL 1DFBH 2VJXA 9CGTA 1U58B 4NQVA 4D94A 2Y36L 3AY4C 2HYMA 1XT5A 3PP3K 4ZMAT 2HMID 3PG2A 4CMHC 3BRFA 3E8UL 1NSNL 5F7KC 2DM2A 3HZYA 5D2LB 5CBEA 4DFHA 1I8IA 3D3VE 4CN6A 4FHBD 3L3OA 2YA1A 1WGOA 4UU9B 4PJHA 4LFHD 1WF5A 1BLNB 1A4JB 3RIAK 2FH8A 1I9RH 1NGXA 4HIXH 1ZMYA 1MFCH 1YEEL 1C5DA 3UTOA 3T4YA 2JIXB 1IEBB 4GRWE 1WCQA 1NUGA 3C9NB 4B41A 3DURB 3RWGA 5IBTL 1JVKA 1KBGH 1UH2A 4JANB 2G60H 1S7VA 4KI5D 4GAYA 3FZUC 3C8KA 5C6TL 1RUAH 3WDIA 3FO9A 4NFDA 1AE6H 5DS8B 3F12B 1FGNH 4LSSH 1T1XA 3S9DB 1NMBH 1I4FB 2PO6D 4NJAH 2H45A 4PJ5D 4LKXA 1A5FL 5I66B 4MMZC 3IGAB 3IJYB 4MAUL 4Y16C 4UDUA 3SE8H 5EFIB 1TLKA 1B4JH 2HKHH 4ZUTB 5EIVA 5K93A 3SOBL 1YEDB 3EYFB 4PY8I 4HZLB 1G7LA 5IEKA 3TNMB 4LIQH 1K4DA 1P7QD 5FO7B 3CFCL 5IJKC 6FABH 3ARBA 4HKJB 4QLRA 2ILLA 3HC4L 4YE4H 3ZE0E 4M7LH 5E99L 5JW4N 2I60L 4OGAD 1HH9A 5H35B 1I1AB 3DMMB 2YEZA 3IJSB 3DV4B 2HKFL 1R5WA 4QCIA 3D87B 3QFDB 5K9JH 4HGMA 4LSUH 2W1NA 5EZLA 1IC1A 1KN4L 2ZSWA 4YGAB 2D7QA 2Z92B 4IMLB 3LPGA 3ECBA 1CDHA 2YZ1A 5D1XA 1RVFH 1JGDB 1G9EA 5AAMA 4M1DL 2VQ1B 5E2VH 4NZTH 3SO5A 3SKOA 1FLRL 4CADB 1ETZA 4F33B 5TQ0L 1DUZB 4OF8A 4PB9L 2A73A 3OAYK 4WFFE 3OGCB 1WZ1L 5TFSL 2R0LL 4BFEA 1ZLSH 1MJUL 3JTSB 3QDHA 5D70H 4YHMH 5JDSB 4YHIA 3DRTA 3VE0B 3TBSA 2W0FB 5DJ2B 4E41B 5IVOA 3DIFB 3VGFA 1A64A 1KLFA 4BFIB 4MX7B 4M5YL 4JFPB 5AYUH 3MLUL 1D6EB 2NY6D 3HC0B 4R26H 5JDJA 1XMWA 4NFBA 3H3KA 1EDQA 4NN7B 4WI2A 1QBLL 2I07B 3CDGA 3HA0A 1GGCH 1CICA 1MI5E 4PLNC 4HC1H 2CGRL 4P5TC 1RFDH 3VXRE 1MHCA 4XP4H 3MRFB 1Z3GL 4V1DB 5EIIA 3QQ3A 3T0DA 2DBLL 3GNMH 3U36A 4CVZB 4Z78A 4L4VB 2OCFD 3ES6B 1NBVH 2GK0B 3T2NH 3MXVL 4LDOB 5J11B 3SKMA 3W9EB 4GMTL 4LOUC 3IB4A 4BZ1H 5GRJL 2Z4QB 5HGHA 5EB9A 4XVTL 3FT4A 3MRJB 3SQBA 4OF3A 3UJJH 3PWVB 4NBYB 2J4WL 3P4MB 1NJ9A 4PRBA 1PEWA 3MX0A 5BV7L 2PR4H 2BHUA 3BD3A 1WTGT 2N1KA 1RUPH 5I18H 2ZNWA 4OZGB 1E4WL 4PRHD 5F3BA 1D5MA 5D1ZC 1SVCP 3DX9B 3ARFA 4I3SL 4FTVB 1ACYL 3U30B 5IB5A 2EE3A 2FJGA 2EO9A 1SY6H 2VXUL 4OKVB 3RU8L 2HT4D 3BP7A 4I0PC 4FFWD 1CGWA 2NXYD 3BXNA 3PXHA 3P9MB 1FC1A 4KDTA 4LF3A 4O9HL 2Z31D 3L7EB 5SX5H 4OZIE 1Y0LA 4M43H 2BSTA 2OL3B 2AV1A 3K74B 1L6ZA 2FX9H 4QHLB 3VI4E 4PJ9B 3BKYH 1U91B 4DUXA 3G5YB 3OKEB 3KXFE 3A6OA 3X13A 4LSVL 5ESQB 3VWKC 1FAKT 3CUPB 1OTUC 1QRNA 3PWJB 5F9AC 1FL5B 5FYJH 5T1MA 1NGWB 4QRQB 3AY4A 5IM7B 4KRPB 1MCKA 3CPLB 5HYQA 1B0WA 4RIRA 1DLFL 3FMGH 2QQKH 4QY8B 5F9WC 3EHBC 2QQQA 4U05A 5HGGS 2XZQL 4X6FA 1F02I 2BNQE 2HT3D 4KTDL 5C86A 2FHCA 4J12A 2J88L 4HWNA 1GRWA 4PJEB 1AC0A 2X4SA 1RZGA 3FB8A 1V05A 3AS3A 1C12B 1KXTB 1FRGL 1VACA 1KPRB 1P6AB 4N1CA 3M1BA 2EDHA 1FVDB 2OLDA 3MNZA 4PGCB 2P49B 3VXPB 3LRSA 4XVJH 3DUSA 3MV9B 1J0JA 4S1DD 5HHME 1W72A 1AR1D 5DEFB 1A6VL 3DWTA 1J8HE 4JFEE 5T3ZD 3WLWC 3FO1B 5FM4A 2Q86B 2LAAA 3QCVH 5ESAA 4RGMC 2YBRA 3EJZC 4LCCB 5DD0L 4GQ9L 4Y16A 3BE1L 4OZGF 1M05B 4KKBD 2JF1A 4KDVA 5FDWA 4QTIL 3RRQA 1AXSB 5IW1A 1NUFA 4TNVK 4U1SA 5EN2A 2IF7A 3DOSA 4YXKL 5C9KA 1MH5A 1YJDL 3M8OH 4DN4H 4X6CA 5IJKA 3QUZB 2F54E 4BQBA 3QZWG 2BY1A 4AJ0A 3ULUH 5E2WH 4RFOH 1NFDB 1NGPH 2F53D 5TDNA 4JAMA 4JY6A 4UQ3A 3AS1A 3ZHLA 5DK3A 4R3SB 1T3FB 2IMNA 3NCBB 2E6QA 3SDYL 3ZKNC 2AJUL 3QWRA 3LV3A 3QSKB 4NM4L 3CFIC 4PIRF 3U0TA 2EECA 1F4WL 2WIIA 4ZS7H 1AQDB 2RCSH 1KN2H 2OTUA 5JA9A 2PYEA 3I02A 1CVRA 1VB9A 2DICA 3U7YH 5FHAL 5C6PB 3QRFM 1QA9A 4KU1A 2XT1B 1QHOA 1PSKH 2ARJB 1RZ8A 3G9AB 2VLLB 3U2SA 3WKNA 4L29A 2ZOLA 3S3JA 1KCRH 3NABH 3WS3B 2X4RA 4X7TB 3MC0A 4WTZA 4FMFA 3WFBH 4JR9H 3WN5B 4YAQA 2CDEB 4PJEF 1VFUA 5CP7A 1B0GA 1MCDA 3LS4H 3VGDA 2P5WB 5C09D 2NY5L 4LKCB 4EUPH 3LQAC 3H42H 1KGCD 4TSAH 2IGFH 4Y2DC 5EOQH 5GS0D 5T1LB 4WEBH 2MSPA 3Q5OA 5EU7E 3O4LE 4Z7WA 1IM9A 4F15B 3T3ME 4RFNB 5I75B 5JW5A 1J12A 3D39D 5MI0C 2Z0BA 4I8DA 3THML 5K9KB 1CR9L 1QFHA 1M71A