1NCBL

Crystal structures of two mutant neuraminidase-antibody complexes with amino acid substitutions in the interface
Total Genus 50
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
50
sequence length
214
structure length
214
Chain Sequence
DIVMTQSPKFMSTSVGDRVTITCKASQDVSTAVVWYQQKPGQSPKLLIYWASTRHIGVPDRFAGSGSGTDYTLTISSVQAEDLALYYCQQHYSPPWTFGGGTKLEIKRADAAPTVSIFPPSSEQLTSGGASVVCFLNNFYPKDINVKWKIDGSERQNGVLNSWTDQDSKDSTYSMSSTLTLTKDEYERHNSYTCEATHKTSTSPIVKSFNRNEC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase(o-glycosyl)
molecule keywords INFLUENZA A SUBTYPE N9 NEURAMINIDASE
publication title Crystal structures of two mutant neuraminidase-antibody complexes with amino acid substitutions in the interface.
pubmed doi rcsb
total genus 50
structure length 214
sequence length 214
ec nomenclature
pdb deposition date 1992-01-21
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1ncbL02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1ncbL01
3LB6C 1FHGA 3RNQA 2YC1B 4KTDH 4K3DL 2NXYC 1WT5A 5CBEA 1OW0A 4HEME 3T2QA 1M4KA 5J12C 1RD6A 4JM2B 1L0XA 2RR3A 4HWBL 5T3ZD 1ZHBB 1AQKH 4GBXC 4LLYB 1T5XB 1LO5B 3Q1SL 3ZE2F 4K7PH 3VI3F 1KJ3H 5KZCB 1GPOL 4RDQF 3ARYA 3KYKL 3VXOB 3EJZD 2C3VA 1HHHA 5D9SB 3AXLB 4EVNB 1PG7L 3PWPB 5EU4A 3H0TA 3T0ED 4J1UB 2HMIC 4QKXB 4XVSL 4KZEL 3F7VA 3CFCH 4FQHB 4P4KA 3L5XL 1T5WA 2IFGA 4PRBB 1J7VR 4G6FD 3AY4A 4ONGL 3PGDB 2I60H 5F1NB 3FOLA 4PGDB 4Z8FL 4NC1C 5J8OA 1TNMA 5F9OL 1C16A 4Y8AA 5I17A 4OD3H 4KU1A 1R3JB 3RVXD 1JTPA 1TCRB 1DTUA 3LQAC 5FYLH 1QA9B 1P9MC 1DN0A 2IBZY 2I27N 1FNFA 3BVNA 1I8KA 2OTUB 4BQBA 3BSZH 3K2UL 4JRXB 3RWJB 4L9LB 3VGBA 4OUUA 3H9SB 3QDHA 1FYTE 2R0ZL 5HDBF 3MRHA 3V4PL 3RY6A 4ODUA 1E0OB 3QQ9D 4XAWL 3MMEA 1G7LB 5TF1H 3PWUA 1K85A 5C07E 1YEIL 4HIEA 1N5AB 1RIUH 2CLZB 4ZNEA 1KC5H 3S97C 3C09B 2BFVL 3VFVA 1VDGA 3DOSA 4XTRD 2Q8AH 4X9BA 4MJIA 1OP3H 3PNWB 5I1CH 4JZNB 2EH7L 2JJTA 3RZCA 2ITDA 1P4LA 3HPLB 1GHFH 1FO0B 2WLZA 5I74B 5LXGL 4LHUA 4Y5XC 2FBJH 2NYYD 3B8YA 1NFDB 3VE0A 2JJSC 5DEZA 1CU4H 2HFGL 5F97E 2XY1A 5IV2A 2XY2A 2MOVA 3L7FB 3O2DA 1IAOA 4WJ5B 3SGJA 5L7XH 1A6AA 4R90H 3FQUA 4HZLA 2A77L 1CR9L 1MQKL 2NZ9D 5GHWL 4YR6B 3GIVB 5IMLB 4NZTH 4DQOL 5I9QC 1XGTA 3U0WL 4P46A 3WFEH 4MNQE 4M5YL 1QQDA 3NA9H 5D2LE 5J6HA 5EU3A 3IKCA 4DAGH 3B9EA 4P2QD 4YC2C 4XMKH 4O9HH 1IAKA 3W81A 3HE7B 4U3CA 4M4PA 3KPSA 4IMKA 3FB8B 1FCCA 5IBUB 1N8ZB 4IDLA 5EN2A 5C2BL 2FX9L 3SDCA 4OLYL 1VGKA 5J57B 5JUEH 4JFPA 3C08L 2K1MA 5HBBA 1EUTA 4LCCC 1K8IB 4JQIH 3KVQA 4L8CA 3LIZL 1T22A 1QACA 3KYMA 1RIHH 2A73B 3C5SB 1HXMA 3X14A 4XBEL 2V7NB 3QNXB 5E8PB 5HPMB 3FN3A 2OP4L 3OKYA 4FQXD 2P47B 4Q6IB 1NSNL 2AK4B 1UWGL 3BESR 5L0QB 2YMXL 3P11L 2WUCH 4ZUWA 1T04A 4OV5A 3DARA 4DW2L 1KB5A 3CFDB 4Y19A 4MQXC 5HHPA 4PJHA 2G2RB 5HI4C 4LVOC 1PKQE 3BKYL 4ZUTB 4P23B 2LQRA 3DJ9A 4ORGA 1KJ2B 1KCVL 3VWJB 3MV8A 1XCTB 4JY5L 4QRQA 5CEYA 1VSCA 3RA7L 4LLDA 2D7NA 1KSRA 2A9NH 2XKUA 4NFBA 3O3EB 3QFDB 5ISZD 5JPMB 1IILE 1WGOA 4N8CH 2BOBB 2HP4A 3WUWA 1IGYB 4GBXA 4WY7L 4PLNC 1A9BB 1B0RB 2ZOKA 4UQ3B 1SY6A 3V0VA 1GVIA 1OGAD 2A6KA 4XP6L 1FORH 3NCFB 3VCLA 2ZNWA 4KVNL 4X8JB 3FO2A 2DDQL 4GKSB 4I3RL 5B38B 3B8SA 1J87A 2UVFA 5IESH 1KPUB 1OVZA 1SJHA 3CSYB 2XI9A 1GAFH 4JR9H 2P5WD 1KFAH 1OSZB 5CD3A 2W0KA 4PG9A 1RU9L 3H42H 2ADJB 3L5WB 3DRTB 4R8WH 1Z6JT 4DKDC 1DSFH 5D7SH 4PGZA 1ITCA 2V6HA 3DI3B 4JPVH 3MRIB 2CLVB 2IGFL 3BZEA 3CMGA 3H7BA 4HK0A 2EKSA 1QOKA 5C7XL 1OPGH 4PV8A 3DUSB 3VRIB 4JM2F 4G6JH 1RZIB 1MFCL 2X9WA 1YA5A 3MGTB 5KSVA 3ULUL 4HGKC 1JGDA 4PRHE 4RMUA 1JI1A 4UU9A 4XPHH 1I1YB 1HEZA 2AEPL 3L3JA 4X6FA 2HVJB 4U1MB 4DKFH 1NKRA 4XXCC 1KCSH 5F44A 4BZYA 1OF2A 2WBJD 3OV6A 3U36A 4KJQC 1E6JL 2AJZB 3RGVA 2BRRL 5FB8A 1ZLUH 2Y5TA 1LP9E 3BT2L 2YD2A 2WQ8A 4NM4H 4ZUVB 4NQXB 2CK2A 4KK5D 2AVGA 2UUDK 5GS0H 1MVUB 3MRPA 1FZOB 1AGEB 1AI1L 4PRID 4PJDB 1ZHLA 2Q86A 2F53E 3BDYL 2AEQL 1KGCE 2JJSA 5EBMA 2Q7YB 3ZKMC 5J13B 1VFBA 5DD5L 1JNHA 3V8OA 1NBVH 4L5FH 5FUZL 1S9XB 2V7HB 4JO4H 3S3PA 1X3DA 3TIEB 4WUUA 3SKNB 4IEFB 3GMNB 3IU3A 4JRYE 4TPRH 1N6QH 2W9DH 3DTXB 3JV6A 3EOTL 5B39G 4O4YH 1ZV5A 5EO9A 3MRKB 5GRYA 1BVKB 4Y1AB 1RJLB 5JNYA 2EXWD 2G5BA 3S7GA 1F3JB 3OAZH 5K9KA 2X10A 1B2WL 3DXAB 3MROA 4MCYB 4AIZB 3ZL4H 3MO1B 1UQSB 5E94A 5L9DH 3G5VA 1Q9WB 3ARWA 4P5TA 3QIBB 2AXGB 5DSCB 4EN3D 3F58H 1INDH 1IKNA 1D5IH 2VDNL 4QRSA 2Y72A 3MLYL 3O6FB 5EOQH 1AGDB 1JYXA 3BEVB 1HQRA 5D5MB 3QEQA 4CVUA 1NFDF 1NUGA 4X7SL 4Z7QE 4C56A 4J23A 2F54D 2VZ1A 4WW2C 2PF6A 4P3DA 2J4WL 3IFLH 3HG1E 3SJVE 3NTCL 3LQZB 4POUB 2HT4D 1T1YA 3L3KA 3NCJL 4XMPH 1TQBC 4YBQD 3IDYC 1YECL 1B4JH 1MNUH 4OLXH 1N6VA 2CRMA 5CBAB 2O93L 3TN0A 1CDGA 3RTQB 1DVFC 4YNYA 2GJ6A 4R2GB 5GGSB 4K7PX 1CDHA 1CXKA 3MBEA 2WBKA 3O6LL 2NY3D 1B90A 3H9HA 4BFIB 4MB4A 4NKIL 2A83B 1VFUA 4JHAH 5F93C 32C2A 1A6ZB 5KS9B 5IVNA 2V5YA 2XV6B 1RUMH 5EU6E 3OAUL 3FMGL 3V6FB 3BW9A 1VADB 4LIQE 3ULVC 1D3CA 3WL9B 1JZ8A 1U8IB 1OP3K 4NQSA 2H45A 3WNLA 1QNZL 2P5ED 4OV6F 3CFEA 3LHPH 1QRNE 3FQRA 2BNQB 5DWUL 2E9WA 5DJXB 3AS0A 4PB0H 5ENWA 1I9RH 2WANA 2BP3A 1KXTB 3LKNB 4CVZA 4E42B 2PXYB 1O7VA 1I1FB 5J56B 1YDPA 3WDJA 4JY6A 2YZ8A 1GGIL 1NANH 2XN9D 3ARBC 1S9YA 3LMJL 4LCYA 4DKAA 5BS0E 3T1FA 1T2QH 2AV7A 3ULSB 1DUZA 1XR9A 3P0GB 3SCMD 4U6VH 1GGCH 3KJ4C 1WJ3A 4Y5YB 2R23B 5TE4L 3W11C 3JTTB 3ZDZF 3L5HA 4AEIL 5LJYH 1K5NA 5C3LD 5CLWA 3O4OB 2CK0L 2WNGA 2BVQB 3LKOB 5L2KE 5J1TC 1CDCA 1QZ1A 1NC2A 4LPCA 5IUSA 3TESA 1J1PH 4X7TA 3HZKB 3OTTA 3CFKA 5HHOD 4FTVB 4ERSH 1KIRB 4I0PC 4WI2A 4FZ8L 2O5YL 1YUHA 1ZHKB 1RURL 2FO4A 3KLAB 5F88A 5EO1A 5C08A 4YDVA 1ACYH 4IMLA 5SWSB 4ZS6D 1I7RB 3IDMA 3NFNB 5D2NC 5GS0C 3HC0A 4JY4A 1A22B 4X9GA 5IB5B 1JZ7A 3MNZB 2GKIA 4CW1A 2BY1A 4HFUL 3UMTA 3PHQB 1DE4A 4NKMB 1U3ZA 4HG4K 3V5DA 2N56A 4PGCA 4YX2H 1JGLH 1A7RH 3BZ4A 4OZ4A 1ZA3A 4PP2B 5E7FA 1YC7A 1EHXA 5EWIL 1U8LB 3CX5K 3B83A 1NCWH 1YY9C 3W82A 3JV4B 3D9AH 1DN2A 4Y4HB 5FXCH 1G9NH 1S7SB 3QFJD 2VSCA 1ZT4A 1QLFA 1MCSA 3HCVB 4U31A 1NLDH 3GUTA 4N9OB 3ARQA 1A64A 3HZVB 3OKMA 1JN6A 5BZDB 1EXUA 2DLHA 4WO4B 5FYKH 3PV7A 4IRJA 5E95B 2WSKA 5GZND 3RUGB 1H3XA 5EZIH 3CIQA 1CICD 3LS5H 4H26B 2FL5B 1J88A 1J8HA 8FABA 1WEJL 1MCOL 5T3XD 3I2CH 1QR1A 2YS4A 3D0VA 4MQSB 4ZS7H 3GHBH 4D9QE 3JTSA 4GMTH 3GBML 3UP1A 3RY5A 4X4XA 2OXGA 5DFVD 5C0EB 1U8PB 5I1HL 2HRLA 4OB5H 5ADOL 1FIGH 2PO6D 3RU8L 5EORH 2EDXA 5CSGA 4XWGL 3MV7A 3O4LD 3QUXD 2YSSB 3RIFF 3TIDB 2AJSH 4HT1L 3HNVH 1CLYL 1MJ7L 2ZPKH 2JELL 3KHOA 3N85L 4UTBL 4WGVB 4QRUA 3TV3L 5HVHB 3F7YB 3S35L 2FYYA 4LSPL 5GPRA 4PJDF 2NY2C 3RVUC 2P1YA 3BIBX 1ZVHA 4HUWB 4MXWL 2O26U 2J5LB 4NNYB 3ZTJH 4Q9RL 1BHGA 4Z0BH 4HW6A 1JTOA 3L3OB 3RVVD 1XIWB 3FRPA 4R7DB 2AJ3A 4NN6B 1YEGL 1VFMA 3QQ3B 2ICWB 4BKLA 3RL1B 1TZGH 4KKCC 1A7QL 4OZHE 2Q6WA 4Z5RB 1MCNA 4XPFH 2X70A 4XAKD 1SHMA 3K3QA 2OJZL 4YFLF 2IALB 1OM3H 3PL6D 1JK8A 1AR1C 4N8VA 2R1YB 2ZG2A 2ZUQC 4C59B 3TZVD 4P2QE 5L8LB 1I1CA 3QUZC 3ZTJG 4PRDB 3QUML 3QJHA 3AREB 4PRNB 4YO0B 3OAYH 3U7WH 2X7LA 5DHXB 1ZLUK 3O6KL 3O3AB 3L95A 4F7PB 2A9ML 1YEHH 1E4JA 1CLZL 1A7OH 2P4AB 3T2NL 5D5MF 3WJJC 1FVCB 2DWDB 1CDYA 2GY7B 1MLCA 4NT6A 3VJ6A 4QOKD 4M7LH 3SHSA 2QSCH 2XWJB 2Z92B 1KCUL 4Y2DC 2XA8L 4XI5C 4HHAA 4GG6E 1G7IA 1AFVH 3ZKND 3VWKB 4Z7VE 1AGBB 2BVEA 3ZMRA 2PYFA 1M6OA 4LDEB 5FM4A 2VDRL 4NJAH 1Q8MA 1M7DB 5ACMA 5IB2B 4HPOL 4LEOA 1PEZA 2BCKA 3GSWA 1YYLL 4MAUH 2R4SH 1PY4A 1CL7I 3CMOH 4DVRH 5I8CB 2Y4SA 4NRXA 3SDAA 1KV3A 4PJGE 4V1DB 2OZ4H 2YA0A 4H25B 4I0KA 1IQDB 2BSSA 2HKFH 4UB0L 5DQJB 2IQ9L 4ZPVB 1IARB 1P84J 3RL2A 4UUJB 1NLBH 5KS9F 3QG7H 4NZUL 1FYTA 4JO3H 5D8JL 1RZGB 2FH8A 4HUXB 5DTFA 4JB9L 1CDIA 2IF7A 1BZ9B 2XFXB 4I0PA 4NOFA 4MHHG 3WIIH 3O9WD 5FGBC 2JCCE 1T0MA 1KIUA 1U92A 4GXVH 2ICES 5C07A 5EUOB 5B4MC 5JORB 1F58H 1G9ML 1A1MA 5T3ZH 5DRWB 1QFWI 1IL1A 3TVMB 2K7QA 1BVLA 5B8CC 1OTSD 2C7UA 1T2JA 5CZXC 3TBVA 5CJQL 2ZUUA 1DEEA 2R2CA 4RWYH 4QHUB 1AD0B 1A8JH 4DN4H 1UB5A 3IDNB 1LQSR 2IC2A 1KCRH 3K80A 4N9GA 2OM5A 3B9DA 5EOCH 3SE4A 4RMWA 2VYRE 2XT1B 5C09D 1INEH 4XCFH 4YUEH 5D1ZC 3M45A 1EJOL 2GITB 35C8L 3QI9C 3KLSA 4R26H 3S4SB 4PRAB 4MNQA 1FN4A 5D2LA 2WINB 5M95B 4LCUB 3M8OH 1KLFA 2HFEA 3UBXG 1MRCL 3GBNL 2FO1A 2AKRB 3GHEL 2L0DA 1YJDH 2CO6B 5F7FA 3HMXH 5CZVL 3U30C 4GAYB 3B3IA 2IANE 3V6OC 4EUPB 3SBWC 4TVPD 4HBCH 2B2XH 5FECA 3ZKXC 1K4CB 4GLRI 4G80B 3QJFB 3ZE0E 2BDNH 4HS3A 4HUMB 2XZAH 2X40A 1B9ZA 1MHPL 4NCDA 5EBGA 3CCHA 3QHTC 1PAMA 1FFRA 1MI5E 3E6HA 3FQXB 3VFMB 4HS8L 4O00A 5I6XB 4PGEB 3KAAA 3CXDH 1U8OA 1OTTD 3RUGF 1PKQA 2VXQL 2IADA 4J6RL 5C0FA 1B4RA 5IB1B 2V17H 4JM2D 1S3KH 1T7ZA 5ITFB 3H6JA 1AQKL 1IM9B 4R4BA 4FA8A 5IMKB 4L3EB 3IF1B 4UNUA 3C6SB 5KZCD 5HHVH 3FONB 1AO7E 4LNRB 2VRAA 3AB0B 4U6YB 5HGDB 5JR1H 2HTKD 5KTEH 1YEDA 2VLRB 4PJXA 1U8KB 5GGQL 3PWPD 4RX4D 5E8EB 1TDQA 3SGKC 1P7HL 1I3GH 1RFDH 1Y18A 3SGEI 4QT5A 1T7XA 5IK3B 3ZHKA 3ZKSD 3C8DA 1WWBX 2R4RH 4OQ1A 2DQFA 3PABB 2NY4C 3WFDH 1QPXA 4NJ9H 1MH5B 2GSIB 5DA4A 1NGWA 2I9LB 1S5HB 3MGOB 3U9UA 4AEHH 1F2XK 3VXPB 3B6SA 4MDIB 2IPKA 5CGYC 2X42A 2L7UA 3BZFA 5ITBH 4LLVA 2F54E 5EBLA 2B5IC 3ZE0F 4QXGH 4JRXD 4JFHD 1T66C 1DQQA 3WFCH 4FQQA 4DN3H 1E28B 4RRPG 1Z3GH 5TDNB 4E0RB 4JFDE 1NUFA 5C6TL 4AH2A 1X5LA 5C0CB 5JHDB 3QH3B 2P8PB 3PQYE 4ZXBA 3B5HA 1NGZA 1IZKA 5GXBB 2HN7A 1KB5H 1T20B 4XBPB 5BW7A 2GAZA 1KXVC 1A6TA 3GRWA 3HI5L 1CE1H 4GRWH 1IC7H 5F7NC 1RIUL 4UDUA 3NZHH 4TUJA 4WW1B 4DCQB 5IMMB 1YN6B 3KXFB 4YXKL 8CGTA 1NMAH 5FGBA 1GHFL 3DSFL 3OJVC 2ORBL 2XTJB 4HIHB 2BNUA 4JQXC 4YK4C 4BSVB 3EJZC 4JZJA 5IHUH 1CU4L 4L3AA 5F9WC 3SE9H 5E4IA 5CEZH 1LP9A 5EZOH 4IHOA 1TJGL 3T0EC 3GKZA 3KJ6H 1N64L 3G6AA 4LDOB 1JZ2A 4ORZC 1MIEH 1OARL 4NQCE 4MJ6B 4XP9L 5L7XL 4R90L 4DWHA 2H9GA 5DD6A 5BV7C 3QAZB 4JN1L 4QXTB 2F53A 4Q2ZB 1EPFA 4RGMB 2XN9E 5EZLA 1MRFL 3T2PA 4Z78A 5DC0A 2OR7A 3I50L 3NA9L 1NUDA 4RMRA 3HE6B 3RVXC 5J9PA 3IYLW 4HGMA 2H32A 4JRYA 4EJ1C 3HE7D 4O9HL 3U0TA 4UT7L 3MNVA 3S34H 1SMOA 1Z9OA 4DFIA 3LN5A 4NFDA 2BSTA 3FCTA 4YHKL 2HKHL 1SQ2N 5T1LA 3UTTB 5J7CC 1P2CB 1IEHA 5JUEL 1J9CT 2Y5EA 2I9TB 3VXMB 5INDA 1TXKA 3OAYK 1YJDC 1HHJB 1E4XH 1S8DA 5DJ6B 1RIHL 1TVDA 3P73A 5EUOF 2XZQL 2R69L 2P42B 4CU6A 3Q5YA 1F4YL 3F6IA 3QQ9C 4XNXL 3T0BA 4DGVH 3BMWA 1NAMH 1TZIB 2P7TB 4IIQA 2VDLH 5J06A 1XZ0A 3AMKA 5B3NA 1V3LA 4XTRC 4P23D 2G75A 2VH5H 2UZXB 1TVBB 4QHNA 4F33B 4YJZL 3VWJD 3NGBB 4MQ7B 3CFJB 3HG1A 1R6VA 3UDWA 1NC4B 5F1IA 5C0BE 3T8XA 2A9NL 43CAA 4WFED 3X3GL 2G5RA 3MJ6A 3BPLC 2YPLA 1A4KB 5DXWA 4YDKH 4MXQC 1RZKH 4N8CL 4TUKH 1AHWB 4U1KB 4ZSOE 2UYLB 3TA3A 3L7EA 2NZ9C 3D39B 2AK1H 4KK6D 5IHZA 3TJEH 3QUYB 1CZ8H 3NCYS 3UX9B 4J3SA 1U8HB 5EDXA 3VRLE 3CFIC 3OGCA 3SKMA 1KACB 3FO9A 4MQTB 5EU6A 3SGKA 3ULUF 1HZHL 2EIZA 1V7MH 2FIRT 4JR9L 4MB5A 1KFAL 4NSKB 1X5XA 2ZCKH 2P24B 3T4AA 1UCBH 3VD4A 3H42L 3MRDA 1QRNA 4K3GA 2MHAA 1FGVL 4YHPA 1ED3B 1FSKB 2IAMB 3T0AA 4WI4A 3T3ME 3DRQB 5D7SL 4F8TA 3STZA 5I1EH 3BD5A 5F89A 1ULVA 3MLSH 4FQXC 1UJ3B 4MVBD 3WUZA 5KAQF 4NQVB 5BS0A 5EC1A 1EAPA 3RWGA 4UILH 1OPGL 3MTRA 2HJFA 2WP3O 3LEYH 1I85C 1XGUA 3JWOH 3IS0X 3S5LB 1HKLH 3PWNA 3GMMA 5GGSY 5D93B 3W39A 4ZO8A 2N1KA 1GZPA 2B4CH 1PG7W 2XOTA 5C0JA 4IRSD 1BAFH 4XPHL 3OR6B 5L2KA 2ICWI 3MC0A 4XAKE 1KCSL 4MD0B 4Q0XH 1S7VA 2JJWA 1QHOA 4GS7C 3VW3H 2EIDA 3OKOB 4CJ1A 4U1NA 3WSQH 3EO1B 3RRQA 1ITBB 4G8GD 4XP5L 2YD9A 4BSWB 2FB4L 1JPTL 4LASH 3K2MC 2IQAB 1MJ8L 1PQZB 1SEBB 3TCXA 7FABL 4N0UE 4G8EA 4H5SA 5FV1L 1F6FB 1UADC 3FOMB 4CKVX 4R0LB 1RHHB 1ZANH 3QUMB 4KKBD 4LP4A 1NGQL 2AJYH 5E08H 3ZSSA 1AGCB 1MUJB 2LU3A 5D7IE 3OR7B 3NIDE 1G7MA 3BKCH 4TPRL 3PGCA 2XQBH 2FSEA 1N6QL 2W9DL 3E3QC 1WBZB 5F6IB 4U1JB 3IGAA 3LKSB 3VI4F 3KR3H 4Y1AD 3GJFH 4HS6A 4FQJH 2RGSA 1L9MA 4M1CD 3B9KC 5A1AA 4M43H 1FGNH 4G5ZH 1AIFB 3DXAD 5H35B 2A2QT 2X89D 2X41A 3DWTA 5L9DL 1XCQA 1MQ8A 1AC6A 3QIBD 3EDDA 1T21A 4Z7NE 4H8WL 2ERJB 4S11A 1HHGA 1CI5A 2ATPB 1INDL 3WIHL 4ZFFA 4PJAA 1MAMH 5MP6L 4NM8L 3O6FD 1MHHA 1QSFB 4GRMB 3PV6B 3HHRB 4K8RD 1X5GA 1EEYA 4M6NL 2C26A 4IOIB 2KZ1B 4PRPB 5JOEA 3AC0A 1TZHA 2CR6A 2WBJC 3C5ZB 3DECA 5ESQB 3NPSC 1BBJA 4OZGE 4XMPL 1A1OB 3UPRB 2OL3L 5E03A 1KT2B 5KN5A 2C1PB 4KK5C 3DX8A 5DMKA 5IGXH 4WCYH 4PJEE 4JHWH 4HKJA 5CGTA 3W9EA 3N1MC 4R2GD 2C1OA 1KB9J 1XGYH 4XCYA 4EIZC 4P57A 2X4UB 4I5BB 3P0VH 2R1XA 3RDTD 3LV3A 1P4BH 4R96B 2LTQC 2EE2A 2GFBB 3E8UH 5K9JH 3OKEA 4JHAL 4U2ZA 1TLKA 1AP2A 1H0DA 2GTWA 3MLXL 4OZHA 1RUML 5DQ9A 4D8PB 3O41B 4HH8A 4MSWA 4ELKA 3QHFH 2Z91A 2Y25A 2EDDA 2C4FU 2EXWC 4HDIB 4OFKA 4TYUA 3ARPA 3D48R 4MD5A 5JQ6H 1IKFL 3MA7A 1U3JA 5FK9B 2BNQD 5CILL 4P2QA 1NCDH 3CJJA 4GW5B 3H2WA 1BBDH 4MMXC 4OQTL 2UWEE 3FB7A 4L8BA 1LK3H 5T3XH 4RZCA 1U9KA 2GYSA 2DQUH 3CZFB 4DEPB 3OZ9H 4OCYH 4EN3C 4S0TD 2OX5A 4QCIA 4DGYL 1OLZA 4YXHH 1XF2B 2UV3A 5IT2H 2ED9A 4HIJB 4PGBB 3K4AA 3AM8A 5C0DA 4MNHA 5H37H 1NH6A 1GGCL 1I8IA 2MPAH 3ILQD 2Z31A 3EOAB 5BXFA 3JWOC 3GMRB 4GG6A 2AV1B 1HN1A 2CUMA 3DLQR 4FQXA 3VFWB 4Z7VA 1BQLH 1IAMA 5IP4A 1N7ML 3QXAA 1TCMA 2BOCA 3MCLH 2B4CC 1JWSA 3DX7B 1U58A 2HT4C 3QISA 4NKOB 1QKZH 5CJOH 5EZJA 1A4JA 4LCWB 4I9WD 4YBQC 3L3GA 1QBMH 5E4EC 1I85A 5IMOB 1JF1A 1FL6B 1OAKH 2VJXA 4WFFD 5FCSH 1LVEA 2GUOB 5GGTA 1MHCA 4NPYB 1IEBA 1CWVA 4AG4H 4PJGA 4RDQG 3RWIB 1NCCL 2NNAB 3GNMH 5HD8D 5H37G 2NY3C 2DBLL 1JF6A 1NFIB 3L3DB 4X5WA 5DGQA 1EFQA 4YHZL 2DYPB 3RI5K 3WS3A 2C3WA 5ISZA 5MERB 3M17A 1PJ9A 4G43B 2JCCA 1DEDA 5FGRA 2VZOA 4AM0A 5ICXA 4U0RB 5BCAA 3CDCA 3WNOA 2P48B 4Y4HD 1FVDB 7CGTA 1G9NL 2BY2A 4OM1H 2XKNB 5AZ2L 1JJUA 4JPWH 5DK2A 3V0WH 1C1EH 1RVFH 1W72H 2HFTA 4KQ3L 3INUH 5KJRL 3QHZL 4HUNB 3MFFA 5F1OB 5ACLA 3QPXH 1ZHNA 2HA1A 1F6AA 1ORQB 4WO4D 5T1DH 3ZTNL 5FYKL 15C8H 2FJHA 2P5WA 3GM8A 1U95B 1X7QA 3NFPB 3IFPB 2NXZB 4APQD 5IKCA 4GJTB 1F2QA 3HFMH 4PJ9A 3HAEB 5LGJA 3SCMC 1XGRB 3D3VB 2NX5B 4YHNA 3TO2B 4V2BA 3V6ZA 1J0IA 5EIIB 4G42B 4FN0A 4X6BA 4KY1H 2ESVB 2VL5B 2BVPA 2ICWJ 4Q9QH 1A6UL 5LWYH 1MPAL 5D70L 4EDWH 3GKWH 1MAJA 2AJUH 5CCKH 1VERA 5CUSH 1SYSA 4NO2A 1F8TL 4JM4H 3GMOA 2NQCA 3BN3B 4UBDD 1ROWA 2VMFA 1NKOA 2DQGL 2Q76B 2Z4QA 3FRUB 4XPBL 3RVWD 4JCMA 4ZS6C 4PJFB 2EDWA 5DJ0A 1MFBH 4U6HB 1XIWD 3OKDA 4OD2B 2VC2H 3P30H 3WLBB 4UQ2B 5K9QI 3IDIB 4GKNB 3MLUL 5B3JE 1NEZB 4M7JL 3UC0H 4UMGA 4DKEH 4KK8D 4CN6A 3ARRA 5GIRB 2AAVA 1TZGL 3HI1A 4PJBE 2VQ1B 1C12B 1GGTA 5SWZB 1T83A 2W9EH 3UZVB 5L88H 1O5DT 3EDKA 1MI5A 3HUJE 4PRIA 3EKCA 4BH8B 1LNUB 2J6EH 1OM3L 5DJYB 1Q1JL 1YPZE 5FOBB 1ONQA 2CIKB 1YMME 1LE9A 5C6PB 1JYVA 3GSOB 3ARED 4R97B 4ZAKA 5GZNC 3U7WL 3FQWB 2V5MA 1CICC 4EXKA 3AGVA 1G7PB 1AO7A 5ERWA 4WDIA 1CT8A 1H3UA 2ZCLH 1A7OL 2NMSA 4OAWB 2W1NA 3QXTA 4KVCH 1WTLA 4A6YL 5DFVC 1YNKH 3TT1H 4PJ5E 2PO6C 5BVPH 3VWKD 4F80A 3QUXC 4LVEA 2EKJA 4EN3A 1K3ZA 3SQBA 1G0YR 1CD0A 1LEKA 3G5YB 1JHLL 3LKQA 5IM7B 3JZ7A 3T4YA 4MAUL 1J12A 1XAUA 3VXQA 3GJFK 3PWJA 3QXDB 5JXAL 5DK0B 1M71A 1JPGB 3OKNA 5IF0B 3IAQA 4V1DD 5DHYA 2F54A 2Q7NA 5B3JF 5J3HD 4QHLB 2PYEE 4YZFF 3QG7L 2WWMD 4S1QH 4UV7L 2P44B 3RVVC 4O02L 2NY7H 2CGRL 4RWHA 4JFDA 3RHWF 2VDPL 4XVUD 2ZOLA 4WFEE 5F7UA 4KUZH 1PX4A 2OS7A 3HUJF 5JO5A 5IQ9A 3WIIL 2WIIA 5IB4A 1RUPL 3H9YA 1ZVYA 5MEPA 4TUOB 4GG8B 3WN5B 3PL6C 4JJHA 2AABL 3L9RA 1FIEA 3QO1A 1F58L 2OSLB 4XH2B 4XC3H 5I76A 5TDPA 3BRDA 4ONHA 3EYFA 1MFNA 3DYMA 3TZVC 3N06B 1BFOA 4OTXH 3TVMD 1MHEA 1H3PH 2X44D 4NQDB 1PVHA 2YD7A 3FT4B 3QEUB 1MIML 4RWYL 1XF5A 3U2SA 3MV11 3NMEA 2P5EA 2VIRB 3CSGA 1YEKH 3K1KC 3VFPA 2PTVA 4NRZB 3HA0A 4NQCA 1G7QB 2J12B 4M7LT 4D2NA 2C3GA 3MUHL 5CINL 1OGTB 3F12B 3QDJB 3TBYB 3ZKNC 1LHZA 5CEXB 4RBPH 1G1YA 1HHKA 2E9IA 3CH8A 2VR5A 4R26L 2XN9A 5FHAH 3LRHA 2Q20A 4AK1A 4FQCH 2X4PA 3S8WA 1I9IH 3IDJA 4AENA 2YKLH 3FQNB 4RISH 1NAKL 2EC8A 3U7YH 4M3JA 3P77A 1EIBA 3DVNB 1G0DA 5TGBA 3HMXL 4ZQKA 4MDJA 2EYRA 1X5KA 1J5OH 3ULUD 2MQ0A 1JHTA 1JGEA 4FG6D 3ROOA 1U41A 1OD9A 2CD0A 5BZWB 1IGCL 2BDNL 2KDGA 4LLMA 5CMAB 5KVDH 2VXVL 4G8GE 5ID0B 3O9WC 4QRRB 1CIDA 3I9GH 4BA8A 5I8OH 4Z0XB 4EQ3A 5C2UB 4X98A 5ANMB 2AGJL 4U2YA 5B39B 2DIAA 2EIEA 4I3GA 5GGUA 5D7JB 2VITB 3ALWA 1FO0H 3DUUA 4F37F 3CXDL 3I6GB 4NWUL 5DEFA 3VFRB 3LPFA 3D2UB 1IM9D 1OTSC 2Z8RA 4M1GH 3MGAA 1WUNT 3T1WA 4L3ED 1V5JA 4EI6B 1KJVA 5E2UH 1SJEA 1WC7B 3VGFA 3DROA 4NFCA 4G9FB 5E2WL 5C0BA 3O2DL 1E27B 5JR1L 2VLRD 3QFJA 3MX0A 3O8XB 4FFZH 2CDEB 4JFEE 5DI8B 5FAAA 2WM0A 4PB9L 3SE8H 1HSBA 5HY9A 3BUTA 3MUZ1 4RCAA 3VFUB 4P2YA 3PIQB 3DHJA 5DRNB 1S7WA 2CDGB 3PE9A 5DJ2A 1FNEB 2H32H 3IDGB 3PWVA 4K7FB 4WFHE 1N4XH 5TJWK 1QSEE 1UC6A 4M8QA 3WFDL 4XNUL 5IW6A 3SPVA 1JZ5A 5D96C 3SDYL 4U7SA 5C3TA 3DMMA 4BELD 4PJFF 2UZIH 3IVKA 3DVGB 4X0KA 3EYUH 1V3MA 1QFUH 1EDQA 5ITBL 1XH3A 3QA3A 5AUMB 3QUXA 3P4MB 1MELA 3NIFE 2HLAB 4WU5B 4DN3L 2FD6H 4CMHB 1F4WH 5DA0B 1I4FB 5E1AB 1TPXC 3VFOB 4P4RB 4PJCB 4FQ2L 1KEML 25C8H 3O2VL 3S88L 5C0CD 4WHTA 5JHDD 1YNTB 4JVWA 4KK9D 4CGTA 4I48A 4ZFGH 5IBUG 5I19H 3UYRH 2VN7A 4TN9A 2OL3B 4Z77A 3WNNA 2VB5A 5CIPA 5I30H 1KB5L 4ALAH 4XC1H 2MTPA 3S3JA 2CLRA 4IS6B 1EK3A 2X4OB 1DQMH 3EGSA 1OTTC 1KJ2H 5KSUB 3KXFD 4MAYB 2VE6A 3QNZA 4ZPTA 2ADFH 2F8VA 4JM2C 3U4EB 1N59B 3FHAA 5AAMA 2DQHH 4X80H 3W2DH 4RFOH 3BMVA 4QF1A 1QLRA 2XTJD 4XBGA 5KVGH 1D5BB 2D0HA 3PL6A 3V4UH 4HULB 2HTKC 2P8LB 4M62H 2LU4A 5CEZL 5EZOL 4F2MB 3QDGB 2OJEA 1QFWH 3TZVA 4EQ2A 1XGQA 4M7KH 2QQLH 1SJVA 1SY6L 3FO1A 2NTFA 3A6CH 3WHXB 5IFJA 3BPOB 4N0UA 1M7IB 3A6BH 4LSUL 2H6PA 4EIGB 1WLHA 1QVOA 2FJFB 3QQ4A 2IH1A 3KPMA 4F57L 3EYQD 1A6WH 2J8UE 2B1AL 1FNAA 1CFNB 3MCKB 5D7IA 4U6TA 1T0PB 3HE6D 4LIQH 1R3LB 1KIPB 1UZ8B 2GK2A 3MRNB 3K8LA 1UEMA 3B4NA 1IM3B 4NN7B 2VOTA 5CKGA 1F45A 5GJSH 3UJJL 5T33L 1A0QL 1U6AL 3S34L 2FIKB 4KHXL 4YWGL 3UTTD 3IFOA 1HILB 1WBXB 4JFYB 3VXMD 2Q3AA 3HS0B 1FFQA 4JREB 4L9LC 2XNAA 5CWSA 2FEDD 1BJ8A 4D0BB 4KI5F 4X7DC 5D1XD 3NAAH 4QRPD 1OAUL 5KSAD 4PV9A 3MRCA 4CN1A 1A5FL 3AS2A 3IJYB 5E8OA 3HZYA 4F15B 1U91A 3F5WA 4U1SA 5MI0B 3LKPB 2LU7A 4JFOA 5IVZA 4WI9A 2NW2B 3C09C 3TBSA 1I9EA 2HJLA 3K46A 1KLGA 3NFSH 2CXGA 4LU5H 3U0PA 1H15B 5C0AE 5GJTL 1GOFA 4L8DB 5I74C 1K6QH 4RQQA 4QHMA 5FYJD 4KQ4L 4ELMA 3EYVB 3K7UA 1NC4D 4OZGA 1T1XA 3MJ8A 3V9FA 5BRZE 2OR8A 2X4SA 5EFIB 5HDQH 1JUFA 3QIUA 1KJMA 3MRRB 2FX8H 3C9NB 5IOPB 1N2RB 1OWRM 4PJEA 4WWKA 4TUKL 1B6UA 3EFDL 5GRJH 1JV5B 1ORSA 4JG1L 4OFYD 1KNOA 1R3KB 3D39D 3L6FA 1X4YA 1QSVA 2NPLX 4NUGH 3KYAA 1XEDA 3TJEL 3QUYD 4WHDA 4UV4H 4XPTH 4QXUL 1CZ8L 5FKAA 4YPJA 3JXAA 1HXYA 3ECBB 1DBKH 1DBJL 3ESVF 5HJ3B 1KOAA 3HE7C 4JFZH 2DI7A 3QCUL 3C5JA 5IJKA 1BGXH 1EO8H 4CNIB 2GJJA 4WV1B 1V7ML 2XIDA 2JKXA 1Z5LB 3BXNB 2JIXA 4MD4B 3O3DA 4OFIA 4M1DL 1HCVA 5A2LH 1LDSA 1N3NA 4BFGA 2IAMD 4LF3A 2GK0B 4U1LB 3BP6A 2UWEA 4YHIA 2H8PA 1MWAA 4KROD 3OB8A 4Y4KB 4Q6IC 4OI7A 3RWEA 1NL0L 1F6LL 1TQCB 3V2AR 1MY7A 4ZUSA 3O81A 3U6RA 3LEYL 2FNBA 3VXNB 4RBPK 4M8VA 2E27L 4XP4H 4P23C 4YQXH 2WMPA 1UCTA 3PP4L 2V2XA 3DIFB 4J12A 4XPAL 2W07A 3VWJC 1PSKH 1I7TB 1KTDB 5HYJB 4U0QB 4XMLH 1X6NA 1F97A 3IDUA 2OK0H 3MLZL 1U3HA 4JPKH 3LS4L 4Z7WE 4XRCB 1X4XA 4LASL 1HIML 1CFVL 2VLME 1EBAA 3MJ9A 4LLUB 1DQJB 4Y0GA 4KK6C 3VXOA 1CYGA 4ODWB 5C9JB 4OZIB 2O5ZL 3CDGB 5D9SA 2YHGA 1ZANL 5FDYA 4H0HB 4WU7B 3PWPA 1CD9B 4R6UA 3T65A 4Y7MA 2A6JB 3SE3A 1CS6A 2ZKHL 1AGFB 3FT2B 4PRBA 1DQLH 3DHMA 2XWBA 5BJTB 2NY5C 4WUKH 5KSBE 1IT9H 4Q9CA 5ESAA 3S9DB 2ZSWB 2APVA 4ZO9A 4C55A 4PJCF 4JZOB 4A6YB 4XVJL 4FQJL 1WWCA 4P9HH 5T1MB 1IGFH 3R0MA 5IR1A 1EEQA 1TJIL 2VZUA 4M43L 4H20H 4JFFE 1QA9A 2AW2A 2RQ8A 5EPMB 3I75A 3MLPA 5TE6H 1T03H 1IGTA 2I5YL 1J0HA 5DQDH 4PR5A 5T1KB 3C87A 4MVBC 4P5MB 2OTUA 1UXSA 1HINL 5F9JB 4KZDL 3RWJA 3GI9L 1BOGB 1OAYL 4L9LA 1M05A 1DLFL 1JPSH 4P59L 2NR6D 4FXKB 5H94A 3VGDA 1QSFD 1AY1H 1WFUA 4J3VA 5JIIA 1S7QB 5DC4B 5E6IB 1XR8B 1CFQB 1G7LA 4Y16B 5ECJE 3SQOH 5ACZA 4PRPD 4G8IA 4X5XB 4K7PY 5IROA 4YPGB 3C5ZD 1N5AA 4XHQA 4URTB 1MLBB 3BP4B 3RNQB 3PNWA 5CBEB 4WNQB 1KPVA 4HWBH 5ICZB 4KKNA 1XGYL 2H41A 3RX5A 4HFWB 3Q1SH 3V52L 3P0VL 1NFDA 2GI7A 5J13C 2Z8SA 1GPOH 2OCFD 4KKBC 3KYKH 4GW4A 1IE5A 3BJ91 2C3VB 1HHHB 4NKDA 3V5HA 5KSBF 4XVSH 4HKZA 3H0TB 3BHBB 3VMPA 2A74B 2CJUL 3F7VB 3Q5OA 4P4KB 1K9TA 1T5WB 5IJVA 5DVOA 4Z8FH 1YPZA 2QKIA 2RFXA 4ETQB 3FOLB 4M1CC 3FFCB 4M9PA 1YMMA 3S37L 1C16B 5HPOA 3HE7A 2CKNA 4F9PA 4NNXA 5I17B 4PJIE 3QDME 2PTUA 2P45B 1DBAL 1DN0B 3QIBC 1NJ9A 2DQUL 4OCYL 3SKOA 1RUKL 1K8IA 1FG9C 1I8KB 3K2UH 1EUUA 2XA3A 3G04A 5DD0L 4K71B 1BP3B 1BWMA 3O6FC 1B3JA 1FNLA 2R0ZH 4OUUB 2G60H 1RULL 3V4PH 4K8RC 3MRHB 4M48H 4PJ5A 3DX9A 2P46B 4PG2A 5K59F 4XAWH 3QIWA 2DJSA 4XCNA 5LGKA 3MMEB 2DQDL 1WAAF 4O2FB 3PWUB 1YEIH 4LCWD 3CFDA 1N0XH 1QBML 2YUZA 4HIEB 1HSAA 4CU7A 2KBGA 3AVEA 3DO7A 3RTQC 3VFVB 1NBQA 1P7KA 3V95A 1T2XA 2EH7H 4ZOEA 4MJIB 2I24N 1H8NA 4R2GC 3BGFB 4N68A 3GNML 3RZCB 5LXGH 2ITDB 1P4LB 4AIOA 4L9DA 1BIIB 3MNWA 3EOBA 4JN2A 3MV9E 3TGXA 1IMHC 3QFDA 3A67L 3VE0B 1F11B 1IGYA 4O58H 1IAOB 5DURD 4NC0B 3QCTH 3EFFA 2ENYA 4UQ3A 3SOBL 4HJJL 2A77H 1CR9H 1MQKH 3WHE0 3NCBB 5FHBL 3FQUB 5GHWH 4HZLB 3SDDA 2R2EB 2MMXA 1GGBL 4KJPD 2OI9B 4PJ7E 3L3IA 1XMWA 4DQOH 1IBGL 4AT6A 4X8JA 3U0WH 4CL7A 3MBXL 2HFFA 4JPWL 4G6KH 1XGTB 3V0WL 2W38A 4RGNB 1C1EL 1W72L 4GKSA 3RIFK 1KIQA 1J8KA 3ULVL 5EU3B 2SEBA 2VQUA 2N7BA 1RUQL 3IKCB 4F9LA 5B38A 5T1DL 1N6UA 1UM6L 1KPUA 1IAKB 4KDTC 2PXYC 2N7AA 3KPSB 2FX9H 5C2BH 1F3RB 2RCSL 1D7FA 1A7BA 1CVRA 1VFAA 2ADJA 2NXZD 3C08H 1Z0NA 4CVXA 4JFPB 4LMQI 4I1NB 1RUAH 3LIZH 1BQHA 3D3VD 4L8CB 5ILTL 2QHLA 2HWZH 4Y5YC 3ILQC 1CXFA 3KYMB 4XBEH 2GY5A 5HVGB 2H1PL 1HXMB 3X14B 5DF0A 2ESVD 4KY1L 2KL6A 4X8XA 3QG6A 5E8NA 1E4WL 1NSNH 1KTRL 1UWGH 5LWYL 3D69A 2YMXH 3P11H 4EDWL 3VXSE 4FNLL 5CCKL 5CUSL 2C5DC 4DW2H 4D9RE 4OV5B 5AZEL 5J1SC 3MGTA 1KB5B 3PGFL 4Y19B 3TYFA 5HHPB 4PJHB 6FABH 3BKYH 5IG7B 3WFZA 1X4ZA 2APWA 1A9EB 4GRWB 5F3BA 4OZIF 4IRSA 5DJDA 5HD8C 4ORGB 1KCVH 4YHMH 3P9MA 4JY5H 5DZOA 3MV8B 2X1XR 4QRQB 3CVHA 3CK0L 5CEYB 4LLDB 2X1OA 4G8GA 4ZUVA 3UC0L 3C6LA 3ORJA 4D3CH 1UZ6E 2VR9A 1MVUA 1GH7A 5SWZD 4WY7H 3C8KA 3WD5L 3WUWB 3TH4T 3LDBB 4Y4HC 2ZOKB 4XP6H 3V0VB 1DLHA 4E41E 4MJ2A 1K2DA 2QEJA 1S9XA 2A6KB 5HHMB 3WHE1 3SKNA 3TEUA 4DFHA 1TTGA 1BX2A 2YN3A 2DDQH 4WO4C 4I3RH 2WAHA 4M6AA 5K33A 1CFSA 1RMFL 3PJSA 1SJHB 5E2TL 4LLQA 1NANI 1RJLA 2ZCLL 1RU9H 5CD3B 1T6VN 4HG4J 4PG9B 4JFEA 4JVUA 5DGRA 3VD3A 4J3WA 3DXAA 2W65A 4JANA 4M7ZB 3Q6GL 3GMPA 3CX5J 2X89A 3MO1A 2FEEL 1VACA 4KGLA 4QRPE 1K4DA 4RAHA 3QIBA 4NDMA 2IGFH 1OSPH 2AXGA 5DSCA 4NBZB 1ZVSA 3BZEB 3QXVA 1ZA6B 3H7BB 3NA4A 5FYJU 5C7XH 4JO1L 2EKSB 4PV8B 5HVHC 1MFCH 4UBDC 3FO0L 4LSQL 4TQEL 1IGJB 1X5IA 2ZCHH 2OBGA 3ULUH 1NAMB 1ZLWH 4EUPH 1FLTX 5KSVB 1KN4L 5D6DC 1JGDB 3RVWC 2J5LC 2J7LA 3CH1A 3KLDA 1HEZB 3S4SG 5DC9B 3L3JB 4X6FB 4RFNB 1XIWC 4NN6C 3B43A 1BREA 1E6JH 2BRRH 4KJWD 4KUZL 5CHNB 3BT2H 4KK8C 3RGVB 4MNGE 5CJXA 5EU7E 2Y5TB 5FA3A 4B53A 3DGGA 2B0SH 4ZYKB 1FAKT 2D7MA 2UY7A 4OZFA 3Q48A 1Z9MA 1HQ4A 1BFSA 3RDTA 1JRHL 1PFCA 1AI1H 4KRPB 1KTLA 3BDYH 2A6DA 2AEQH 4EEEA 4JAMB 1HH6A 1ZHLB 3ALXA 2Q86B 5DD5H 4GW1A 5D1QB 1X5AA 5EBMB 1VFBB 1JNHB 4N90E 4M9OA 4OSUH 4NQDD 3AREC 3OKKA 4RIRA 4WUUB 3V6FA 4L4VB 3IU3B 4YAQA 1FAIH 4WEMB 1U8IA 3UTPE 2DQJL 3EOTH 4HBQA 3UROR 3JV6B 3TO4A 4W70A 3QSKB 5EO9B 4N0CD 4A2MA 3RGHA 1VA9A 4L4TB 2G5BB 2ZNXA 5KAQG 1B2WH 1UH4A 3JVGA 1JGUL 3EOYG 2J88H 5K9KB 3MROB 4X9FA 2XPGA 3QDJD 4KDTA 3OJDA 3HNTL 1JNLL 2Y7QA 3VWKC 1I1FA 5CAYB 3G5VB 2Y36L 2J8UA 2NW3A 3R06A 3ARTA 2M26A 4P5TB 5F7EL 3ARBD 4BJLA 3U7AA 4FQCL 1UEYA 2VDNH 4XVTL 4F3FA 4JEGB 4UAOB 3ZYOA 3RWFA 3MLYH 3KHQA 4QRSB 4P2RE 1AQDA 2IBBA 1BLNB 2YKLL 4PREA 1J1OH 1CGUA 1HQRB 3F7QA 4X7SH 4QY8B 3LAFA 2JLLA 5J3HC 4C56B 5IIEA 2J4WH 1Q94A 5E24E 3NOIA 3NTCH 2WWMC 3MLRL 4P3DB 3NCJH 3UO1H 4XVUC 1YECH 3VA2C 1T1YB 1FRGH 2XQYG 5KVDL 4QRRD 1GL4B 3GRWL 5GS2D 3KLAA 2EO1A 4JPIA 3TN0B 2VDKL 4U6XA 1UYWH 4YNYB 4NBYB 2GJ6B 2W0PA 2ADGA 2QADB 3O6LH 5C86A 5D7JD 3MBEB 5GS0D 3WIFA 1OLLA 3KWWA 4NKIH 5TH2A 3W0WB 5C0AA 1PG7X 3H9HB 1WSST 4NKMA 2DRUA 4O2EA 3TVMC 3P3YA 5DRZA 4ZG1A 3D2UD 4U3XA 3BFOA 4DK6A 4M1GL 32C2B 3OAUH 3FMGH 3MRJB 5E2UL 3TYGL 1T1ZA 5JA8B 3BW9B 1ZTXL 4G9FD 3JV4A 3UTZA 3KPLA 5BRZA 4D94A 3WKMH 3EZJB 1QNZH 4NQSB 4PJ8B 3O8XD 1ZKAA 4NC1E 1HNFA 4N5ED 3CFEB 3LPGA 5DWUH 5EULV 3FQRB 3FKUS 3GJFB 2CUIA 3SE8L 5ENWB 1H5BA 4H26A 4OLWH 2FL5A 2D2OA 2VWEC 3BIKA 3GSNH 4MHHI 4G3YL 4GRLA 4APQA 4PJHF 4CVZB 4HAFA 3LMJH 1YDPB 4JY6B 2FH6A 1S9YB 4LCYB 4O5LL 4OLEA 3WBDA 3T1FB 1CLOL 4X6EA 1IEAB 1XR9B 3C60D 5EBWB 1TITA 3VH8A 3BP5A 2ICEA 2ATKA 2UY6A 1MCBA 1QFUL 3OWEA 3V0AC 2CK0H 3WEXB 3ULUC 3TIDA 1K5NB 2DQTL 1GJIA 3U1SH 4J3XA 5E6YA 4PIRF 1AJ7H 5F70A 4FG6C 1NC2B 3F7YA 3KPNB 3CNKA 4RAUA 3BGMA 25C8L 3F8UB 4OT1H 4FZ8H 2QHRL 2O5YH 2RHEA 4WWID 1RURH 4ZFGL 5I19L 4XB7A 1NDGA 3LKRA 1YUHB 3RVUD 2O61A 2FO4B 4NNYA 5EO1B 5C08B 1WIPA 5I6XC 4IMLB 1CDJA 2KUTA 1MAKA 3HC0B 2ICWA 4MAYD 1BEYL 2ADFL 4HC1A 2FX7L 3B2UD 2UVEA 3V5DB 3W2DL 4PGCB 4RFOL 1L6XA 4D0CA 1JPFB 3BZ4B 3EYOB 1ZA3B 5A2JH 2MKWA 4HQQH 3RNKA 3AB0C 4NYLB 1BD2B 4M62L 4Z7WA 3QDGD 5C71A 4DOHB 2R1WB 2RIKA 4M7KL 1ZT4B 1QLFB 2AJVL 3GUTB 1UACL 3BD3A 5TQ0H 3OKMB 1JN6B 1EXUB 2H2PD 2BVTA 2FJGA 4F7PA 2BRQA 4IRJB 3RI5F 1C7TA 1A6WL 3MRGA 1WEJH 1MCOH 8FABB 3U82B 3CSPA 2F58L 4YDIL 1QR1B 2XWJA 3GBMH 2FR4A 3D0VB 4P0DA 1EFXA 3GO1L 2IBGA 3JTSB 2A0LD 1UH2A 4X4XB 5I1HH 3VWKA 5JW4M 1AGBA 3QEQE 3CGTA 3DVIA 2XZCL 3FN0L 2F8OA 5AEAA 1A3RL 3RJDA 3MV7B 4HT1H 4OF8A 1CLYH 1MJ7H 2JELH 4JFFA 2D9QB 4UTBH 4M6ML 2V5TA 1TJHH 4U1HA 1WFTA 3TV3H 2ICCA 4QRUB 3S35H 5A2FA 4KK9C 4LSPH 1Q9LA 3ARGB 3QZWA 3VXRE 1HYSD 2VKXA 2DLFL 4MA3A 4MXWH 5DQJA 2AQ2A 3BOVA 1Z9LA 1RHFA 5E56A 2DD8L 4W6YB 2HAZA 4NHUA 5C0RL 4HUXA 2P49B 3SDXE 1KUMA 2R2BA 2AJ3B 4I2XB 4BKLB 2XTJC 1R24A 2Q6WB 2EECA 4L29B 3B2VL 1TENA 1YQ2A 2OJZH 1ZLWK 2GQHA 2X70B 1G7JB 2VLKE 3HPJA 5C1MB 1FZKA 4ZTOH 2W91A 1LD9A 3S5LG 2FX8L 4IOSD 3MJ9H 3ARFB 1Q0XL 4JJ5A 2XG4A 3QAZC 1DBMH 3MUJA 3QJHB 3UTQA 3O6KH 4QHUA 2X7LB 4LVHB 1W72B 4RGMC 3EYQC 2W9LA 1KF9B 2A9MH 5FYLE 4ZD3L 3L95B 4UV4L 4XPTL 5FYKD 4J3OC 1CLZH 1VEOA 3HE6C 3T2NH 1FZMA 2L4OA 3I02A 1KYOK 1MREL 5BV7L 5DT1L 3FTGA 4NT6B 1OAQL 5HYSA 3EHBD 1PZ5A 2XA8H 3KPRD 2VN4A 5KVEL 5GGRB 4KRNA 4HHAB 5EOTA 3REVA 2BVOB 4WI7A 2VDRH 5DJAA 2XACC 1A7NL 1S78D 3OB0H 2PYFB 2FEDC 1M6OB 2VUOA 5EC2A 4OBSA 4U7MA 2AI0H 4HF5H 1YYLH 2BCKB 4PJIA 3GSWB 3QDMA 5KSAC 2AKRA 4NO3A 1OB1B 2R56H 5FFLA 4DK3A 4Y4KD 2X1PA 4KH2A 3SDAB 2XRAL 4GAYA 2IQ9H 2BSSB 1U0QA 4NZUH 1K4CA 3BAEL 2XQYK 4G80A 5D8JH 5KANG 3QWOB 4JB9H 4GOSA 1FYTB 4RSVA 3QDAA 4YQXL 5DTFB 2YRZA 3ILPA 4YBLB 1WWAX 3WS6C 3NGBC 5DEGA 1XF3A 2KH2B 1LILA 4JFXA 1T0MB 3KDMA 5HYJD 1MRDL 5SX4H 4K9EL 1U92B 1QRKA 4J4PC 5C07B 4XX1E 3OKLA 5E9DE 1CXHA 4KV5F 2WLYA 1A1MB 3I6LE 5IB1A 1AHWC 4JKWA 1IM9A 5ALCL 3VFGL 1IL1B 3LEXB 4H88L 4L3EA 3LEVL 1BVLB 1I1AA 1TFHA 2C7UB 4HWZA 5CJQH 3QUYC 3TBVB 4U6YA 5HGDA 3MV9A 1DEEB 1NGPH 3NCCB 2VLRA 1J8HE 4BK4A 1GC1L 2EDJA 1UB5B 1H3WM 1TETL 3HI6H 1NBZB 3IU4L 4N9GB 1MFDL 3D85A 3L1OH 3U48A 4EZMA 1I3VA 4Q97A 3KYNA 1DQLL 1CDUA 1IZJA 3V5KA 1EJOH 1YNLL 2BY3A 35C8H 4PJ7A 5F7YC 1QFHA 1FSKC 2IAMC 4MNQB 1FN4B 4P9HL 5D2LB 1MH5A 2GSIA 2VXUL 4L3CA 3MGOA 1MRCH 2GIYA 1UJ3C 4KROC 5T1KD 2HFEB 1G6RA 3IJHA 3GSQA 3TNMA 1WCBA 1I8LC 3BQUB 5CZVH 4W4OC 5JW5B 1U93B 2LVCA 1T0NA 4R4ND 2EDBA 5TDNA 4LQFH 2UUDH 3B3IB 4AYFA 5D93C 3TNNA 4C4KO 5FECB 5C0CA 4HS3B 5E6ID 4NQEE 1YC8A 4Y16D 1H8OA 4QNPE 1MHPH 4XBPA 3EBAA 3OSKA 2Y1VA 3SKUD 3BGAA 4XXDA 2V2WA 4WTZA 2XTLA 3VXSA 5AD0B 1W0WA 5GGTL 3R8BB 3CCHB 4HS8H 2OLDA 4DCQA 3U4BL 1YN6A 2ZSVA 4NNPL 2VXQH 4J6RH 3VXUD 1U8OB 5EOCJ 2IADB 5C0FB 4FFVD 3ME0A 4HIHA 4NP4L 2EDHA 5ELIA 4GSDL 4R4BB 1S9WB 3ULVE 3MZTA 4R0LC 1WICA 4M61A 3UPCA 4RGOL 4DUXA 2NY0B 5GGQH 3HMWL 1FLRH 4MJ6A 4ISVA 3ARDA 5F6IC 1YQVL 4P4KD 1Y18B 4LSTL 1ZS8B 1SBSL 4QT5B 3ZT7A 4H0GA 1U8QA 4E41A 1LO3H 2JF1A 4I4WA 2Q8BH 1QLEL 3FFCD 5CD5D 2GHWB 3VGEA 3ZDXF 2DQFB 4ZFZB 1JVKA 1FPTL 4PTUB 3KLHD 4H1LA 3MJ7A 3QULB 1RY7B 1U8NB 4KAQL 5FO7A 3HAEH 1NGWB 5MEOB 3NZ8A 4MLSA 3IDXL 3QQNA 2I9TA 2IPKB 3NIGF 2ERJC 3BZFB 3FL7A 3MRBA 2ZUSA 4LLVB 1SJXA 2NR6C 3HRZA 1DQQB 1ODAA 2BXYA 4FQQB 4LVNC 3G5ZA 5D1XA 1JPST 2G60L 4QRPA 5KSAA 5C6TH 2DQCL 4M48L 5FO9A 5TPWH 4UT9L 3CDYA 5L2JA 4ZXBB 1WFOA 2YPVH 1NGZB 3WFHA 2P7TA 2HN7B 3QNYA 1X5FA 3C5ZC 3HI5H 2X4QA 5GISL 5JLZA 1A6TB 1N0XL 1Q0YL 1U8MA 5DJZA 4G8FA 1MY5A 5D2NE 1F4XL 3WE6A 3HAEG 3NVQA 4IDJL 4FXGB 1J18A 4QEGA 4YXKH 4KUCF 3VFSB 3ULVF 1G9MC 4L8SA 4MJID 4PRHB 3WS6A 3RZCD 3DSFH 3CVHH 2ORBH 2WWKT 4TSCH 1CGTA 5GRZA 4NO0A 4YFEA 3VD7A 4ODXA 1NC4A 3VG0H 2BNUB 1A6VH 3RWHA 4JZJB 2BSED 2LV4A 4ZDHB 3THMH 4MNGA 4XWOD 1A21A 1TJGH 1LP9B 2ZG3A 1N64H 4IHOB 3ZE1E 1OARH 4O58L 4OFYA 4MXQD 1ZT1A 4XP9H 4S1DD 3QCTL 5I8EA 4PLJD 4PY8I 4JN1H 3TBWA 5DD6B 4TOYL 1DUYA 3LN4A 1MRFH 1J05B 2F53B 2WUBH 4M00A 3I50H 4J8RA 4QHKI 5EZLB 4G6KL 4Z78B 2X4TA 3X12A 5DMYA 1NEZG 4N1HB 1RJZA 4UT7H 2VLJD 1P6FA 2H32B 4JRYB 4HCRH 2A1WL 3U0TB 4BZ2H 2ID5A 3KPSD 4NSKA 1Z9SA 3MNVB 4YHKH 4DEPC 2HKHH 1F4AA 3LN5B 5FDWA 2BSTB 3FCTB 1AXTH 1NCBL 4TSBL 4ZUUB 5INDB 1RUAL 4OFVA 5HI5D 3DRQA 2HWZL 1FL3A 3S35X 4YHLL 1S8DB 5L6YL 2ZP0T 2XZQH 2H26A 2R69H 4PP1D 3P73B 1F4YH 5CJ8A 4XNXH 3QB7C 3P0YL 3DBXA 1WK0A 2VISB 4LARL 2X9YA 2CKBA 4W4OA 4D0DA 5DS8B 1IC4L 5MEQA 4HLZH 1KTKE 4IIQB 5B21A 1WITA 4P2RA 3PDOA 4Y19D 2IH3A 3DV4B 5ALBL 6FABL 3ZZ1A 3FB5A 3OB0K 4HH9B 4UT6L 2APXA 1KEGL 4XCEB 3MUGA 2G75B 4S1RL 1UKTA 5EIVA 1YN7B 4DZ8B 4QHNB 4YHML 3HG1B 3H8NA 3SJVB 3MV8D 5BVJB 5F1IB 1BJ1J 3T8XB 3X3GH 4QXWA 4BSWA 43CAB 4PJXE 2PR4L 2ARJA 1A7PL 4OIIH 4JKPL 4D3CL 4ZFOA 4U0RC 1NGXA 3BKJL 1SEBA 2W0FA 1FL5B 4GAJH 4HLZG 5CEZD 2OYPA 1VCAA 5D2LF 1L7IH 3TA3B 3L7EB 4KJPC 5MENE 4GAGL 3QUMA 2AXFB 3M07A 5HHMD 1AGCA 1QYGL 5JQHC 1AKJA 2AERT 3CLEL 5LBSL 5M7QA 2HH0L 3MODH 4UZGA 3DV6A 3OGCB 1Q72L 3SKMB 3MRMA 2Y06L 3FO9B 1HZHH 4FOMA 2BNRE 5EU6B 3BH8B 4X9IA 3LKSA 2EIZB 2NXZC 1B6DA 4OZFG 5JDSA 3RX7A 4NWTL 3T4AB 1WBYA 2X4RA 5KG9A 1FFNA 1Q38A 4FQPA 1FGVH 3MRDB 1QRNB 3B9KD 2MHAB 4X6DE 2BZDA 2JK5A 5EUKA 1C5CH 1P9MA 3RHWK 1CD1B 3STZB 5F89B 2VXTH 2BHYA 1YZZA 1OSPL 2VZSA 1JNJA 3EJYD 5A2IH 4QTIL 5KVMC 1BECA 5EC1B 1EAPB 5BS0B 5J6GA 3SO3B 1WIUA 2HJFB 1XGUB 2ZCHL 3PWNB 3GMMB 2E9JA 3W39B 2H3NB 1GZPB 1EHLL 1SM3L 5C0JB 4N1CA 3HZMA 5L2KB 4PJXF 3KPQB 1W8NA 1A1NA 5GS2H 3UPRA 2WV3A 1B0GB 1M7XA 5FYKU 1S7VB 2F15A 1ADQA 1U2HA 3RGVD 4XP5H 4U1NB 2FB4H 1JPTH 1WIOA 3CXHJ 2B0SL 1MJ8H 1MJJA 3Q2CA 4FQ1H 2NZIA 7FABH 4Y5XA 2V5RA 4KRPD 1P1ZB 2EC9T 4OCNC 2GFBA 1ZE3C 4HJ0D 3RWCB 4G6MH 5I1JL 4DUVA 5TFSH 2CIIA 1NGQH 5D1QD 1F4HA 5F9WB 2W60A 4LCIL 4OSUL 4R97C 2ZUVA 4L4VD 4D8PA 1G7MB 1FAIL 1FV1B 4PTTB 3U46B 3KPRE 4ODHH 1FYHB 3IGAB 4PYGA 5FK9A 4JHZA 4XPGL 2EEBA 4L4TD 4GW5A 1VPOL 4HS6B 1RJYB 4HXAH 2J88L 1EGJA 4BFEA 4C58B 3CZFA 1G1CA 5I1IL 2YD1A 3K4ZA 1JIBA 5DMJB 4H8WH 1EX0A 3DO3A 1I7UA 1T1WA 4LCCA 4YE4L 1T21B 1BMGA 3ALPA 3D25A 2CQVA 3V6OE 3WIHH 3PG2A 1HHGB 4XNYH 4LPXA 4NM8H 1AE6H 1LO0L 5MP6H 4ZFFB 3S36H 3G9AB 1V05A 3G9VA 4F37K 1IAIM 1J1OL 1WTGT 4M6NH 4MYWB 5DUML 3HC4L 5GGVL 5JIKA 3V4VL 3AUVA 1EEYB 1UWXK 3DX7A 1LP9F 3HKFA 3WNPA 5IMOA 12E8L 1FL6A 1TZHB 2FGWL 2C3HA 4N5UA 4OF0A 4N0YL 3UO1L 2OL3H 4KJWC 1BBJB 1FRGL 4ESKA 4U4BA 2YPLE 3TN0D 3VXRA 1GIGL 2NNAA 5DMKB 3LRSA 4PY8J 4HKJB 5F71A 1UYWL 1WV7T 3WN5C 2GJ6D 1NFIA 1OCWL 2EYSA 3W9EB 2C1OB 2QADD 1J0ZA 4P57B 3MBED 1K8DA 1FH5L 2R1XB 3SDXA 1JFQL 2CPCA 3LV3B 3W0WD 3F7RA 3U9PH 1V3JA 5MERA 4XZUA 3UTSE 1W0VB 3MLXH 5JW4Q 1AP2B 1H0DB 2GTWB 4OZHB 5CP3H 5IW1A 2E6JA 3D18A 3QCVH 2VLKA 4HXBH 3WJLC 4ELKB 3WKML 3IAPA 2Z91B 4PJ8D 4N0CC 1R3HB 1IKFH 5CILH 4MD5B 1DQTA 3G08B 3MA7B 3GSVB 4OQTH 2FEEI 2VXSL 4JDTL 4WEBH 1X44A 2JE8A 3HR6A 3FB7B 4L8BB 4OLWL 1Z0MA 4XNMA 3NFPA 2DQEH 4RZCB 1GXEA 3GSNL 2KPNA 2A6IA 4BK5A 1MVFA 4DGYH 2IPTL 5JOPE 4QCIB 4B7IA 3GSRA 1KLUA 4Z7QF 3CUPA 3TO2A 3O3UN 4MNHB 4HKBA 5HXMA 2Z31B 5BXFB 1EAJA 1TIUA 4GG6B 1N7MH 3CAFA 4Z7VB 4JDVA 4MA8L 3U1SL 2BOCB 1RPQA 1AJ7L 1JWSB 1NC2D 1Y6MR 1IGML 1U58B 1LDPL 4DTGL 1A4JB 3L3GB 1JF1B 3VXUE 4OT1L 2Q76A 1ZGLP 1MHCB 1BWWA 1NCCH 4PJGB 5T3ZE 3SY0A 4OGAD 1KG0A 2Z0BA 5C08D 1JRHI 4RFEA 2Z8WC 1FG2A 1S7TB 2DBLH 1MCWM 4XXCA 5D7JC 2VNCA 4FHBD 2FGZA 4OCXH 4YHZH 4NRYA 4X5WB 4W68A 3WLBA 4GKNA 4ZODA 4AY0A 4K07A 3WS3B 3T0EE 2VQ1A 3M17B 2JCCB 4LKXA 5JTWA 5MHSD 1Y0LA 5I1KL 5I8KL 4AM0B 5ICXB 2YD5A 5CP7B 1DCLA 3WLWD 4HQQL 3T0VA 3BKML 3JWDL 5E9DA 2GJZB 1BD2D 3QEHA 3O8XC 5FM5M 1D5XA 3IXTA 3P2TA 4M4RA 4N5EC 3STLA 5AZ2H 4OM0H 5DHVH 3O11A 5GGRY 4KQ3H 3I84A 1CBVL 5DK2B 5KJRH 3GSOA 3QHZH 5FM8A 4ZNCD 5IB3A 4GXUM 5TQ0L 4R3SA 3ZTNH 3MFFB 3NABH 4O2CA 4Z7UE 4IRJD 1G7PA 1W8OA 2IFFH 2FJHB 2R0KL 1ES0A 1HHIA 5EA0L 1X7QB 1IQWH 3TBTB 1G7HB 4R9HA 5IKCB 4QTHA 1KN2L 2LVEA 5A3ID 4PJ9B 3C60C 4PJAE 4H8WC 4HLJA 5LGJB 4F7MA 5CGMA 4KKAC 2F74A 4YHNB 1BOYA 4Y5VB 3V6ZB 3TPUA 5HDLA 1A6UH 3T09A 2P8MA 1ZGLB 1MPAH 5D70H 5FGCE 2AJXL 4CMHC 3MV7D 2FLBT 5D7KD 1MWAL 2E7MA 4K94L 2NY1B 3TT3L 1F8TH 1SYSB 4NO2B 1TJHL 4OCWL 5FIEA 1OP9A 5TDOA 2QTEA 3GMOB 3WFBL 1REIA 3ARGD 1NQBA 2DQGH 2E5EA 4TVPL 2VAJA 4EDXA 2V5SA 4G7YL 2Z4QB 4XPBH 1WZLA 4HJGB 3I3EA 3MLVH 1HH9A 4WW2A 1OT1A 4XT1C 4AEEA 4QHLA 1EZVY 2VAAB 1ZLVK 4YIQB 2IANB 1CF8H 4Z7OE 5DJ0B 5F7HA 3A0OA 4MAYC 3NPSB 3O2WL 3OKDB 3MLUH 4M7JH 4BZ1L 1OT2A 2YZ1A 4NQEA 3IXAA 3B2UC 2DMKA 1VHPA 5H2BB 1CN4A 1DVFA 1VGEL 3PP3H 4YDLB 2V9TA 4TUOA 1NBYA 1RK0B 3WN5A 4C4KT 1A47A 4XH2A 1SMAA 1MI5B 4TNVK 1Q1JH 4ZTOL 1ONQB 3ARFD 3MJ9L 4HKXA 4F7TA 1LE9B 5JW4R 3BPOC 3JUYA 4JG0L 2D7TL 1J10A 2VLJE 2H2PC 1C7SA 3QEUA 1DBML 4ZAKB 1NMBL 4KUCD 4QYOA 1GOHA 2EYTA 3WJLA 1UENA 1AO7B 4WDIB 1CT8B 4P3CL 3NCMA 3AAZA 4GUPB 4NN7C 3E0GA 4NRZA 1UXWA 2DM4A 4HMDA 1FFPB 1OQXA 2IPUG 2A0LC 4A6YH 3F12A 3QDJA 3GM0A 3WMSA 4X4ZA 4M03A 5CEXA 1T7WA 3T3PE 2YEZA 4JREC 5HGGS 3HN3A 3ARBA 2VDML 4C83B 1C5BL 2D03L 1JBJA 1JHLH 4DZBA 1NCAL 5E99L 2AI0L 4HF5L 4MX7B 1LEKB 3O6ML 2KZWA 3LKQB 5L8JB 3T4YB 5K9OA 2R56L 5JXAH 4UDTA 3VXQB 3PWJB 2QSVA 1RZJH 4F15C 1HYSC 3SDAD 1M71B 5MI0C 4U05A 3OKNB 1MCPL 5DHYB 3PUCA 4OCRH 3AS3A 2F54B 4LSDA 5KBNC 4UV7H 1CGYA 4O02H 1OTUD 3ZDYE 2CGRH 4OZHF 1FYTD 2VDPH 4LHQB 4N0FA 4JFDB 3IT8D 5ISZE 1BM3L 5LKNA 4JO2H 2R8SL 1X6LA 4Q58C 2F19H 1RUPH 3PQYB 4JDZA 5B39A 2AS5M 3DURA 5DVKA 5CSBA 2WIIB 4X4ME 5MEPB 4OFDA 4TRPH 2J3SA 3BDXA 4PFEA 5C07D 1OGAE 2AABH 3H3PL 5D2NA 1HKFA 3EO0A 1KPRA 1UG9A 4FP8L 1P5UA 3AU1A 3L9RB 5GRXG 5DD3L 4LRNL 2EZ0D 5I76B 5TDPB 1N0LA 4ONHB 1G9NC 3DPBA 1BFOB 5CS7A 1NDMA 1WC7A 1I7ZA 5D7LD 3MOAL 2F5BH 5DUBA 1MIMH 3BPNB 2P5WE 3E3QE 3WO3B 5CSZA 1E27A 1NGPL 1XF5B 3BYTA 3O8XA 1JWMA 1LO4L 3X3FL 5BO1H 3TWCH 5DI8A 4KTEL 3MLTA 4PS4L 2YBRB 3HI6L 4GG6F 1DFBL 3P9LA 5EU5A 1LK2B 4Z7VF 3L1OL 3U4AA 4WV1C 3EHBC 5CJBA 4NQCB 5CINH 3VFUA 4MLIA 1GSMA 3PIQA 5DVNA 5HHQB 1S78C 3FQTB 1NGYB 2XN9B 2FHBA 3MREA 4MNQD 3VGAB 3ARXA 4MCZB 4PJGF 3S36X 4OKVB 3C60A 1JHKH 5C70A 2X4PB 3T2OA 4X4YB 3IDJB 4Y4KC 1NAKH 4AENB 1BFVL 5AUMA 1MEXL 1TQCC 3VFNA 3P77B 3BQUD 5GS3A 5TGBB 4WU5A 4ZQKB 4MDJB 2EYRB 1I4FA 3IETB 2CRYA 4LQFL 5BOPA 5I1GL 4J3TA 2JCCF 5E1AA 1JGEB 4P4RA 3ROOB 3MOQA 1IGCH 4P48A 1QO3A 1YNTA 2VXVH 1MF2L 4LLMB 2YD6A 3CFBA 4OJFH 2AGJH 3G6JE 4HIXL 3UZEA 2C4XA 3RPKA 4X98B 2OQJB 4EI5B 4PRIE 1P7QB 3QPQD 5GGUB 1CG9A 5I18L 3HC3L 1CFTA 4AMKL 4NWUH 3U4EA 1A2YA 3DUUB 2BSRB 1N59A 3HB3D 2DTSA 1P6AB 2VLLA 4EKXA 1IAIL 4QGYA 5KW9H 3ZYIA 4WI8A 1KJVB 2E7LC 2B1HH 1SJEB 5E2WH 4B50A 3DROB 3O2DH 4MJ5A 5C0BB 4GO6B 2NY0D 3C2AL 3LRGA 3OHXA 4CUCA 3OGOE 5JOFA 1BZ7A 1FLRL 1R5IB 5AWNH 3QUZA 3WHXA 2OTWA 2FWOA 4PB9H 3TP4A 2FJFA 2CR3A 4ZSOB 1HSBB 3BUYA 4YFLI 5HY9B 3QYCA 5MENA 4NKQB 4CDGC 1LO3L 4LHUG 2Q8BL 3CPLA 1HOCB 1CFNA 2D31A 1S7WB 1P5VA 5DJ2B 3WJJA 3LN9A 1R3LA 1B0WA 3PWVB 3MRNA 3DETD 4XNUH 3UTOA 1MFEH 4M8QB 2NY5L 3SDYH 5IW6B 3SPVB 4AL8L 2BNRA 3DMMB 4Y2DA 3IVKB 4X0KB 4JFYA 4J7RA 1ND0B 1XH3B 3QA3B 4R4NC 4Z95L 5F8QC 3H9SD 2W59A 4X6DA 4FQ2H 1KEMH 5E6IC 3O2VH 3S88H 3IJYA 4HAGA 4Y16C 5H8DA 5TPWL 4WHTB 4ZXBD 2YPVL 4Z77B 5CIPB 3PHOA 1D9KB 4WHYH 3EGSB 4M93B 1WT5C 5IVXE 1OW0C 4FFVC 5F1KC 2VE6B 4PRHD 3P4NB 3QNZB 4ZPTB 3B5TA 1VEPA 4PUBH 3QRGH 1BJMA 3CVHL 2D7OA 4TSCL 4ZO7A 4QF1B 1QLRB 4XBGB 3VG0L 5IEHB 1EMTL 1A6VL 2P5EE 5F3HA 3THML 5I75B 2EDKA 4Q74A 4K2UL 1SY6H 2QQNH 1XGQB 1R3KA 5B8CA 3O0RL 4P4KC 3FO1B 2J8HA 2NTFB 5D6CA 4LSUH 5IFJB 2V2TA 4N0UB 4LPUA 4ONFL 4WHYG 2FATL 2H6PB 3AY4C 4F57H 5FUOH 5F6HI 2B1AH 5I2IA 5CD5C 2F53D 2IH1B 2WUBL 3PP3K 5A2KH 3MRLA 1BJ1H 4KTYA 5D7IB 3I6KB 5T5NF 3KLHC 2IPUK 3GSNB 5IBLD 1PZUB 3UJJH 5T33H 4WV1A 1A0QH 1U6AH 1X5YA 3QR2A 3BXNA 4HCRL 4BZ2L 5D1ZA 4KHXH 4YWGH 3KPRA 5J4MA 3JUZA 3QI9A 2YPKA 3WUWG 3IFOB 5JW4N 1AXTL 3H3KA 4PPTA 1LE5A 5LVEA 4K71C 4N1EA 3Q5TA 5CWSB 1NMCB 4OKDA 5HHOE 1TTUA 4YHOL 1EJ6A 1OAUH 4HUVA 5INCA 1A5FH 4C54A 1WQVT 4PV9B 3MRCB 3X11A 1VEMA 2R0LL 5E8OB 2AK4D 4S2SA 4IOFC 3F5WB 4U1SB 3RPIA 3V6OA 3SBWA 1S9VA 5I71C 4K8RL 4JFOB 5IVZB 4X6CE 4NCC1 2HJLB 4MXVE 1ZXQA 5GJTH 1KLGB 4X9HA 3BGFC 2JJTC 4P2OB 3RZCC 1UM5L 2R0WH 1U8JA 3WXVH 4GH7B 4I77L 2E8YA 1T4KA 4RQQB 4QHMB 3HG1D 4KQ4H 3SJVD 5IHBA 1BD2E 3P40A 3HLAA 4N8PA 4OZGB 1OAXL 3MJ8B 4XWOC 3QFJE 2X4SB 1W0YT 4RMTA 1JUFB 3QIUB 5C0GB 1KJMB 3O3BA 3KNBA 3SGJC 4OIIL 1UB6B 3GJEA 3EFDH 4S1DC 4JG1H 4GAJL 4PLJC 4PJEB 4WWKB 1DQJA 4XHJD 1ORSB 1LEGA 1WCQA 3TA3D 3PWLA 1KNOB 3L6FB 1L7IL 2OI9C 4YGVB 3TF7C 3FAWA 2MQCA 5DZNA 4QXUH 3UTSA 5JIPA 5LQBL 5T3XE 4RGNC 3CLFH 1XF1A 2MWCA 1JZ6A 1DBJH 5FKAB 3ZE2E 1HXYB 3VI3E 3MODL 2DBJA 2GW5A 3QCUH 3OQ3B 1Q9OA 4IMKC 5EU6D 5BJTA 1T80A 3C5JB 4CBPA 5HHXH 1CIUA 3BE1L 4M1DH 1LEIA 2JIXB 3GIZL 3O3DB 1QEWB 3BP7A 2HVKA 4JZOA 3DGCR 3EJJX 3O4LE 5E5MB 3KPOA 5HI5C 3EAKA 1QRND 1N3NB 5DO2D 1C5DA 4EOWL 2DTML 3Q6FA 4LF3B 3GGWB 4PP1C 1C5CL 1JF5A 2UWEB 4KHTL 4C57C 1SVCP 4X99B 4YHIB 2H8PB 3OG4B 1MWAB 2VXTL 2CUHA 4CAGA 1ZT7A 3BDBA 1NL0H 2XWTB 4HPYL 3RWEB 1C08A 1A6PA 4MWFA 5BS0D 4UIMA 4RMVA 4FXKA 2OZ4A 5DRXA 3U6RB 2E27H 4ZMAT 4ENED 5I1LA 1ETZB 3PP4H 5E6IA 1XR8A 2BC4A 3NN8A 3GSXA 4JFQA 4KPHH 5GZOD 3I85A 2V2XB 4XPAH 2PCPA 4NQUA 5HDBE 2R29H 1ACZA 2JTDA 5L2KD 4YXLL 1MLBA 4Q6YA 1BIHA 1JE6A 5E6ZA 2BMKA 3MLZH 1RZ7L 3LS4H 4LEXL 3MR9A 3VXUA 1U3HB 1I9JL 4BQ6A 4WNQA 1LO2L 4QO1A 1HIMH 5ICZA 1CFVH 4FQ1L 4G9DA 4HFWA 3LDBC 4EBQL 3K0WA 3DYOA 5GSVB 3VRLF 1CFBA 4JQXA 1UWEL 4WI6A 2O5ZH 4G6ML 4KMTH 5L8KB 5TFSL 5AYUL 4TTGA 4OCMC 3UBXA 1INQB 3T0EA 2VDQL 4QOKE 4FQLH 3T65B 3BHBA 2ZKHH 3LSOA 2A74A 2AEIT 2CO7B 3FFDA 4I8DA 2ZWLT 1OHQA 4JGUA 2XWBB 3T3MF 4ODHL 4ETQA 2EICA 4LFHG 3FFCA 5ESAB 4CMMA 4XVJH 2LE9A 4M7ZC 1PGRB 3P4LA 1TJIH 4HUUA 4HXAL 5IR1B 4HMCA 4LL9A 5JPNB 2I5YH 3IFNL 3I75B 4Z7UA 5A40E 1IGTB 3L3HA 4PR5B 4HIIA 3EJYC 3GEWB 2R9HD 1HINH 4KZDH 5FF6B 3GI9H 1UXSB 1FJ1A 3K74B 1OAYH 2ADIA 1DLFH 4P59H 5TE7L 3HMXA 1M05B 4XNYL 5ABDE 1AE6L 4D9QD 3EW3B 3S36L 5H94B 3KG5A 3LH2L 1EVUA 2PN5A 3ZYJA 4O2FA 3MXWL 5ACZB 4RFNC 4G8IB 3FB6A 3BWAB 4ELME 4LK4A 1U2CA 5DVMA 3RGVC 5FO8A 3QEGH 4N0RA 1UJTA 5C0IA 3RTQD 4ODVL 3MYJA 4UNTA 3MZGB 2YD3A 1EO7A 1WWWX 1KPVB 4W81A 2CMRL 4KRPC 5D7LE 2PETA 4P5KA 1BIIA 3GMQA 5D7IF 5B22A 3V52H 1RZKC 3WNKA 3NIDF 4HJ0C 5F6HJ 5D1QC 4HC1L 3U9PL 1F11A 3T77B 3P4OA 4P3WA 4GW4B 2JB6A 3VMOA 2EDYA 3MOBH 4NKDB 3V5HB 1XGPA 2EEAA 2VDOL 1F5WA 5C09E 4PJBB 3GDBA 4HKZB 1JGVL 2CJUH 2D7QA 1VESA 2R2EA 3HUJB 5JW3L 3QCVL 4HXBL 5K93A 4RRPA 2NLJA 5IJVB 2YRPA 9CGTA 4KJYB 1YPZB 1YEFH 2QKIB 2FCBA 2RFXB 2OMBA 1XF4A 2PTTA 3S37H 1YMMB 1KENH 2FZ3A 4RMQA 2DM2A 3S6CA 2VLJA 5HVWA 4WEBL 4POZD 4Z7NF 4NNXB 1I3UA 1DQDL 3EO9L 1J1XL 4KMLB 5JMRA 1DBAH 2HJKB 2PXYD 2DQEL 5ICYA 4P5TC 1NJ9B 1RUKH 5C0NC 3SKOB 4XX1G 4UAOC 4TVPE 1IKNC 1MCEA 5DD0H 2YXFA 2ARWA 3G04B 2RBLA 1RULH 3ZKQD 3GI8L 4BH7A 2ITCA 2Z31D 3REWA 4ELMF 4OZGF 4PJ5B 3DX9B 2ZG1A 3QIWB 2DQDH 2B8OT 4E5XB 4XCNB 4FMKA 4PJEF 4FTVD 3Q3GB 5IG7A 3RKPA 1HSAB 1A9EA 2PNDA 3TN0C 3DO7B 2DS4A 1P7KB 1CVSC 3VXTA 4G7VL 5SWSD 3CVIL 2QADC 2C9AA 5DR5L 3MBEC 4LKCA 4OCXL 2PYEB 5ADPL 3MNWB 4YGAB 5CZKA 3EOBB 3A67H 1L0QA 4JN2B 5DLML 2K9UA 3PWPE 3ZHLA 5BMFL 3MRQA 4Y2OA 3E2HB 3WO4B 4X4MA 5I15L 3SOBH 1KELH 4HJJH 2CH8A 4LAQL 3EFFB 1WZ1H 5HSFA 1OGAA 2DAVA 5FHBH 5FGSA 4PJ8C 2DMBA 1GGBH 3FT3B 2UWEF 3SDDB 1IBGH 2ZJSL 3MBXH 3L3IB 4OM0L 4AT6B 3VRJB 4X7FC 5E8DL 2HFFB 3ULVH 3RAJH 2AQ1A 3FRPG 1RUQH 4PGJA 1KIQB 4Y89A 2SEBB 1UM6H 3NABL 5IBTL 2RCSH 2IFFL 4FQIH 3VG9B 1IQWL 1P53A 2EEDA 4JRXE 1VFAB 4JFHE 4CVXB 3S96B 3B9KA 3H9SE 1S7UA 4PJ9D 4N8VG 4HSQA 5ILTH 1BQHB 1ZAGA 4U1IA 2H1PH 1RK1A 5J1AA 5HHNB 3K4DA 2CRIA 2CDFA 1ZWIA 4R7NA 3TFKD 2VQTA 1ZA6A 1E4WH 5LCVL 3CXHK 3BPCA 5E8NB 3QG6B 1ZLSL 4TTDC 4FNLH 4F58H 1SYVB 3D69B 1MCLA 2NY1D 3NH7L 1IGJA 5AZEH 2DLTA 3PGFH 1NAMA 3TYFB 4FZEH 4OGAC 5F3BB 4IRSB 1AXSA 5F7LB 3MLVL 5DJDB 2XG5A 2IAND 4O51A 2WBJA 1NFDE 1CF8L 3P9MB 1CQKA 2C3XA 3BH9A 3CK0H 1OAZL 5CHNA 3CVHB 1QBLL 5T5FL 4POYA 5D72L 2VABA 4PY7A 4G8GB 4ZYKA 3G6JA 4WTXA 3C6LB 1PY9A 3WLWC 1R5WA 5IEKA 3TCLA 3WD5H 3TJHC 3C8KB 3OXRA 1MI5D 2BY0A 4HGWA 4JAMA 3GSUB 5D1QA 4TNWK 1DLHB 1YMHA 2PKDA 1K2DB 1ZSDA 3EZ8A 4OLUL 5KOVC 4L4VA 1BX2B 2IJ0C 2VZTA 3LPWA 4IRJC 4ZAKD 4DUWA 4GKZA 1RMFH 2EDNA 4WGWB 5E2TH 5DJCB 1CFSB 3X13A 1AO7D 3PJSB 5HYFA 4LLQB 1KBGH 4S1SL 4JLRA 4L4TA 2YD8A 4OFPA 5A3IC 4JFEB 1CK0H 3Q6GH 3MYZA 3N1FC 3MRFA 2W65B 4JANB 2LFGA 4RAVA 3GMPB 1O7SA 4Y4FB 3G5XA 1VACB 3M1BA 1K4DB 1IGIL 5HGHB 2GT9B 4OF7A 2AK4E 4NDMB 1WZMA 1ZVSB 3D6GA 4JO1H 1GOGA 1JWUA 43C9B 1G6RL 1QSEB 1R0AH 2ZUXA 5SX5H 1PDKA 1BLNA 3FO0H 4MA1B 4LSQH 4TQEH 3ARGC 2GSGA 4FRWA 1KN4H 1RZJL 5HGBA 4KFZC 4QY8A 1PKOA 1D5ZA 5I73B 2YUVA 4OCRL 3CH1B 1PX3A 3ZDZE 5FUCC 1OL0A 2MNUA 1IFHL 2MCG1 5AAWA 4PJBF 1EEZB 2QQQA 4JFDD 5DMGC 1Q9KB 4HV8A 1F90L 1J0KA 3GK8L 4JO2L 5DDHA 2F19L 3PQYD 5FA3B 3EYSL 3DGGB 1YPZF 1QFOA 4TRPL 4NUJB 1JRHH 1MCKA 4OZFB 4HWEH 5I0DA 1HQ4B 2DQIH 3E6FA 3RDTB 3W0WA 1KULA 4KXZI 3NACL 3MJGX 1KTLB 5I1DB 3CC5B 2A6DB 3ARFC 5IVXA 1HH6B 5CKAA 2PW2A 1TTFA 4GW1B 5TF0A 4ETYA 1HDMB 4LP5A 2DMCA 3AFLA 5GQBA 3MRJA 3OKKB