1NCCH

Crystal structures of two mutant neuraminidase-antibody complexes with amino acid substitutions in the interface
Total Genus 40
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
40
sequence length
221
structure length
221
Chain Sequence
QIQLVQSGPELKKPGETVKISCKASGYTFTNYGMNWVKQAPGKGLKWMGWINTNTGEPTYGEEFKGRFAFSLETSASTANLQINNLKNEDTATFFCARGEDNFGSLSDYWGQGTTVTVSSAKTTAPSVYPLAPVCGDTTGSSVTLGCLVKGYFPEPVTLTWNSGSLSSGVHTFPAVLQSDLYTLSSSVTVTSSTWPSQSITCNVAHPASSTKVDKKIEPRG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase(o-glycosyl)
molecule keywords INFLUENZA A SUBTYPE N9 NEURAMINIDASE
publication title Crystal structures of two mutant neuraminidase-antibody complexes with amino acid substitutions in the interface.
pubmed doi rcsb
total genus 40
structure length 221
sequence length 221
ec nomenclature
pdb deposition date 1992-01-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
H PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1nccH01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1nccH02
5I1KL 1OB1A 5E9DB 1GGIL 4HX1A 1RQ5A 4LASL 1KLFA 1INDH 1IQWL 4R7DA 1MFBL 3L9RA 2AJYL 4N9GB 3CSYA 2NW3B 3MV9B 4ODVL 5I17A 3FMGL 3BPLB 3SOBL 1RHFA 1HHGB 4QF1A 3RWHB 4Q9RL 3X13B 3DMMD 1ZTXH 5ESAA 5H35A 3FN3A 3TLRA 1UCBH 1AO7B 3C9NA 3JBG7 4M7KL 5E08L 3SGEH 2AJ3A 3FOMA 4AIOA 1P53A 3VFVB 2K1MA 3BE1H 2FD6H 1AHWA 3SDDA 3L7EB 3BSZL 4X9HA 4OZHF 3OKMA 4P2CG 5C08B 5DFVD 5DJCB 4Q97A 4U4BA 3T0ED 5K9OB 4FXGB 2ZZUT 5D1ZA 1DEDA 4P3DB 3U6RB 1ZMYA 1HXYB 3VXUB 3BKCH 4IMLA 3UTSB 3C5SB 5B38G 5FYLH 1A7NH 5GRUH 5T3ZH 5GHWH 4RBPH 3FRPG 1ETZB 4WNQA 4GW4A 4GAJH 3ULUD 3G5ZB 4KK8D 1IKNA 2Y5TA 4NQEA 5J0BA 2X6MA 1J1XL 4KDWA 3ES6A 3O45B 4HFWA 3QUML 3LMJL 5C07B 4I48A 3O6LL 2UV3A 3MUZ1 3O2DA 4QRTB 3CVHL 2WWKT 1S7TB 5B3NA 1CTOA 2Q8AH 4PV8B 1JNNH 3O6KL 2JK5B 1HQ4A 2DQTL 3S36H 3BD3A 1A7QL 5JNYB 4N0CC 3DMMA 1IZKA 5CJXA 4BUHA 3HKFA 1REIA 1CLOL 4G6AD 3DO7A 5DJYB 4XVSH 1P7HL 3N06B 1RJZB 4P9HH 5ACZB 1K8DA 3IF1B 4HUNB 4EBQH 5HGBA 3T0EA 1H8NA 4PJHF 2AAVA 2VH5H 5C2BL 2UVFA 1GPOL 1JE6A 4HKJA 3TV3L 2CXKA 5FYKH 3NGBC 4KKBC 3S96B 1MCQA 1QACA 4WGVB 3BD4A 1KBGH 1MAJA 2ATPB 2XA3A 4NKDB 4RIRB 5F72S 3KPMA 4ELMF 1R3KA 1NMAL 2Q1EA 1P9MC 2A2QT 3ARDD 3V7AE 3DVFA 2NNAB 2Z31B 1IGIH 4C57C 4QY8A 2VR9A 3C6LC 2R69H 4QXUL 4G8GD 3MGOB 4ODWB 4CW1B 1ZGLP 3PWUB 1S8DA 4IJ3B 3HB3C 3DOSA 1J8KA 4ORZC 3TWCH 1FIEA 1MCPH 2OJEB 4YEEA 1R3IH 1RIHH 1JYNA 2XQBL 3STZB 4KJYB 2PCPB 3QDJB 4KWUA 2EO9A 1UEMA 2J6EH 3EHBD 3C08H 3D3VB 5AEAA 4I18A 5DI8B 1EGJH 3CLFL 1LE5B 1T5WB 2Q86A 1F5WA 2BJMH 1IM3B 2MHAB 5SWZA 2Z0BA 5GRVK 1VCAA 4XNUL 4JO1L 1S7WB 1UM6H 4EI6A 2X4OB 2HFFB 3EAKA 4EDXA 4HGWB 3OKKB 5EZIL 1MRFL 3FB5B 4ORGA 4PGZA 4R4BA 4YLQT 2QSCL 4EUPH 3AFLA 4FQIH 3L3KB 2D0GA 3I75B 2IGFH 3W11D 1K2DA 2X42A 5BZWB 2VQ1A 4GT7A 4F8TA 1C5BH 1X4XA 3FJTA 5E8NB 5I1IL 1MVFA 4WIQA 2PTTB 3VXQB 3SKUD 4X7SH 1EEZA 2DLHA 3KPSB 1MLBA 1JGUH 1PEWA 3NTCH 4XGZA 5DMYA 2BOBB 2AXJA 4G6FD 3C60B 3B9KB 2DQJL 2ADIB 4WI2A 3IJYA 4CN1A 2EKSA 2FB4H 1S78D 4JFZH 2Y07L 5INDA 1HHKA 3REVA 3OV6A 4LSUH 1X9QA 5I9QB 5EBMB 1KC5L 3HHRB 3HNTL 3U0WL 1JGEA 3QWOB 3PGFH 4G8EB 5C0AB 1RJYB 4GG8A 3RGVA 5EU3B 4PYHA 4PTTB 3L3GA 4H5SA 4OCWL 1I9IH 2FX7L 1TCMA 4U05A 5IROA 4E0RA 3SGJA 1AGBA 2R9HC 3HLAA 5DFVC 5FUOH 8CGTA 5D7KD 1HNFA 4KK9D 1D5MA 3BHBA 3FB7B 3GSOB 4ZPTA 1NFDA 2X4PB 5A3ID 2D03L 1U3HA 2HJKB 3ZTNL 4MJID 3NA4A 5DD6B 4U1MB 2BMKB 1YMMA 4OFPA 4BFGA 2QR0B 1DCLA 4J3OC 1KEMH 1JVKA 3UPRA 3CK0H 2UWEE 1L9MA 1UM4H 3UTTD 5DEFA 1G6RA 3D25B 1OGTB 2J88H 4GRLA 4ODSH 4P5MB 3D9AL 3ZYOA 4QT5A 3V5HB 5DK2B 2IMMA 3RPIA 3S9DB 3KWWA 3DIFB 4M4PA 1KTLA 1HN1A 2FX8H 3C8DA 5M7QA 1OGAA 4GRMA 4W81A 3QIUD 3T1FA 5IR1B 4X6CF 3T08A 1EVTC 1H15B 4KC3B 4P2QD 2B4CC 1KCUH 4K2UL 5MHSE 3B2UD 5CHNA 1Y0LB 1A9BA 5LQBH 5FO7B 3BPNC 2BVYA 4NSKA 1X5ZA 1TQCB 2ADJA 5H37H 4NKMB 4TSAH 2ESVD 1QSFE 3CSBA 1XT5A 1IC5L 3GSQB 3OKOA 1IEBB 3TIDB 5HVHC 1DFBH 1TLKA 3Q1SL 4WFHE 1MJUL 4RGNC 4L4VB 4XNQB 3V6OC 3KYKH 3O9WA 1NC2A 5C09B 3V8OA 3DVGB 5ID0B 1HXMA 2LQRA 1T03L 3X3FL 3DGGA 4PRDB 1SY6H 4ZQKA 4UIKL 3ARDC 2IFFL 3VXME 5LGHH 43CAB 3RI5K 3MRRA 4DGIH 1E28B 2BDNL 1H3GA 4QHKJ 4P4RB 3MFFA 3B9EA 3T0AA 4XAKE 1FZMA 3ZHKA 1H3PH 2HH0H 4H26B 4C83B 4DN4H 2P7TA 4Z78B 3RJQB 2J2ZA 2JELH 4RGOL 1JN6B 3MR9B 1G0DA 4OT1L 4WW2B 5EU6B 1FL6A 3H9ZA 5DUBA 4CVWA 4TRPL 4PY8J 5GGRA 1IGTA 2IAMB 4ZFFB 1C16B 4HPYH 3EHBC 4OZHE 1GGYA 3A6CH 5HHNA 1NLDH 2X89D 4P2QA 2BNQA 1EEYB 3K3QA 3SCMD 1CXLA 3H9HA 5HYQA 1AJ7H 1U8LA 3CZFB 4M5ZH 1INDL 4NOBA 1OD9A 4JY6A 3D85D 1CICC 3RVTD 3SJVD 2VRAA 1BOGA 2KZWA 3WEXA 4KGJA 2R4RL 3QIWB 1OAZH 5DRXB 4NQUA 1LEKB 5B38A 2MQCA 5F6HI 2CKBL 4OGXH 5DYOA 3AAZA 3FRPA 4NC1E 4ZNCD 4G7YH 2OR9H 2O61A 1FL3A 3EO0B 2IC2A 4DTGL 5JW5A 4MS8D 3QUZD 4PJ8A 1T6VN 5L2KB 1UCBL 1UH4A 3VXOB 4LNRA 2I9LB 1TDQA 4M93C 3LRSB 3P9WB 3BE1L 1GOFA 1L7TL 1ZAGA 4BSVA 3OQ3B 5D96B 3DARA 3UYRH 4FQQA 3LRGA 1MJJA 3WUZA 3T8XA 1KJ2A 4HWBL 4MB4A 4OD3L 3KXFA 4KMQA 4YIQA 4YDJB 2NY2C 3VFRA 3IDNA 3EYUL 3M17B 1AH1A 4Q6IB 3NCCB 3WFCL 3DUSB 4JO3L 5FYLE 1A7NL 5GRUL 1NBZB 2YUVA 3IDUA 4KKCD 4S0TD 1ZT1B 1A22B 4JCMA 1ZGLB 4HC1L 4GAJL 5D72L 1AC6A 4WJ5A 5IUSA 3QRFM 4PJHE 3S8WA 1S7UB 3SKJH 5LXGL 4JPIA 3SDCA 4MXQD 4PJBF 4Z0XA 3UMTA 4XPBL 3ULVD 1MIEH 3IJHB 5ISZA 1CXKA 2GTZB 4Y2DD 4FFYL 4P2OD 1QRNE 3V4PH 3VCLA 4ELME 1NPUA 4C56E 4GG6B 2WV3A 2CJUL 3RNKB 4WI5A 4JM2C 2WQRA 3OXSA 1R5VB 3S36L 3MZGB 5SWSB 5ITFA 2NYYD 2DMCA 4NUJA 1EJOH 3HC0B 5I1GH 2OTPA 4MD5A 4D0CB 1QR1B 3QIUC 3DXAA 4YX2H 4ODUA 5EN2A 2XXCB 1P6FA 1XIWB 1A7RH 1OSZA 4XVSL 4HBQA 3B2UC 2HKFL 3MLPA 1IC4H 4P9HL 1BD2B 4XVJH 1SJEB 4EBQL 3QXAB 3JTSA 5IVXB 5ICYB 3CFEA 4YFLI 3DHMA 5C0FA 2Z8SA 2VH5L 1DLHA 2APFA 3LN5B 2DBJA 4P4KA 1DE4B 3EFFA 4DKFL 4RMQA 2DLGA 1TNNA 3LKRB 1KN2L 1KBGL 1UJ3C 4ZUTB 4YK4B 1WVZA 2DQDH 3NN8A 4URTB 4DW2H 1INQA 4IHOA 4CVXA 2O5ZL 2P5WE 4CJ0A 3RZCC 5MERA 4OZGB 1YYMH 2XXMB 1F6AB 5E4EB 5SWQB 5I1LB 5FOJA 4HLZG 1WICA 2JE8A 2MJWA 2BRQA 1MCPL 3VFNB 1JV5A 1T1ZB 4P2OA 4DZ8B 2Q6WB 4N0UA 1KJVA 1R3IL 1RIHL 2AXFB 5D8JH 3OZ9H 1DUZB 1G0YR 1HSAA 1Q8MA 5DO2C 1GH7A 2A9ML 3OMZA 2J6EL 4Z7NF 3C08L 2IANB 4HJ0D 1EGJL 2R1WB 2YD7A 3VWJB 4KI5D 4PBXA 2BJML 3D0VA 2DQIH 3GJFH 4JHZA 4N8VB 1DEEA 4LCUA 3G5VA 1T0PB 3GHEL 5HJ3B 4QXTA 4CNIB 2RGSA 1UM6L 1KIPA 4Q9QH 4YBLC 2E9JA 3PG2A 4NFCA 3EJZD 3SDXF 4FQIL 3SCMC 2X4UB 4WFGD 5HDQL 1G9NC 2QV2A 2Q76A 3K2UH 1FP5A 4OQTH 4XH2A 2Z91B 3PJSA 5EA0L 4X7SL 5E99H 3RVTC 3NTCL 1JGUL 1U36A 1D5IH 4IRJC 3K4AA 2H26B 3JVGC 5FO9A 1OHQA 1E27A 3VGHA 4CMMA 1K6QH 1A6PA 3GMQB 1IC7H 4JFZL 4QRRE 4LLQB 1MAMH 4D94A 2IPUG 4LSUL 5FEBA 4MS8C 3QUZC 2C9AA 3PWJB 2H32H 3FT3A 4DGYL 2HRLA 3BISA 4F33A 1KLUA 3MFGB 3PGFL 1G7LA 1R3HB 3UTPD 5CBEA 5E5MB 1I9IL 4X6CE 4KDTA 4PP1D 1JGVL 1F97A 3UYPA 1KEGH 4X4YB 5FUOL 5CJQH 1U8NA 3QDGD 4KTEH 2XRAH 3K2MC 4NPYB 4U6HA 4ZD3L 5ID1B 2M26A 4NNPH 2BY0A 4TVPH 3M8OH 4FS0A 1UJTA 4OJFL 2B7DT 2WINA 3X3GL 4X7FC 1KXTB 1WQVT 3L1OH 3X11B 1FIGL 1I3RA 4JZNB 4KKCC 4H1LG 4HT1H 1UM4L 5BS0D 4NM4L 4C4KO 2J88L 4ODSL 3WBDA 1U8IA 5GS2H 3BO8B 4KRPD 4MXQC 2JB6B 3ULVC 2X4QB 2VLRD 4BZ1H 4JRYE 3HAEB 4Y2DC 4AQ1B 5MENE 1DVFC 4NIKB 2GUOB 3KYOB 4UBDC 2FX8L 2GJ6E 3V6FB 2V5TA 4PGCB 3P0YH 3HUJE 4JEGB 3G6JB 1JF6A 1XH3B 4QTIH 1ZLVH 3QG7L 3VGBA 5CINL 1KCUL 4Y5YA 4V1DE 2VXQL 4POUB 5I73B 3CDYA 3UJTH 4GLRI 3JV4B 4K94H 4HCRL 4PJ5E 5DJZA 2VISB 4NO2B 1M7DA 2GHWB 2JCCA 3C5ZD 1LNUA 3ALWA 1FVCA 4PD4J 4U31A 1X5XA 5C0CD 1KJMB 5IHLB 3I6LE 4ZOEA 3AREA 5DA4A 4ZUWA 5C0GB 3L5JA 3RVUC 3KYKL 2D7QA 1K4CB 1ZT4B 3RL2A 4LEXH 3F7VA 4Y5VC 4CN6A 5BZDB 3UC0H 5GGTA 3SBWC 4P3CH 1EPFA 5MP6H 2DN7A 2H8PB 43C9A 4OZIA 2JCCF 3N0PB 4OCXH 1ADQL 3EFDL 3BP4A 3REWB 1HH6A 5E8PB 3CC5B 1DDHA 5EOTB 3V0WH 2E27H 2W65B 3F8UB 3WD5H 2EDFA 1BBDL 3SKMB 4D0DB 4Z7UF 4NOFA 3EGSA 5J3HD 1H3PL 1S7XB 3MRPB 2P8LB 1T1YB 4BJLA 4HKXA 1FLRL 2AK4A 1DN0A 2JELL 3KPQA 5DJ0B 1MWAH 5J13C 1MCEA 4OLEA 3AVEA 1JYWA 4U1JB 2XICA 2EIBA 2FJFB 4JREB 5E6YA 3P30H 2Y36L 2P8PA 4OF0A 5D6DA 1D9KC 4JDZB 2FJHA 1A6AB 4HPYL 3N1MC 4HJ0C 2HG5B 2XZQL 4KI5C 3RWGA 3VGGA 4OKVA 2P8MB 1KIUA 4J1UB 5HI3D 1T1XA 2DOCA 3T2NH 5CJOH 3P9MA 1QVOB 2B0SH 5J8OA 2VLKA 3U79A 4OV5A 1QO3A 4JKMA 1Q72H 5GRVL 2AXHA 3RX7A 1F42A 4X6FB 4PLNC 3C5ZA 4EIGB 4WTWA 2BVUA 5FUCC 4MNQA 4BZYA 3GSNA 3OAYK 1AXSB 4XC3H 3O2VL 4UINH 4OGXL 3PGCA 1U8HB 3QCUL 4LF3B 4FQPA 4JFXA 5KVDH 5CIPH 3QA3B 4G7YL 2OR9L 4R4ND 3BPNB 4OF3A 5DD0H 1ZEAH 4PJBE 4PJFB 3HI5H 2DICA 1RUQH 1NCWH 1BF2A 1RU9H 3S37H 1TPXC 1LK3H 3KYMB 4RMUA 4GQ9H 3LKQB 5JO5A 5CP3A 2FIKA 1AFVH 5IVZB 2PXYD 2ZPKL 5IMLB 3RDTC 3NPSC 1IARB 4Z7VB 4X8JA 3U36B 3HS0A 4YUEL 1EVUA 4B0MM 2D0FA 5HY9A 3FTGB 5I1EH 2RHEA 2DWDA 3ESUF 3RVWD 4H20L 4Z6AT 4IS6B 2BNUB 1OTTC 5KS9B 4HFUH 4R97B 4R0LC 3QWRD 1HIMH 3BIBX 5FM5O 2VXVL 1OAYH 3LSOB 1ZWIB 4NCC2 4P46A 3UZQA 1T83A 3G5XB 4YFLF 1YEEL 2ZUYA 2P24B 3SKJL 1EK3A 2R2EB 4PLKD 5F9OH 1MIEL 1FNGA 1T21B 4ERSH 5I2IA 2AJXH 3MNWA 2QSVA 1N4XH 5F1KC 3ZE0F 3FQUB 4KRPC 2ATKB 4ELKB 3NIDF 3PF2A 3L3DA 2NPLX 4YDVB 4DKEH 1AQDA 1JI1A 4XPFL 4JHBA 1DQML 5L2JA 3H2WA 1E6JL 3MLWH 1CFTA 1CICB 2AK1H 4AIZA 2ZWLT 4PJXF 1O7SA 1I9EA 3KHOA 4JKPH 5I74C 1G7QB 1YEFL 4HBCH 1HINL 4MWFA 1RHHB 1X6NA 3QNXA 4P5TB 3KPTA 5CEXB 1F45A 1L4IA 1WK0A 4YDIH 3PWNA 1BQHG 4HUVB 5SX4I 1H3XA 1SMOA 3VMNA 4PRNA 3IYLW 5FFLA 1S7VA 3Q6FA 4M93B 4ONGL 1F4XH 2B8OT 3MLTA 4XZUA 2W9DH 3ARBB 3SDXE 4PJEF 2BOCB 4JZJA 2ICEA 4S1DC 4MJ6A 4H0IA 1I7TB 1TZGL 1YYML 3D39E 3HR5A 2OP4H 2UZXB 4JPVL 3E0GA 2CIIA 4MJ2A 1LQSR 4O9HH 1FRGL 5A2LH 4YDLC 3L5XL 4MHHG 3SGDH 4F3FB 4FTVA 2HFTA 1HDMA 5F88B 3WL9A 1IL1A 5HYFA 5D8JL 4S0SD 2DLFH 1RIVH 2VDKH 3MRKB 3BXNB 2WBJC 4EDWL 5EBLA 3NCYP 1U92B 3QI9B 4I2XB 5DD1L 4BQBA 3TBVA 1QSED 2YUZA 2YWZA 3O6FA 1URLA 2H6PA 4ZUSB 5HGGS 5LGKA 1PG7L 4Q9QL 3RUGB 5C71A 4XC1L 1RZKC 4CVZB 5I8OH 1OY3B 1TMCB 1ZE3C 3BPCB 1SYVA 4IIQB 4NBXB 4AMKH 5IB3B 4X7EC 3WFDH 4ZTOH 4GLRH 2MNUA 1RZ8A 4XNMB 5GJSH 5I18H 4OQTL 1RUPH 3V4VH 5I66A 4NZUH 1I3VA 2NX5B 3VFPA 2MPAH 3DX8A 3PWLB 3W39A 2FGWH 4GS7B 3UTQA 2ED7A 4EQ3A 3V5DA 4I0PC 1P2CB 3FN0H 5HHXH 3X14A 1K6QL 1MRCL 2WUCL 2X1WL 3LRHA 4WU7A 4ZFGL 1DQQA 2DMBA 4YO0B 2XWTA 2EH7H 1MAML 2X7LA 4H25B 5I16A 1HH9A 4NJAH 1RZ7H 3H0TA 5J1SC 2Q20A 2YD9A 1MCOH 3BZDA 4KK5D 5DA0B 5LJYH 4PBWD 3O4LA 5HHOE 3H42L 4K7PL 2PXYC 3NMEA 3WJLA 1UJ3B 1EX0A 4JFEB 4EVNB 3DTXA 4Z8FH 3T0DA 5MHSD 4F7CA 5BRZE 4PJGA 3RZCB 4J4PD 4KTEL 3F65A 1LVEA 1E4KA 5E6ID 1N8ZA 2VL5A 4IOFC 3ARGD 3RVWC 4OCYL 4W6WB 1EFXA 4NNPL 2VLJB 3E6FB 1QSEA 1QSFD 1KT2A 4P3WA 2JJSA 4EUPG 3O11B 4QRUA 4WFHD 4NBZB 3P11L 1XAUA 4Y8DC 2D7NA 3PQYE 2AXGA 5HHME 1A6WH 5EC2B 3VJ6A 1FG2B 1WC7B 1CYGA 3WIIH 3VFUA 4MNHB 4GKZB 1MCFA 3NFNA 4BZ1L 4HIHB 3VXMD 5D4QA 1EXUA 1PGRB 4RWHA 4QYOB 1GZPA 2BSSA 3QUXB 2VDNL 3D1MC 3AY4A 4XAKD 2BRRH 5T5FL 4ZO9A 4QTIL 1AP2A 4MDJB 2VAAA 4Z7UE 4Y16A 4XTRC 5IK3A 4UAOC 3WNOA 5ALBH 5E70A 1IE5A 4TULH 4IRJB 3SKOA 1HHIB 4OSUH 4PJ9A 5FCUL 1EO5A 1PKQB 3HI1B 3ILPA 3ELAT 1V7NL 3LQAC 4HWEH 1QLEH 1FGNH 2HVJB 5TDOA 1EHLH 4PRIB 3QBTB 5DZNA 4X6DA 4W6YB 3MBEA 4J4PA 5CEYB 4ZNEE 1JFQL 3VXRA 4LEXL 5EFIB 3ARGA 3UC0L 2X4TB 4H0GA 3WO4C 4XWGL 1XGTB 2ICCA 1K5NB 4P3CL 5MP6L 5D7IF 5D7LB 3EOYG 2XWJB 4DQOH 4OCXL 3FT2B 5JUEH 4WO4C 4AG4L 1KIQB 1NFIB 5T1KB 2D9CA 4L8BB 3V0WL 4MA8L 3I3DA 3WD5L 3BJ91 4G43A 2AEIT 2UVEA 4TUJA 4APQD 3WIFB 3F7YA 3FQNA 3CU1A 4LIQH 3BKML 5F6IC 1A1OA 5KOVC 1Q1JH 1U0QA 2JJTC 4Q2ZA 1MWAL 5IQ9B 3VXMA 2OMBA 5KSBA 1IKFH 1NMCC 4PTUA 1D3CA 4AM0B 5HHQB 5KSAC 1YEHH 4OZ4A 2DM2A 1A02N 1J0YA 2YD1A 4FHBD 4V2CB 1MVUA 1ZVHA 2ZG2A 3MX0A 4ODXA 2Y23A 2B0SL 4M8VA 2GSIA 5ENWB 4NWTL 3P0GB 5H37G 4ZTPH 1Q72L 3OPZH 4OGAC 4ZXBD 4S2SA 1F11A 2F54B 3VFSA 5F7HA 3ZYJA 5FYLD 5C9KA 4KVNH 3IAGC 4YHLH 4ONFH 4CADB 5T1DH 5HYJB 3G6AB 5SX4H 3W9DA 5EZJB 2YEZA 3HMXA 4BFEA 5FK9A 3U4BH 4F58L 4BA8A 3T3PF 4BFIA 1GGTA 5I15H 5DD0L 3WDHA 1VFBB 5CP7A 3HI5L 5JMOC 2YXMA 2CRIA 1RUQL 1NCWL 1QRND 3QEQE 2YS4A 1RU9L 2XN9E 4C56D 1P69B 3L95B 1UXWA 5F21B 4GQ9L 3NZ8A 1MUJB 3D0LA 3MXWH 5CMAB 2I9TA 3ZE0E 2DB8A 2CLVA 4O4YH 2A6DB 3BT2H 2ZSVB 1KCLA 3NIDE 2GK0A 1BWWA 2BNRA 5E8EB 4KK5C 5GRXG 2YPKB 1PBYA 1RUMH 5I1EL 1WZMA 3MV7B 1Z5LA 3FO1A 1YDPA 6CGTA 4PJXE 5FF6A 4M5YH 1ZK9A 3BI9X 4TUKL 1JK8A 1HIML 3T4AA 3GSRB 4IOIB 3MROA 5GJTL 3DJ9A 3UCRA 1OAYL 4N0FB 3E2HC 1A2YB 1HNGA 5F7YC 2ZSWB 1BQHA 1JPFB 5J13B 4ZXBA 4FQXC 3NCBB 4PJEE 1FZJA 2OSLA 2XKSA 4ERSL 5DMIH 5HPMA 5IFAH 5KW9H 2AJXL 4C55A 5HHPA 4FXLA 1NJ9A 2P5WD 3NCMA 1BIHA 3DYMA 1UB5B 2CDEB 4G6ML 4RMWA 1ZHBB 4NQDB 1EHAA 5ITBH 3SO5A 5MI0C 1A0QL 2A77L 3CH1A 4BK4A 4DKEL 1AGEB 1AGFA 1RURH 1HKLH 5GS1B 2D31B 3MLWL 4OF8A 5I76B 5EUOA 4ZO7A 4O2CB 2VZOA 5FECB 3VDCA 1J5OH 1KTKE 5GGVL 1WAAA 3HFMH 4HBCL 5DMKA 1FO0B 5C0IA 4TNWK 3RKPA 1UADC 3U0PB 5FGBA 3PL6C 1XGRA 4M8QB 5CSGA 4YDIL 4EI5D 2HT4D 3V6ZA 3VGEA 1G7PA 2FATL 4PY7B 4X83A 4D9LH 4U6XB 5EUOF 4IDJL 3MRBA 4JY4A 1F4XL 5FGCE 5IG7B 5D70L 4WU5B 3U46B 1WAAF 4YXLH 1LE9B 3U1SH 3MNVA 3VE0A 2JIXD 1QLRB 1VB9A 1C5CH 3MBXH 5EB9A 1FZOB 1MCDA 3PHQA 2FHBA 5EWIL 2FIRT 4GUPB 4U0RB 4YR6B 2W9LA 3SDDC 1CVSC 4L1DA 4XCYA 4O02H 3ET9F 5D5MA 3WFEH 1CK0H 4X99A 1RZGB 3QFJB 4QRRD 5DHXB 4JDVA 1RIVL 5D1ZC 1IILE 4APQC 3FQXA 4GW1B 4WHCA 2UYLB 2XQYG 3QIBA 4M1DH 2EE6A 4CU8A 5DZOA 1WF5A 3EOTH 4PJDA 3C8HA 3NFSH 4RDQG 1AGCA 2CR3A 5IP4A 4MSWB 1WZLA 3ZKSD 3O6ML 3ARYA 4NO3B 1IKNC 4IRSB 2OQJA 1MFEH 2OS7A 3BFOA 1L0XA 1F58L 4U3XA 1EGJA 2PW1A 3MNZA 5D2LE 1KPVA 4H0HB 3WFDL 3N1QC 4DUWA 4ZTOL 4P2RE 2JB5H 5I18L 2EO1A 4JB9H 2DJSA 5CBAA 3TBSB 4ISVA 5E2WH 5GS0H 1MF2H 4OCMC 2G2RA 2FGWL 3CNKA 4NM8L 1FYTA 3FN0L 5HHXL 5JPNB 1SBSH 2CQVA 4JRXB 4S1RH 4E42A 2BCKB 4YHPB 3TPUA 2AQ3A 1YYLL 2EH7L 1EFQA 4GBXD 3OJVC 4P23A 4LKXA 4JRYD 2ZNXA 3BP6B 4PLJD 5MEND 3HN3A 1RUKH 4Y5XB 3VD5A 1LDSA 2GJ6D 4M48L 3TBYB 5D93C 1J8HD 4UT9L 4GFTB 3WIHL 3EJJX 1QBMH 3HG1E 1HWGB 2AGJH 2PO6B 4HUXA 4I77H 4M03A 4JFOB 2WUBH 4D3CH 4QHNA 4DJMA 3DPBA 2CIKA 2LFGA 4W4OA 4MMZC 4V1DD 1JL8A 4R8WH 2HMIC 4O2FB 1WZKA 4PJ5D 3MCG1 1FBIH 4F7PA 4XP5H 3D6GA 4F2MA 2QHRL 5LGJA 4YDLB 2AI0H 1WIPA 1WCBB 4M3KB 1CBVH 4XNXH 3I6LD 3LS4L 3MLZH 3LKPB 2XNAA 3L3JB 3UJIH 5GISH 3BDXA 4YHKH 2V2TA 2WBJB 5F89B 1EAPA 5E1AB 3MGTB 4U1IA 2XQYK 3VG9B 3FFCD 5GSVA 3MV8E 3R4DA 5DMGD 3GGWA 4YHYB 5EBWB 2W9EL 5D1QB 3RWIB 1N6VA 5D7IE 2J3SA 2EICA 1BBJA 5C0RH 4TNVK 4GAFB 2VLLB 2AABH 4J8RB 1G7IA 1A1NB 1JYXA 1MCHA 4BKLB 1XR9B 5E94A 1W8NA 1NMBL 4K8RL 4C4KT 3BP7A 2BRRL 1QP1A 2Y7QB 4ZUVB 1W72A 4UTAH 3IRPX 4CN4A 4JFFB 1YUHB 4GBXA 4P9ML 4FMKA 3BGMA 4QOKE 3ZT6A 5KN5A 1V7ML 4YBQD 4CAGA 1I8MA 3N85H 4TULL 2GJ6A 2NXYB 1J8HA 3BJLA 4EXPX 2C4XA 3HUJA 3CFBB 1FLTX 2ADGA 4I5BA 5HGDB 3SQOH 1JTPA 4I3RH 2EDDA 3RTQD 4EJ1C 1YECH 3TJHD 4H88H 2RFXA 1FGNL 2DQFB 4FP8L 5JHDE 3EDKA 4V1DA 5DHVB 3KPPB 3IDJB 1MI5B 2CO7B 4PJ5A 3IFOA 3MJGX 4NWUL 1A47A 5T5NF 4MA7L 4MQXC 5INCA 1G7MB 3H3KA 4JHWH 1AGDB 5DRZB 1A14H 2F53A 4HF5L 5DT1H 5EO9A 3NABH 1I8IB 1I1RA 4QWWC 5E2TH 2N7BA 1RK0A 3RGVC 3MREB 3LV3B 1WBYA 5L8KB 3T3PE 1BLNB 3FFCA 1F90H 5T3XL 5T3XE 4LIQL 4MAUL 5E9DE 4LIQE 4QLRA 1MHHB 4BQ8A 3T0WA 4MNGA 1Q1JL 4QRPD 3S5LG 2Z8RA 4LCWD 1SY6A 4YDKL 5B39B 1MCWM 2GJZA 1RVFH 2VB5A 4HS3B 1U3HC 3MV9E 4S11A 4BQ9A 1VDGA 4LCCC 3HI6H 4U3CA 2E9WA 3EOBB 4OV6F 1ACYH 1TCRA 3JTTB 4P0DA 3T3MF 4JPKL 4ZTPL 5D9SA 3OPZL 4GKSA 4LQ1A 1QKZL 2C4FT 4GRLC 3WHE0 1AO7E 2IBZY 3C8KB 2X4SA 4BELD 5I8EA 1WFOA 4ZAKC 2V9QA 4K3DH 4WW2F 5IBUB 4YHLL 1KPUA 2XI9A 4PJCA 2KUTA 4ONFL 1KB5H 3FQTB 3GSXB 5EU7E 3U7YL 3U4BL 4UAOB 5IEHA 3KYNA 5C08E 2DLIA 2JJVA 1VFAB 3LVEA 4KMTH 3IFPB 4WHTB 1F13A 3QZWG 2ICWJ 3VFWA 4GOSA 2NY6D 4LVHC 1A4KB 3UXFA 3MXWL 5I8CB 1KLGB 3VXUE 3BIKA 5KSVB 3B5HA 3UTSE 3BT2L 2XZCL 4NP4H 4HV8B 2BY2A 1KB9K 4PLJC 1JZ6A 1QRKA 2EE2A 5F1OB 3TVMA 4YHOH 3WO4B 5MEOA 1RUML 5FA4B 5DD5H 4O2EB 3W0WB 5I1DA 3AS0A 4QRPA 5A16A 4G8IB 4LCWA 4DUXA 3O9WC 1OCWL 4R2GC 3OJDA 5C07E 1HHJA 1CT8B 4U1GB 5C0DA 1CFSB 1OWWA 4N5ED 1M1SA 3QT2A 4DUVA 2EE3A 3ARFD 4N9OB 1Z9LA 1T0NA 1T4KB 5KVEH 1LP9B 1XF1A 4U2YA 1KN4H 1DSFH 2RR3A 4DOHB 1KUMA 5KSAB 4JJ5B 4UQ3B 1LEGB 1JWUB 5DMIL 1QEWB 2AV7B 4Y4HA 5IFAL 5KW9L 4YHNA 3Q6GH 4JQIH 3CFDB 1UWGH 1N64H 3D39D 2NLJB 4OD2A 5E2UL 5ITBL 5E95B 1U3JA 1Q9KA 4YGVB 1JHTA 1W0VB 1RURL 4YPJA 1OVZA 1S7RA 2LAGB 3BGFC 3TGXA 3JWDC 2FZ3A 1R3JB 1U95A 3CXDL 5KAQG 1KF9B 1ZA6A 1J5OL 1RULH 4ETYA 3HFML 1WITA 1FN4B 1LDPH 2PN5A 4U2ZA 4LRNH 4NNXB 5JLZB 4RAUB 1NCBL 4N1CA 3HE6B 1L6ZA 3LPFA 3OKLA 4HIXL 3T2PA 2AJSH 4PR5A 3TBTB 4D9LL 3RTQC 3CFKB 5IIEA 1OWRM 4F80A 5I1JL 1X7QA 2G75B 3FQRA 4LBEB 4PRAB 4P57A 4YXLL 5T33L 3LIZH 1U8JA 3U1SL 1BM3L 4OFVA 5EC1B 2O5XL 3QDJE 4WCYH 3FFDB 3D3VE 2BVOA 1X3DA 3IGAA 4TSBH 2R56H 1P5VA 5IVXF 4O02L 2F8VA 4TNVF 2OTWB 2NY3D 1AXTH 2ITCA 5I30H 4F9PC 5D7JD 4NUGH 4PJIA 3IKCB 2EH8L 2FECI 2A38A 2BK8A 2H41A 3D39A 3MRMA 1F02I 1F4YL 4XT1C 1JTTA 3QCTH 4RX4D 1NBYA 4L3CA 1MH5B 5HHOD 4OLZH 4OLYH 3M1BB 1C12B 4OZGF 2JJWA 3CUPB 5BRZD 1U2HA 5DJ2B 2VWEE 2DQCL 1F2XK 2OL3B 3PWPA 5EIIA 3SDCC 4PYGA 5IKCB 1A9EA 5F8RC 4MX7A 1CL7I 1R3LB 2JB5L 2E9IA 1DQJB 2IBZX 4HK0A 4JB9L 4MA1C 3SE8H 4OKDA 5GS0L 1MF2L 1OB1B 1ROWA 1X5GA 2HLAA 1WGOA 3BQUA 3PQYD 5C0AE 4HX1B 1SBSL 3NH7H 5HHMD 1IBGH 4Y4KD 4E5XA 1DN2A 4R7DB 5IW6A 3L9RB 3CSYB 4RFNC 5I17B 2R39A 2YPVH 4WEMB 4GAGL 4I4WA 3EO9H 5DVNA 1X5IA 4QF1B 4TOYH 1F6LL 2HN7A 1CE6B 4HJGA 3OB0K 35C8H 4I77L 3GO1H 3E3QE 5ESAB 3OB8A 3KLAA 4OFYD 5H35B 3SGKA 4D3CL 4PG9B 3C9NB 1FNFA 1S9XA 2FEEI 4KROB 4R8WL 2AJ3B 4I0KA 4JHAH 5L9DL 2ZG3A 2H32A 3C5JA 3FOMB 3VW3H 2LV4A 3C2AH 1T7VA 3JZ7A 1AHWB 4QXGL 7CGTA 2D3VA 1PX4A 3SDDB 1NGQH 3GIVA 4RGMB 3OKMB 4K3JH 4D0BA 3HAEH 1A7OL 1JPSH 4PJ7A 1CBVL 3MLZL 4HZLA 3MRFA 5GISL 5D1ZB 3CZJA 1ND0A 3CDGA 4IMLB 3WXWH 5FA3A 32C2A 5C0RL 4WNQB 4GW4B 2BHYA 1KNOA 1N5AA 2Y5TB 2DL2A 4NQEB 2LE9A 3ES6B 1HKFA 2HFGH 4HFWB 3KAAA 3KPRA 5BW7A 4I48B 3VG0H 1GIGH 2ZUXA 4E9LA 1E4JA 4L4VE 5C09E 1A6ZA 2I5YL 4DKAA 3GKWL 3S5LA 1WIUA 3V0AC 2R4SL 2D7PA 1BZ7A 4XCNA 1LHZA 4BQCA 1HQ4B 4LDEB 1CFQA 3OKNA 3SQOL 3SE4C 2R0ZL 3FL7A 3DMMB 5C3LD 4H88L 3V4UH 4RZCA 2RJMA 5GGRY 3UZEA 5IB5A 3G6JF 1P1ZA 3DO7B 3T3ME 4XAWH 4ENED 1LMKA 5DJ6A 1K8DB 3O4OC 3S34H 3GJEA 2UUDK 5C8JA 1VEPA 4X9FA 3T0EB 4RWYH 5EU6E 4WUUD 5DT1L 5DQDL 3RWFA 4HKJB 1DBAL 1WFNA 4HJJL 4PJAA 5I71C 4HXAL 2X4NA 3GI9L 1F90L 5K9JH 4KDTC 1IM9D 3KPMB 1ZKAA 1KXVC 3QEQD 1R3KB 5D6CB 2XN9D 1MHCA 4HD9A 2H2SD 2NY3C 3EJYD 5D7JC 2OJZL 3QZWA 3KLDA 4QY8B 4BK5A 1H5BA 3JWNC 3PP4L 1CLCA 3GMRA 1S8DB 1YEIH 2B4CH 4XWOD 3HI6L 1DQLL 2OXHA 1ACYL 3FN9A 3QEHA 3GRWH 4DK6A 3S3JA 2YD8A 4I18B 1MFNA 2XKNA 2Q86B 4F9LC 5L2KE 3VXNA 3P4NA 5SWZB 4WWKA 3TFKD 4EI6B 1Q0YH 4EDXB 2CH8A 3MOAH 5FKAA 5ABDE 4ORGB 4HAGA 4R4BB 1EIBA 2GFBA 1EJ6A 2HFEA 1K2DB 4KMTL 5AUMA 4XVUD 2VQ1B 1JCKA 1IGCH 4XPTH 5B3JF 1QR4A 2BSRA 2NTFA 3PNWA 4UOW1 4Y5YC 4Y4KC 5JDJA 4JFDA 1FNLA 1EEZB 4QHUA 4XGZB 1B9ZA 1JNJA 4WUUA 3X17A 3INUL 1J0KA 5CIPA 4NP4L 3HNSH 2XA8L 3WYRA 4LSSH 4NBYB 1IQDA 5EZOL 3IJYB 4GSDH 4YHOL 5GRJL 4JDTL 2EKSB 2IQ9L 5KTEH 1P7QD 1IM9A 1IAKA 2PUQT 3AREC 1HHKB 3QRGL 5INDB 3WN5C 3IXAA 3REVB 1BVKA 1FJ1A 2DRUA 2QADD 1DBKL 4PJFF 3KJ6H 2YKLL 1JGEB 2XTJD 3QB7C 1B4RA 1Z9MA 4PFEA 5JW4M 4N0YL 3FRUB 3I6KA 3RGVB 1PLGL 4GG8B 2D4FA 4GG6E 3L3GB 4H5SB 4BZ2H 3HNVH 4XCEA 5K9QI 1NEZG 4E0RB 3S7GA 1FC1A 4EN3D 1W0WA 1AGBB 3HLAB 3S88H 1I85A 1CGTA 4Z7VF 2C5DC 4FFWD 5SWSE 3BGAA 1CD1A 4X4XA 4NDMA 1GCFA 2AJUH 1DSFL 1D5MB 3BHBB 4ZPTB 5ESQA 1NFDB 3ZE1F 1D5ZA 1U3HB 5LCVL 4EEEA 1AIFA 4OM0L 5KS9F 4TTDD 1OLLA 1N64L 1YMMB 3D2UA 5IGXH 1PZ5A 1BD2E 3UPRB 5D6DC 5ILTH 2DMKA 4MJ5A 5IVXE 5DEFB 3QR2A 1G6RB 2G60H 4GRLB 5EDXA 2NY4D 4QT5B 4Y4FD 2K3TA 1RULL 3OKEA 3RPIB 1S9WA 3TJEH 5JORA 3KWWB 1JPTH 1LDPL 1FAIL 1KTLB 2DM7A 2YBRA 4LRNL 1OGAB 4GRMB 1EV2E 3T1FB 4OZGE 3OGOE 1JNLH 2AJSL 1UH2A 5KSUA 1K9TA 3F62A 3CLEH 5CHNB 4X6BA 2HT2C 1A9BB 2HT3D 2AJZB 4NSKB 2FX9L 1N7MH 3LIZL 2ADJB 1N3NA 4OLXH 4KQ3L 5JMRA 4RAVA 4DVRH 3OKOB 3LEXA 2ADFH 4WCYL 1T66C 4Y89A 2WZPD 3QCVL 2IANE 2DIJA 1IGJB 1YNTA 4LOUC 1K4DA 4NKIH 5EU5A 1FAKT 3O9WB 4TSBL 2R56L 1NC2B 4PP2A 4R2GB 4OUOA 5CZVH 1HXMB 5BMFL 3MUJA 5DURD 5DJXA 3B5GA 5I1HH 3DGGB 4RFOH 1CIDA 1A6UH 5AZEH 4ZQKB 4G9FE 2NQCA 4JFPA 3F6IA 3MRRB 1QLFA 2ED8A 3QCTL 5C1MB 1WWBX 2F9BT 4UV4H 3WSQH 3MFFB 2J5LC 1FZMB 3FHAA 2P42B 4J3UA 2V5YA 3RVVD 5IB1A 2AEPL 1YNLH 4P46C 2P7TB 4LRIC 2APWA 4PGEA 2A83A 1FCGA 1FL6B 3HMWH 4Y19A 5DUBB 3LKOA 3GMNA 2RAMA 1FGVH 2PR4L 5EUKB 5GGRB 1IGTB 3WDJA 3TA3D 5BXFA 3K8LA 5HHNB 1MFDH 1TVHA 3DYPA 5TDNA 4P2QB 3SE8L 2BNQB 4U6TA 4XMLH 1INEH 3H9HB 1T2JA 2DJ4A 5HYQB 1E4XI 4G6KL 5HI5C 1NCAL 1U8LB 3O8XD 3NH7L 4CDGC 2W92A 3HE7D 3MV8D 3RUGF 1BOGB 3IDXL 5FV2A 3WEXB 5A2FA 3KNBA 2YPVL 2VERN 5B38B 3GNMH 5DYOB 2ITDA 4TOYL 2VO5A 3AAZB 1N6QL 2O5YH 6FABH 3B2VL 2O61B 4K8RD 1FL3B 1CDJA 2XOTA 2ZCLH 35C8L 4L8CA 5JW5B 3FO9A 4PJ8B 3BWUC 4XPGH 4GRWH 4LNRB 3I9GH 1HHHA 4QOKD 3FONA 4HIIA 3C09B 3UZVB 4XXCC 3PV6A 4MAYD 4XBPA 2EDYA 5EU4A 3MJ6A 4BSVB 4FQQB 5HDOA 1MJJB 4K3JL 3ESVF 4PIRF 1G0XA 3LN4A 3T8XB 1KJ2B 1B6UA 3U2SA 3KXFB 4YIQB 5JHDD 3VFRB 5BVPL 3IDNB 1OTUD 2IPTH 4L4TA 3MRLA 3IU4H 3G6JE 3B9VA 1G9NH 5JZ7C 4EN3C 3WXWL 2P45B 3SDAD 1AQKH 1NKOA 4PGDA 2MWCA 2R0WH 5IVOA 1KIRA 1KELH 4I3SH 4EKXA 4WJ5B 1OOAA 1UXSA 4U1LA 3LH2H 3O8XA 1BVLA 1FNEB 4JPIB 3SDCB 3JV6A 4Z0XB 1MIMH 3O6FC 2DQUL 3VG0L 3MV8A 5ISZB 2CO6B 5EORL 1WTLA 3VCLB 1GIGL 1CWVA 4JO2L 4YXKL 3OXSB 4OLVL 3DX9A 5EOCH 3D5OF 5ITFB 4LSVL 4NUJB 4YZFF 1NCDL 2V5MA 4MD5B 3V4UL 2HWZH 3CMOH 3DXAB 4ODUB 4RFNB 5EN2B 3WFBH 1MQKH 5CGTA 1I8KA 2V2WA 4BSWA 1T5XA 1FFPA 3WLBA 4WGWB 3QUKA 5CGYC 4JKKA 3F7QA 3BMVA 1OAUH 2YPLA 1AO7D 4G8FA 2EYSA 3V0VA 5TJWK 3JTSB 1XF5A 3CFEB 2VITA 5C0FB 1HCVA 5EG6C 1DLHB 1U8OA 3NACH 1QFPA 3DUUA 4P4KB 3EFFB 2NR6C 5D2NA 4LP4A 3PIQA 5C08D 1XGQA 1P4IL 3RWJB 1CXEA 1Z9SA 3NN8B 2NZ9D 4M7LH 3TIEA 5IESH 5E56A 3ULVH 1INQB 4IHOB 5B3JE 4FQCH 1U8QA 4CVXB 3SHSA 1J11A 2IPKA 3V5KA 1T22A 5MERB 3BUYA 1BMGA 3UTSD 1O0VA 1XMWA 3PWVA 2UZIH 4WV1A 1B0GA 2OZ4H 3MV11 2FH6A 4LLUA 1I1AC 2B20A 4HKBA 1G84A 1JV5B 2WP3O 4P2OB 4DEPC 4N0UB 5F96L 4GXVH 3GRWL 4LARL 2VXUH 1HSAB 5JR1L 5FYJU 1ZVYA 4AIXA 2IH1A 5C07D 5DSCA 4PJFE 4XCCH 1S9KC 4Z77B 3D0VB 1BFOA 3VWKC 5F7WC 1DEEB 1EO8H 1U2CA 3G5VB 4QXTB 3RU8H 4CJ1A 1I7RA 1KIPB 1WJ3A 3HCVA 3I50H 1MPAH 1IMHC 1Q0YL 2Z93A 3MOAL 3MLXH 4ETQB 4RMVA 4JQVC 4RGNE 3TA3C 1J88A 3P77A 3P73A 1NEZA 4V2BA 4Z7VE 3D18A 1UCTA 3QSKB 4P99A 4XPTL 2ZKHH 3BN9D 4NKQB 1LEIB 1FFOA 2Q76B 4XH2B 3PJSB 3GSUA 2ORBH 3HE7C 5KS9E 3HZMA 1F3JA 5FO9B 4GXUM 1VFOA 1E27B 3OXRA 3HNSL 4PJ9C 4LSSL 2DTML 3QJHA 3MXVL 4CMMB 3QAZC 4K7FA 1ZANH 4ZOAA 4NNYA 2V6HA 3S35H 4GAYA 1OW0C 2NY0B 4ZO8A 4K8RC 2Q87A 3BEWA 3MTRA 4E41A 4JZOA 3MBEC 3O3UN 3FT3B 2CMRH 4F33B 2FECL 1KLUB 3EDFA 3QHFH 2R2HA 1G7LB 1NSNH 3GBML 5CAYB 2ARJQ 2Z31D 1MFAL 4MAYC 5CBEB 4BZ2L 3HNVL 2FBJL 3IS0X 5F7EH 1ZHKA 2VKXA 5LAXA 3GB7A 3DETD 1H0DA 4U6HB 1OTUC 3ZKXC 4F7EA 1S7TA 3FCTA 1Q9LA 2WINB 3QDJD 4YNYA 1CL7L 3SDAC 3D3VD 2B39A 2V2XA 1B0WA 1I3RB 1LO4H 3CCHA 1WBXA 3F12B 2CK0L 2V9RA 1U8IB 3UAJD 2EZ0C 1RFDH 4M7ZB 3TJEL 3FO2A 4LSTH 3R8BB 3WS6A 1JPTL 3W81A 4M3JA 1AD0A 3PDGA 1JRHI 2VE6A 1CGSL 1FVEA 1IFHH 2FEDC 5DUMH 5D1XD 5FV1L 5HGHA 4Y5YB 3B9KD 5BV7B 1A5FH 4M00A 5BO1H 2OYPA 2ATPA 5DJZB 3O2WH 2FEEL 3LOWA 1M7DB 3NBNA 2A1WL 5EO0A 2JCCB 1LNUB 2LU3A 4OLXL 1FVCB 4OCSL 3VRJA 1PAMA 5HSFA 3MYJA 3LPGA 2EDBA 5GS0D 3AREB 4NN7B 4ZUWB 4I2XE 2W0FA 1XF4A 3EYSH 5C0AD 4N5UA 3RA7H 3RL2B 1OPGL 3VMPA 3F7VB 5DHYA 4ZS6D 2OMNA 1KCVH 2F58H 5TPWL 2YUXA 5TE6L 3TBWA 3RUGE 43C9B 4OZIB 1FZKA 2X40A 5I1HL 4RFOL 1A6UL 5AZEL 3TZVA 3BP4B 1T3FA 1HH6B 5FKPA 4UU9A 4KKAD 1JPST 1Z3GL 3W2DL 4PRPA 4UV4L 5F6HJ 1DDHB 5CSBA 3WSQL 1UEYA 3OX8A 5L6YL 2EDJA 1MREH 2NX5E 1RPQA 3ZHDA 1QBAA 4HKXB 2D0HA 4YBHA 1AC0A 2AK4B 1DN0B 3KPQB 4AL8H 1E4WH 4YEFA 3HMWL 2P8PB 3AMKA 4UV7H 1FGVL 2R0LH 3BMWA 2X41A 3QFDA 1KCRH 1P4BH 5FM5M 1MFDL 3UJJH 1UWXK 3RWGB 4OKVB 3VA2C 4XMLL 4JR9L 5D1XA 4N1EA 5IFHL 5IHZA 1T1XB 3B9KA 3P9MB 1CLZL 2EKJA 1NGPL 2VLKB 4OV5B 3OR7A 1QO3B 2AQ2A 4WHYH 3K4DA 4JFEE 1NBVH 3C5ZB 4M1CD 4MNQB 5F1IA 2X2YA 5M95B 5FHBL 3GSNB 1MFBH 3IDYB 3BN9C 4ODVH 3PGCB 3SOBH 3IT8D 4JFXB 1CG9A 2O5YL 2VLJE 3GFUA 5FGBC 4EIZC 1UA6L 1ZLUH 4XP4L 5MEQA 2VSCA 5J56B 4L4VD 3VMOA 4GKOA 5C09D 3WHXA 2X44D 5JO5B 2FIKB 1ZOXA 3MRJA 1G9ML 1GGBH 5HYSG 4ZUUA 3O41A 3TO4A 3WS3A 1TNMA 4X8JB 4LEOA 3HS0B 4R7NB 3BSZH 4YZFE 4X4ME 1NUFA 2BY3A 5HY9B 2DWDB 1RZKH 1NGWA 3BP5A 1JWSA 3AB0B 5F71A 1G9NL 2R23A 2Y1VA 4AZ8A 3OR6A 1JHKL 3IXTA 2D2OA 4O58L 5TF0A 5DVLA 3VI4E 4I3SL 4EQ2A 4P46B 5FGSA 2O26U 4K71B 3J7HA 2BVQA 2IAMD 1WT5C 1S5IH 2DKMA 3L5WA 2XPGA 1M4KA 1PKQE 4OLWH 1MIML 5C7XH 1FNGB 1J1XH 1BVZA 4XXDA 4I13B 5I2IB 4XP6L 5IV2A 3NIGF 1R5IA 4PRIE 3MNWB 3O6LH 1ERNA 2HJFA 3MLUH 3CVHH 3B3IA 3R0MA 1I3UA 3MGAA 3QO1A 1TJHH 3LD8B 3N1FC 3L3DB 1AQDB 3O6KH 2IADB 5D7LE 5L2JB 2DQTH 4J23A 2GCYA 4M6AA 5T1MA 4UT7H 1A7QH 5JOFA 4AIZB 2Q7YA 1RZJC 3CJJA 2P48B 3TN0A 2CKNA 1OP3H 5J12C 1CXIA 4WI4A 3WO3B 3UDWC 4MWFB 3C60C 3QNXB 5IWLA 3HAEG 4KJWC 5L2KD 5CFHA 3RIAK 3PWNB 4P23C 3ZKMD 4LLDA 4PRNB 4PBVC 4LPCA 1S7VB 3Q6FB 5I9QC 1R24A 5K9KA 2YRLA 5GZOC 1D6EA 2GY5A 1UWEH 3MLTB 4XZUB 3QO0A 1GPOH 3DNKA 5J9PA 3TV3H 1BFVH 4JZJB 1WBZA 2ICEB 2M8XA 5JDSA 3MQIA 4L3EA 3QEGL 4M7LL 5IESL 4MJ6B 4W4OC 3CX5J 3RY4A 3UBXA 2F54E 3HR5B 3EDDA 4EXKA 1FDLH 2CIIB 4KJPC 3QUYA 4XNYL 4M9OA 2UZIL 1UACH 4AEIH 4FTVB 1HDMB 3WL9B 5HYJE 1IL1B 4UDTA 2DDQL 1C7TA 4LHJB 3E3QC 4DCQA 5EBLB 4HS6A 4OBRA 2E8YA 4XCCL 3TBVB 3IKKA 4NRXA 4ONHA 1M7IA 1EO8L 3CLFH 3LQAH 3O6FB 3RU8L 2H6PB 2SEBA 3HC3H 3I50L 2BY1A 1B4JL 3MLXL 5JOEA 4XNUH 4JO1H 4A6YA 1BFTA 3ZKQD 2G9HA 2GY7B 3IVKA 5EZIH 1SYVB 4YPGA 1S3KL 5L2KA 1JZ8A 2ZKHL 3MV7E 1RZ8B 1ZLWH 1XIWD 5I66B 2ORBL 4HMEA 3WJJA 3V52H 3VFPB 1KB5A 2BSTA 3DX8B 5I1IH 3W39B 4TPRH 3UTQB 3V5DB 1BD2D 4LPVA 5LWYH 4LAJH 4WU7B 2DQJH 1DQQB 3H9SA 4PRBA 2XWTB 2X7LB 4PD4K 5I16B 1HH9B 2C3WA 4OUUA 3H0TB 3ARTA 4LKCA 1QYGL 3QHFL 2NY7H 1KC5H 3HNTH 3O4LB 3U0WH 2FLRT 1VEMA 2A73A 3X12A 3DTXB 3QULA 4NQDE 2KH2B 5EULV 5F7EL 2FX7H 4U33A 4F7CB 4PJGB 1NCTA 3RHWF 3FB6A 1Q38A 4O51B 4JN2A 4U7SA 1AKJA 2RQ8A 1YPZA 1N8ZB 2VL5B 9CGTA 1UM5H 1EFXB 5FUCE 5ADOL 3DSNA 1QSEB 1KT2B 2NMSA 1F4HA 2HVKA 2DQEL 1FO0L 4QRUB 2IAND 1MNUL 3ZTNH 1R5VA 4R90H 5A43C 4WW2C 2AXGB 3HC0A 3U4AA 1JYVA 4KUZL 2PYEA 1E4XL 4LDLB 3VJ6B 5I1AA 1JP5A 2IAMC 3VFUB 1VEOA 1RFDL 2VXSL 5HDLA 1N0XL 3L5HA 2EDEA 3NFNB 4JFQA 4LSTL 4YHZL 4G9FD 5GZND 2Y25A 4JJHA 5F9AC 4GMTH 1EXUB 4WTXA 1GZPB 5IQ7L 1IFHL 4N0CD 3R06A 1OSPH 5JXEC 5DRNA 1AP2B 2VAAB 5CJBA 3CAFA 4I9WE 5DUML 4YE4H 4U1SA 2I26N 4Y16B 1SVCP 3MSPA 3CDFA 3QIWC 3SN6N 5IK3B 3JUYA 1A5FL 3LKRA 1BEYH 5BO1L 3U7AA 3EYOA 2AERT 4K2UH 5J7CC 3QFJE 1YC8A 3SKOB 4PJ9B 3DURA 3QAZB 3ILPB 3ALXA 4I0CC 2MQ0A 4LLYA 3RVXC 5TDOB 4FNLH 1IC5H 5I1LA 3EYSL 4X6DB 1UZ8A 3MBEB 3VXRB 3Q1SH 1MRDH 1MJUH 4LCIL 1LWRA 3ARGB 3TVMC 5D96C 2EIZA 4M6NL 4S10A 2IANA 3X3FH 4Q6IC 3OAZK 1CVRA 3HB3D 1FORH 4G43B 2BDNH 4TUJB 3FQNB 3ZKXB 1A1OB 1WEJL 4Q2ZB 1C8PA 1OAKL 4G9FA 1D5XA 4AL8L 4JRXE 3VXMB 5KSBB 4PTUB 1E4WL 1UVQA 1CGWA 4RGOH 3NCFB 4OZ4B 3O81A 4UV7L 4Y4HC 4TN9A 1KCRL 3UJJL 1I1YA 1MVUB 5HYSA 5F7DA 4D9RE 2E9BA 4ODXB 2H26A 2GSIB 1OT1A 2LAAA 4R9HA 4S2SB 1WFUA 1GXEA 1F11B 1OARH 1NBVL 3VFSB 4NJ9H 3BRFA 4F15B 2ERJB 4HG4J 5C70A 5FYJL 5FYJE 1PX3A 3JSSA 2MCPL 3GMPA 3NCYS 3THMH 1QTYT 1YY9D 2R4RH 2WNGA 4M1GL 4KZDH 1SHMA 3QDHA 3W9DB 1XIWC 2Q7NA 2YEZB 2CKBH 4MQSB 5FK9B 2K7PA 4BFIB 3VFMA 5CP7B 1P9MA 1KPRA 1AD9A 4HIJA 4DTGH 3NIGE 5TDPA 3DVIA 4AH2A 1UXWB 3NZ8B 2I9TB 3D0LB 4C54A 3C6LA 2CLVB 1GGBL 4NZTL 5DK0A 3DGCR 2GK0B 3GUTB 1XF3A 1C5DA 1S7SA 1OAQH 2H9GA 2BNRB 1L7TH 1CZ8H 4YK4C 1EUUA 4Y1AA 3S36X 1Z5LB 2VDQH 4LLWA 1RZKL 2R9HD 3FO1B 4M7LT 5GXBB 4JQXA 1YDPB 4HWBH 4OD3H 5FF6B 2EC9U 3MJ9L 3EYUH 5E4EC 2Q3ZA 1FCCA 1JK8B 4NC0B 3WFCH 3T4AB 4JFFE 4X7TA 1JPGA 3MROB 1NC4A 4JO3H 2MCG1 3QPQC 4GMSL 2HRPL 4CL7A 1BQHB 4LVOB 1AY1L 4HC1H 5D72H 1S5IL 4LCYA 4ZXBB 4OLWL 3VWJC 5C7XL 1FZJB 2W0KA 2Q8BH 5HPMB 1Y18B 5EZLA 5LXGH 1JTOA 4XPBH 5HHPB 3RZWA 3IU3A 2BP3A 1NJ9B 4FFYH 2MKLC 3MLUL 1MI5E 4KHXL 5TE7L 1I4FA 4WFFE 1TJHL 1J18A 1P84K 2VAJA 2CJUH 2XACC 3CH1B 2XTLA 5FXCH 1AGFB 5GZNC 1PW3A 5EUOB 4UT7L 2IBGA 5F3HA 5DMKB 3TP4A 5C0IB 3MJ8A 1SJHA 3MUGA 4UZGA 1XGRB 2GSGA 2HKFH 2IF7A 4PS4L 3V6ZB 1QFWI 1G7PB 3U83A 1MLCA 1A4JA 4RGND 4HUKB 2DLTA 3LCYA 1RD6A 2VJXA 3MRBB 4JY4B 1UWEL 5IMOA 4GKNA 3QNYA 1ZS8A 3NFPA 1BFVL 2QKIA 4DKFH 2V5RA 3MNVB 3SGKC 3VE0B 1KN2H 5IB4A 2A6KA 3EO1A 3U48A 2HLFC 1C08A 1IC1A 5E0QA 5DQ9A 2C1PA 3PHQB 4U1HA 2O5ZH 1GYAA 2JLLA 1FDLL 4XCYB 1IAOA 2B1AL 5D5MB 1UACL 3EIFA 4X99B 4AEIL 1DR9A 1CD8A 1RIUL 4WI6A 4JDVB 3G9VA 4FZEL 3FQXB 4AYFA 2C1OA 3QIBB 2A9MH 2WM0A 4PJDB 2WP3T 3LQAL 4L9LA 3LZFL 1JRHL 4MCZA 3HC3L 3P4LA 1AGCB 4PRHD 3GHEH 3LB6D 4Y0GA 3E1F1 3RWDA 1C1EH 1Z6JT 2OQJB 4W70A 5LBSH 3VI3F 3MNZB 2PW1B 1CICD 1HI6A 2B1HL 1KPVB 2E6QA 1EHNA 5BCAA 5HVFB 2OI9B 3ZTJH 3W0WE 1MCNA 4KXZI 5IMKA 5HDQH 1Q9OA 4OZFA 5CBAB 4ISVB 5IVZA 1DLFH 1FHGA 3V52L 1FL5A 1YN6A 4M7JH 2G2RB 4PREA 3V6OA 4TPRL 5EA0H 4Z18A 4P2YA 3BZ4A 5I73C 1FYTB 3MRHA 1OM3L 5J12B 1F6FB 1X5JA 2EE9A 5LWYL 3SY0A 1UYWL 1YY9C 2FO1A 2X1QA 4E42B 1MCJA 4LPWA 3TPUB 5CKAA 2XY2A 4P23B 4LKXB 1G1YA 4LLMA 3U4EA 1MCIA 3ARDA 4NN6C 1LP9E 3ARBD 1RJLA 4D9QD 1JJUA 4DOHE 4LLAA 2NY7L 4DGYH 5C0JA 2IG2L 2P44B 4HUXB 4G8GA 2EC8A 3RPKA 2NY2D 3OG6B 4QHNB 5CD3A 1NAMA 2CIKB 2P4AB 4HMCA 4Q6YA 1JGVH 3UP1A 4MLSA 4NT6A 1ZGLM 2WAHA 5E8DH 4MDIA 3VRIA 1UM5L 4AENA 2M2DA 4F7PB 4F2MB 4ZD3H 5IHUH 3IDGA 5LGJB 4JGUA 4XHQA 2L0DA 3QI9D 4PRHA 1U3YA 2XNAB 4OJFH 3MCKA 1H5BC 3X3GH 4R90L 2V2TB 1EAPB 4JREC 1FIGH 4U1IB 5IB2A 4QHLA 4NHUA 4WI9A 1CICA 4WY7L 5GSVB 3TNMA 3GGWB 4LSRL 5DRWA 4NM4H 3WMSA 3QHZL 1BBJB 4JM2D 1NFDF 2D4DA 4GMTL 5F44A 1G7IB 1T20A 2XZZA 3LEVL 4QGTA 5E94B 3BP7B 4ZSOE 1EBAA 2NW2A 1OSPL 1OQXA 1MHPH 2NX5D 4YE4L 1W72B 5HDBF 4LPTA 2R2BA 4GBXB 3QG7H 5C0NC 3GIZH 2YXFA 3EYFA 3BGMB 2BHUA 5CINH 4ZOCA 5KN5B 1BEYL 1T0MA 1FVDA 3VD7A 5HGAA 1I8MB 2GJ6B 1IRAY 2VXQH 1J8HB 2C3VA 3HUJB 2QHLA 4H8WC 2ADGB 4HCRH 4I5BB 4P59L 3ARSA 4ZFOA 4PUBL 2RFXB 3U30B 4FNLL 5E5UB 2X05A 4V1DB 3LHPL 1BP3B 5AAWA 1MRDL 3IFOB 4JFED 3LDBB 4U1NA 1U8KA 5F88A 1N6UA 3MYZA 5INCB 3RZCD 1BQUA 4Z7OF 2OL3L 3MRIA 4JANA 4MJIA 2F53B 3VRLF 5FHAL 5EO9B 1ADQH 4OLUH 3EFDH 2BFVH 2VLJD 1RK0B 1FORL 1WBYB 3U7WH 3FFCB 3JWDH 4R97C 1L6XA 1BBDH 4K07A 3RIFK 4MNGB 3UTTA 1JGDA 2BVPA 4TUOA 5DO2D 5DQJA 3AU1A 4JM2A 1I85C 1U8MA 3C2SA 1FLRH 2ILLA 3BPOC 2GJZB 2RCSH 2Y36H 3QIUA 2NX5A 1JNHA 1CFNA 4IMKA 3FB8A 1TCRB 2XZQH 4JVWA 1YQ2A 5CZXC 5D9SB 4GKSB 1RK1B 3LB6C 3O3DA 1OARL 4NJ9L 2X4SB 1J7VR 5I8EB 1RSFA 4M43H 4PJCB 3THML 2ESVA 4IRJD 3AC0A 5JW4Q 4RISL 1NDGA 4KZDL 1QFWH 2EIDA 3MO1A 3O2VH 5IEHB 4OI9A 3QCUH 3KYNB 1CFVH 4P5TC 2VDOL 1LK2A 4PRID 4FABL 5ANMA 4HIEA 1DL7L 3O3AA 2R2CA 5D71L 1XR8A 3T2QA 1F3DH 1UFUA 2ZPKH 3ROLA 3ARBC 5D7LD 4G7VL 1OAQL 3TVMB 2IALA 1CZ8L 1YN7A 4RQQA 5J89A 5MEOB 5L8JB 4O00A 5T1KD 5I1DB 2VDQL 4QRPB 5A16B 4YUEH 4LCWB 5C0BE 1PQZA 2GKIA 1BJ1H 4NQEE 2LVCA 5JIKA 5F3BA 4K9EL 4DAGL 4H20H 5F1NA 5FM4A 1HHJB 1CXFA 4NRZA 2X1OA 5C0DB 2GK2A 1OAXH 1DP0A 4WHYG 5DDHA 3GSWA 2VXVH 2X89A 4NYLA 3SCMA 5J1AA 1T0NB 1I9JL 2VUOA 3QI9C 1YEEH 3SO3C 2EEBA 3M45A 2Q8BL 4Y4HB 1TVDA 5ALCL 1HEZA 4RFEA 3ZYZA 4YHNB 3D85A 3SJVA 4KXZH 4NZRH 1DVFD 4UBDD 4OD2B 1WUNT 3JVGA 2F54D 1Q9KB 3G6DH 1JHTB 3RY6A 3T1WA 1JF5A 3RX5A 4IIQC 5IT2L 1S7RB 4NO5A 2R8SH 4XPFH 2FZ3B 5HYJD 1DQMH 1E6JH 4YWGL 2NY6B 1ZA6B 3QUZA 2WBWB 5FDWA 4OFDA 4GS7C 3P40A 2GTWA 1YEFH 3TEUA 1HINH 4WI7A 1WFTA 3JWOL 2DD8H 1FV1B 3OKLB 4GH7B 1T2XA 3MLVH 1I1FB 5FOBA 1L0QA 3RVUD 4PR5B 3TCLA 5IIEB 1RY7B 2VXTL 1X7QB 5IJKC 3FQRB 2J4WL 3NIFF 2J12B 4P57B 2VC2H 4ONGH 3Q3GA 3I2CL 3VI3E 3MV7D 4W4NA 1U8JB 1ZV5A 2P49B 3BD5A 5JIIA 3MMEA 25C8H 2JKXA 1CGVA 4RMSA 4L29A 2BVOB 1JUFA 5CCKL 3IGAB 3WLWD 1TZGH 5SWZE 2W91A 2Z8WC 4JPVH 2ITCB 4XPAL 1VGEH 1FRGH 4PJIB 3L5XH 3HPLA 4Y2DA 4YC2B 1DVFA 3D39B 5HI4C 3MRMB 3L3HA 1WSST 5CLTA 2Z8VC 1D9KD 1NBYB 4L3CB 4EDWH 1KCKA 4NHCL 5DD1H 3OKYA 4LHQB 1G9MC 1GAFL 2OZ4A 4NQDD 4G5ZH 1CD9B 1F8TH 4LSQH 4LSPL 2YSSA 1PG7H 1C1EL 1KJ3L 3V9FA 2Y9RT 4UIMA 4Z7WA 3PWPB 1S5HA 4R4FH 5EIIB 4XC1H 5LBSL 5ACLA 3QUXC 3E6HA 4WHDA 3ZDXF 3NA9H 1EMTH 3RWCA 3LKNA 1A9EB 3QXDA 4MX7B 1HQRA 4HK0B 1DLFL 2GT9A 3B9AA 2P5EE 1VFMA 4M7JL 2HLAB 1PZUB 3BQUB 2FSEA 1TQBB 3PP3K 4Y5VA 4E5XB 4Z7WF 5IW6B 3GMOA 2GITA 3V7AG 2QQKH 3B8SA 1MRCH 2HKHH 2WUCH 1AE6H 4ZFGH 3RI5F 4I4WB 2QQNL 3RDTD 4NQVA 2ZCHL 1NFDE 3RIFF 2HN7B 4HJGB 2DWEA 5CEZH 4I9WD 3H42H 4K7PH 3KLAB 1YMME 1QQDA 3SE9L 1S9XB 4XCFL 1P6AB 1QPXA 1OTTD 3C5JB 2H32B 1IZJA 2HYMA 1G6RL 3QFJD 5E8DL 2E7LA 1D9KA 1ZXQA 3GIVB 1TETH 2ZG1A 4FFZH 4OCYH 5IHUL 2P46B 4RRPG 2DQGH 4D0BB 2EXYD 4PJ7B 3CIQA 4UOJA 4HZLB 3MRFB 1ORSA 4XNZB 1NAKL 3CPLA 1OGAE 5CJ8A 2J8UA 1ND0B 1A6TA 4CGTA 1VKXB 3CDGB 3TF7C 1CU4H 3P11H 3KJ4C 4LQFL 2ARJA 1NFKA 4MQ7A 5FA3B 32C2B 3ETBF 2KKQA 4IRSD 4MCYA 4BH7A 3P4MA 3L3IA 3N1PC 3O3BA 1OP3K 3VXSE 2HAZA 1I8LC 1XCTA 3IFLL 3VRLE 1KNOB 1N5AB 5CILH 5JIPA 1BAFL 2VZTA 2D7MA 4MZ2A 3KPRB 4UNVA 1A6VL 2VDNH 1MHPL 3MC0A 5T5FH 4TYUA 3GIZL 4L3AA 1KENL 2PTVA 4JRXD 4Z9KB 3EW3B 3S5LB 3VU2A 3RDTA 4F7MA 1BZ7B 4XCNB 3QDAA 1CFQB 4X9GA 3TH3T 5FO8A 3LEYL 2EXWC 4J2XA 5FCUH 1ORQA 2ZJSH 4D9RD 3K0WA 4RZCB 2KZ1B 4KKLD 1V7NH 3IDIA 5IB5B 4CDHA 4EOWH 4NN6B 5JW4R 2EDKA 1P1ZB 3VFTA 1GVIA 2IPUK 3ZSSA 3H3PH 2PO6D 4HUMB 1TTGA 4R0LA 4OM1L 4S1DD 5DJ6B 1JFQH 3QDGA 5ESVA 4YQXL 1UB6A 4BH8A 3GJEB 3U9UA 5C8JB 4XWGH 5TH2A 2FWOA 4KGLA 1S9VA 3MA7A 1D5BA 1H3VA 3RWFB 4L5FL 4OLUL 5LKNA 4AG4H 2DTSA 1BX2A 2BFVL 4ZYKA 4PJAB 3U7WL 3JWDL 5J6GA 2X4NB 2BNQE 4MA8H 5I19H 3WLWC 1ITBB 3MLSH 1MHCB 4KPHL 5BS0A 3MJ7A 2WBJD 2FYYA 5DGRA 3BKMH 3V2AR 2KBGA 4J7RA 3QZWB 1S9YA 2VLRA 2FO4A 1H5BB 2CRMA 1F4AA 1TVBA 3S37X 4OZIF 2RCSL 3GMRB 1ZLWK 5HYEA 3GSNH 4ZDHA 1NUDA 4QRQA 5GGSA 4OI8A 2VZSA 2EYRA 3G9AB 3QXUA 3B8YA 3QEHB 4C59B 4NWTH 2XKNB 3WFZA 4JFFD 3P4NB 3VXNB 4WWKB 5GS1C 4M43L 2BERA 3OG4B 4KV5F 5CP3H 4FQ2H 5FKAB 4I0PD 5C0CA 1QFWL 2GFBB 1GGCL 2HFEB 4NGHL 4G42A 3VXTA 4FZ8L 3SDYH 1RMFH 3NAAL 1CFVL 5AUMB 1YY8A 1KJ2L 5DTFA 4F58H 4IBLT 3KXFE 2BSRB 2NTFB 5BOPA 4JFDB 1IJ9A 3EOAA 4QHUB 4WFFD 4WUUB 3QQ3A 2EDXA 4MA3A 5CIPB 3VDBA 4J3TA 2X70A 4CMHB 4NQSA 1IQDB 1IM9B 4JG0H 1IAKB 3L7FA 3IXAB 1C7SA 1BVKB 1FJ1B 3F7RA 4IOFD 3MRCA 4YH6A 5CJ5A 4U0RC 5ISZE 3I6KB 1T7YA 3W9EA 2NXZB 5C6PB 2DBLL 4TUKH 1OAXL 4XCEB 1QBBA 5HHVH 5IF0A 3TZVC 3DYOA 2F8OA 5GJTH 1W0WB 5A1AA 2EXYC 4OCRH 5DC0A 1CD1B 4X4XB 4NDMB 3W5MA 3BPOB 3B6SA 5ESQB 1M71A 3NIFE 4HLZH 5E24E 1D5ZB 3DXAE 4JFYA 4NCC1 1AIFB 3L6FA 4NZRL 1XGUA 5I75B 4I0PA 1U93A 3RBGA 3D2UB 4G6MH 3MLRH 1CFBA 1PZ5B 3G6DL 4IRSC 1B0RA 5CWSA 3WNPA 4DFHA 5L8LB 3T04D 1NGZA 3BH8A 1A0QH 4MJ5B 3VFOA 2A77H 1U3ZA 1Q94A 2R8SL 1MJ7L 3QUMA 4XTRD 1LO2L 3OKEB 1S9WB 4ZMAT 5JORB 1TZIA 3CVHA 1LD9A 4UNTA 5GGVH 2YBRB 4A2LA 2PXYA 1OP5K 1YA5A 4Z7NE 5IEKA 2DD8L 2FJGA 4YHMH 3O0RL 2VLME 5GIRA 3MLVL 1LO0L 3P0VH 5KSUB 4NQTA 2QADB 2FATH 5TGBA 4X6BB 4Y5XC 2XTJB 5DD3L 4IDJH 4KKLC 1GOHA 2L4OA 2VC2L 4PG2A 3W0WD 3ZDXE 1N3NB 2KQNA 4N0UE 5D70H 1NCUA 5BQ7A 2PO6C 4RAVB 4WO4D 3LEXB 12E8L 3QWRA 25C8L 2GI7A 3MCLH 4KVCH 2W60A 3RY5A 3KPLA 3JV0A 1PJ9A 1RZFH 1YNTB 1K4DB 5EU5B 5EWIH 4PP2B 2NY1B 5JTWA 5SV3A 1LO5A 1I7UA 1VGEL 1CR9H 1RI8A 4Z5RA 5DJXB 1U58A 4OGZA 4HWUA 4L4JA 4JFPB 2ICWA 5KSAD 1U8PA 4UDUA 5KVGH 1T89A 2BVTA 3QISA 1EZVY 2A6JA 3SO3B 3VG9C 3ZL4L 4LMQI 4NQXA 1QNZL 5IB1B 4G5ZL 4YHYC 2O93L 1F8TL 4LSQL 5D1QC 3RQ3A 4PGEB 4RNRA 2OTUA 3DSFH 2A83B 4OGAD 4R4FL 1Z0NA 4WW1A 1N2RB 4PGBA 3O6MH 2KQMA 4MHHI 4Y19B 5C6TH 3NA9L 1EMTL 3GMNB 3KHQA 4FQHA 4Q74A 1F58H 3EZ8A 3KDMA 5BXFB 5TDNB 1TVHB 3R1GH 4M02A 3QQ9C 1X5LA 2AV1A 3WE6B 3A6OA 2FL5A 1UG9A 4HWZA 3ARWA 2NXYC 4NM8H 3RWEA 4AEHL 3FOLA 2QQKL 2HKHL 1AE6L 4WO4A 3K46A 3KNBB 3MODL 4H1LA 1YYLH 4ALAL 5FCSH 3TN0C 2ITDB 2YZ8A 1EA9C 2W0LA 4M48H 3K1KC 4L8CB 5CEZL 3FO9B 4UT9H 5CEZE 5L0QC 2K7QA 3WIHH 2LTQC 4L8SA 4RBPK 1HHHB 3GM8A 1LP9A 4JM4H 3FONB 4HIIB 4UOW0 5GGUA 1D7FA 3PV6B 4XBPB 5KSAA 3DUHA 1V5JA 5EU4B 2LU4A 1W8OA 1TETL 4FFZL 1QZ1A 3CFDA 1UT9A 2DQGL 3LN4B 3U2SB 2QHRH 1ZVSA 2H1PH 1CDUA 4LHUB 4L4TB 3LS4H 5JIHA 3MRLB 3QUYC 4A2MA 4FQXD 4X7DC 4LFHD 1CU4L 1YJDL 4LU5L 4PGDB 4PJGF 5BV7L 1A3RL 1KIRB 3QNZA 1F00I 3FQWA 1DQDL 4N8CL 2W0PA 2W9EH 2VDRL 3IRZA 1EO7A 2NY5H 3DV4B 2JCCE 2OR7A 1UXSB 1K8IA 4U1LB 5CILL 1A1MA 3O8XB 1BVLB 3JV6B 2CLRA 5FYKU 1B90A 4MD0A 3VD3A 3MV8B 1NMBH 4K8RH 3KR3H 2UWEA 2E6JA 1DANU 5GRWA 1JBJA 3MPCA 3BW9A 1KTDA 3CVIH 3DV6A 4P9MH 5KANI 5GGTL 1V7MH 3PL6D 3DX9B 4KU1A 3I6GA 4XP9H 4ZSOA 4OZIE 1CQKA 1KYOJ 5TFSL 4JO4L 2ZJSL 4HUWA 1T6WA 4MQTB 1I8KB 2V2WB 4BSWB 1T5XB 4EOWL 1FFPB 3WLBB 1RZIA 3QUKB 4FP8H 5F7UA 3H3PL 2IQAA 4FFVC 1XGYH 4OB5L 3WDIA 2YPLB 1GZQA 5E6IA 3ZSTA 4G8FB 2EYSB 3V0VB 4KROD 4NWUH 3O3EA 2AK4E 2YZ1A 2C3XA 1XF5B 1N5YL 4MA7H 5J11B 2VITB 4KV5E 1QSFA 1QG3A 1U8OB 3SDDD 3DUUB 3BVNA 5D2NB 4FQXA 4HF5H 1CDHA 3PIQB 4JGMA 4U1GC 4HW6A 1XGQB 5I19L 4X6DF 3ROOA 1VESA 2F5BH 3MLSL 5D1ZD 1U8QB 5T3XH 2VLKE 2IPKB 4MAUH 3V5KB 2APVA 1T22B 4JLRA 3BUYB 3G04A 1U42A 4DKDC 1IGML 1QBLH 3F58L 4WEBL 4WTZG 5EOCJ 4YDKH 4MNQE 4WI8A 2VQUA 1JF1A 3PWVB 3KJ4B 3GSNL 1EZVX 4WV1B 1B0GB 3G5YA 4LLUB 1J05A 4HKBB 4F57H 1VSCA 5ELIA 1JI2A 5C0BD 3HMXH 4NQED 4R3SA 4MB3A 8FABA 1TZHA 2IH1B 2DQHH 5DSCB 2FH8A 4JPKH 3PL6A 2ZOLA 3TNNA 3M07A 1BFOB 1OF2B 3Q0HA 1QKZH 5KSBF 1I7RB 3QP3A 4FQ2L 4HWNA 3HCVB 4OZHA 2Z93B 2CDFA 5ICZA 1CE6A 1QSZA 3P77B 3P73B 1NEZB 3SDYL 1RMFL 1BPVA 1FPTH 3D18B 3U7YH 4PG9A 3RFZC 5F97E 3ARVA 1FFOB 4OCNC 2HTKC 2QJDA 3HE6C 3GSUB 3BZEA 3HZMB 1F3JB 1S7QA 2CKBA 2VZ1A 3OXRB 4U49A 3QJHB 2XZCH 4K7FB 4NNYB 4GAYB 1MCBA 4JG0L 3LKSA 4TQEH 3BEWB 4APQA 4E41B 2HMID 2FLBT 4JZOB 3BWAA 1RJCA 4GW5A 3IS1X 3MRGA 2R2HB 5C9JA 1OCWH 3ABZA 2EDHA 4X0KA 3BKJH 4KRMB 5AYQA 5HHVL 4M62L 4ZS7L 5IFJA 3PE9A 1ZHKB 5LAXB 2ZUTA 5C0BA 2AEQL 3GB7B 4HWBA 4OCRL 3QG6A 2N1KA 1H0DB 1I75A 1JGLL 3GDBA 1OTSC 4F7EB 4Y88A 2DM4A 3FCTB 1Q9LB 2CLZA 4ZOBA 5DR5L 4OCLC 4YNYB 3MLYL 3H7BA 2V2XB 1KCSH 1XGPA 3MLRL 1YEDA 4HC1A 5SWZD 1IEAA 5E2UH 4PJHA 5SX5H 3CCHB 1WBXB 1L7IL 1JHLL 3PUCA 1PSKL 3FO2B 3KLSA 1QRNA 3CXDH 4ELMA 4C56A 1AD0B 3WXVH 2OK0L 4FRWA 2VE6B 5KG9A 1FVEB 5CUSL 1YEGL 4PB0L 1KOAA 1ZHLA 3STLA 4J6RH 4YHML 1NCBH 3P0VL 3W82A 5HGHB 3QH3A 3C87A 2VKWA 4U7KA 4HIXH 3BX7C 4HH8A 5AD0A 4X5LA 4O5LH 5EO0B 5I1JH 5D6CA 3S3SA 4FTVE 4MQXD 3VRJB 1MCWW 5DJ8A 3MYJB 5T33H 3OKDA 1BM3H 3MCLL 1QFUL 4KVCL 2P5ED 2YC1A 4RA0C 4KROC 2W0FB 1A3QA 1XF4B 2O5XH 1RZFL 4NZDA 4QWWD 3RGVD 4NO0D 3FZUC 4HK3J 4C58B 2V7HA 4X5XA 3IDMA 3NPZB 5DHYB 1AHWC 2I60L 4D8PA 1CR9L 3QDMB 4RGMC 4KMLB 3TBWB 5CD5D 4HUUA 1TTUA 1FZKB 1FFNA 4JQXC 4HLJA 3EYQD 1I3GL 3TZVB 5IMMA 1T3FB 5FKPB 5GSRA 4UU9B 2P5WA 2EH8H 1JZ3A 5KVGL 4PRPB 3VXPA 2Z92A 3WKMH 1U3HD 1ZHNA 3OX8B 1F4YH 2XY1A 4HHAA 3MA9H 1YMMD 1RZJH 1OD7A 3G08A 4ZFZA 4KQ4L 5L88H 3DSFL 5D5MF 3OAUH 3GMLA 4MXWL 3UO1L 5KBNC 3AGVA 4LAQL 3UX9B 5C6TL 3AS1A 2DQCH 3JUZA 4GRLD 2J6EA 4ZAKD 1ES0A 4QCIA 4K9EC 4KZEL 3IFNL 3QFDB 1MCKA 2HJLA 4FXKA 3R1GL 5D1XB 4EI5A 5IHZB 4POZD 3VH8G 1OGAD 1R5WA 2APXA 4PJDF 4LVNB 3O4LE 5J6HB 3OR7B 1N59A 2FR4A 1E6OH 4JPWH 4YHIA 3DVNA 2UY6A 4EUPA 1T04A 5F1IB 1ZSDA 1J0HA 2N7AA 4PJGE 3DMMC 5CJXC 1DBML 4X4ZA 3DLQR 4G9DA 2JIXA 2P5EA 3VXSD 1A7BA 5T1LB 3FRUA 1CG9B 3ECBA 4GAGH 4NO0A 1QSEE 3JV5A 4HKZA 4POYA 2AKRA 5MEQB 5DMJB 1CF8L 3O9WD 3SPVA 1TJIL 1NC2D 3T0EC 4QRRA 4FOMA 3WHXB 4JM4L 4R2GD 4N90E 1OT2A 3MRJB 5L9DH 4ZUUB 1EEQA 3O41B 4QNPF 3TO4B 3WS3B 4GO6B 4LCCA 3DX7A 4QXGH 4LEOB 1XZ0A 4OAWA 3CSGA 2HP4A 1Q0XH 5F9WB 3JWOC 2H1PL 4X6CA 5FB8A 1A7OH 1NGWB 3BP5B 4DGVL 1CIUA 2XYCA 1JWSB 1B88A 3ULUC 3DRTA 1ED3A 4AY0A 2R23B 4KK8C 3GBNH 1W72H 3DBXA 3OR6B 3AXLA 3IXTB 4ZAKA 2VZ3A 1JZ4A 2X4RA 3GK8L 2DAVA 2ICES 2NY5L 1Q9WB 2J8OA 3BDYH 2BVQB 3L5WB 2XPGB 1WWWX 1YEKH 4I18C 4L9LC 2BNQD 4XXDB 5IV2B 3KR3L 1T1WA 1R5IB 4KTYA 3K8KA 1NGYB 3KS0H 4X6DE 5A2IH 2HJFB 3VXRE 2AJZA 1KG0A 3CVIL 3B3IB 3VXSA 1EAJA 4NQCE 3QO1B 4ODHH 4G6AC 2Z9TA 4JRYA 2GJJA 4XBGA 4Z76A 3QJFB 2I5YH 1VACA 5HVGB 5MENA 3GKWH 1QA9A 4XP9L 4PLOB 2R4SH 4WTZA 2GCYB 5T1MB 5JOFB 1IGJA 2R0ZH 2Q7YB 4YFDB 3PDOA 3PABA 3TN0B 2Q3AA 1XGYL 1D6VH 3BYTA 4PJ8D 2GAZA 3ARXA 2VDLL 4HCRA 3KVQA 3BH9A 2B2XL 3IJSA 5L0QB 3GMMA 3BAEH 4LLDB 2LTQB 5KSBE 3HUJF 1QSVA 4HDIA 1R24B 5K9KB 1CDIA 5B8CA 1D6EB 1HZHH 3EYVA 3QO0B 5DQDH 4W68A 1VADA 5J9PB 1DBAH 1WBZB 5JDSB 3KXFD 4HJJH 3GJFK 4L3EB 1LO3H 2F5BL 4HXAH 3GI9H 5I6XC 1WTGT 5IROC 4B5EA 2E7BA 2YMXH 5BJTA 3SGJC 1J10A 5CD5C 1QBLL 3UBXB 1ADQA 2FCBA 5EUKA 3QUYB 1W0YT 2OJZH 3EYQC 2A74A 3PP4H 1F4WH 4U1KA 1QFOA 4QTHA 4F57L 4MGXA 1UH3A 4UDTB 1DQLH 2EYTA 3HMXL 3SDCD 4DCQB 4LL9A 4TNWF 2A0LD 4HS6B 3CGTA 2DQHL 5ISZD 3I3EA 4NRXB 1SJVA 2W07A 4ONHB 3W11C 1M7IB 1OP9A 4PV9A 3VFGH 2I24N 4HPOH 2SEBB 3RTQA 2P1YA 3RNQA 4A6YB 2G9HB 3IVKB 4RSVA 4U7MA 1FPTL 2BNRE 1JZ2A 2VABA 1ZTXL 4POZC 4YPGB 4YAQA 3VGAC 3TH2T 3DXAD 1MHEA 1V3MA 5DJAA 5JPMA 3HRPA 1I1CA 3OSKA 3MOBH 1DBBH 1S78C 2Y72A 4WDIA 1KB5B 2BSTB 2FD6L 4MD4A 4OIIH 1XF2A 1HYSD 4JE4B 5C0EA 5F70A 3INUH 4PJCF 1Z9OA 4F9PA 2XA8H 4XHJD 5EO1A 3STBA 3H9SB 3RP1A 4PRBB 4FQ1H 5EZOH 3OF6D 4TQEL 4PJBA 5DXWA 1WV7T 5E7FA 4JDTH 5GRJH 4P4KD 2IQ9H 4OUUB 3QRGH 3S3PA 3BKCL 1EUTA 3MUHL 5DS8A 4LKCB 4DFIA 5FYLL 1DBKH 3MV01 2YKLH 5GGQH 5T3ZL 5GHWL 3BKJL 4KK9C 5T3ZE 4N0YH 2V7NA 5A3IC 1PLGH 2A73B 2VLMD 2Y06H 3QULB 3X12B 4UILH 5DZLA 4LMQE 4TSCH 2BHZA 1FNEA 3FB6B 2YRPA 4JN2B 1AKJB 2RB8A 1YPZB 3T65B 4X9IA 5EUOE 2BZDA 1X5AA 3N1GC 4KAQH 3WUWB 1ZLVK 2Q8AL 1WAAE 1JNNL 1ONQA 1TTFA 2HVKB 2CR6A 3FT4A 1KCSL 3D69A