1NCCL

Crystal structures of two mutant neuraminidase-antibody complexes with amino acid substitutions in the interface
Total Genus 55
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
55
sequence length
214
structure length
214
Chain Sequence
DIVMTQSPKFMSTSVGDRVTITCKASQDVSTAVVWYQQKPGQSPKLLIYWASTRHIGVPDRFAGSGSGTDYTLTISSVQAEDLALYYCQQHYSPPWTFGGGTKLEIKRADAAPTVSIFPPSSEQLTSGGASVVCFLNNFYPKDINVKWKIDGSERQNGVLNSWTDQDSKDSTYSMSSTLTLTKDEYERHNSYTCEATHKTSTSPIVKSFNRNEC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase(o-glycosyl)
molecule keywords INFLUENZA A SUBTYPE N9 NEURAMINIDASE
publication title Crystal structures of two mutant neuraminidase-antibody complexes with amino acid substitutions in the interface.
pubmed doi rcsb
total genus 55
structure length 214
sequence length 214
ec nomenclature
pdb deposition date 1992-01-21
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1nccL02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1nccL01
5CLTA 1HKFA 3CFJB 1C8PA 3O3DB 2X4TB 4IJ3B 4JDVA 3QWQB 5I1HH 1JNLL 5K9OB 3EFDH 3C2SA 4R96A 1HQRA 1A21A 1FQ9C 2D7MA 4XNUL 1FZOA 3OGOE 4PJAA 1E6JL 3T2QA 5IR1B 4PRPE 3G04B 3RWGA 3VRLE 5FCUH 3VXRB 2VNCA 1T5XB 3V7MA 1HHGB 2AABL 5EOCL 1FYTB 2CO6B 3HI5L 1FFOB 4F7TA 3DUHA 4M3KB 4U1MA 1G7QB 3D39A 2IG2L 2X7LB 2EYRA 3QAZB 4FQCH 4HS8H 1HOCA 1LO4H 1V3MA 4QRSB 5IMOB 4YEEA 4ENED 4F58L 4M1DH 1I1YB 3I6GB 3TH3T 1OLZA 4ZXBA 2XN9B 3RIFF 3G6JA 1A7PL 5FB8A 3BKMH 1CE1L 2ORBL 1SY6L 4P23D 4NQVB 5HGGS 4F9LA 1JRHI 1EAPA 5I1DA 3HE6C 2VZTA 1P7KA 2X05A 3A67L 5T5NG 4JZOA 4X5XB 4UB0L 4Z7QE 3C87A 2LE9A 4J23A 4M7KH 4PGZA 4OV5B 1N7MH 2DWEB 1MRDL 3L5XH 3G5VA 4PJ8B 4BK5A 3TO4D 2GJ6D 5GS0C 1BZQK 5DMYA 1TXKA 3HNVH 2HRPH 4M43L 4NN6B 2GFBA 4G42A 3W9DB 4FQIH 1Q38A 4YE4H 4Z7VB 3ZDZF 4LKXB 1BD2D 2G75A 5C07B 2EKSB 1TNMA 3T04D 2X4QB 4N8CH 4HF5L 3OB8A 4X6EB 2YMXL 3JWDL 1CFBA 3G6DL 2D4DA 1CR9L 5E70A 1J1OL 2YA0A 2NTFA 5DFVD 4KVNL 1RU9H 4UQ3B 3VA6A 3VXMA 2EE3A 3DX6A 4NWUL 3MRRA 4NDMB 1QOKA 2PYFA 3NPZB 5FA4B 4ZS6C 2GT9B 4EI5A 4FRWA 4L1HA 5JIKA 3VXQB 3DVNA 1PY4A 3GMNA 5HHVH 4PLJC 4OT1L 5B4MC 2IC2A 1YPZB 4HKXB 4RISL 3CVIH 3JTSA 5KS9E 4KTEL 4KJQC 3EYQD 3QDGA 4ZO9A 4PG2C 2HLFD 3RVTC 3VD5A 2G60L 1T83C 1KCSL 1J1XL 4X9IA 5IEHA 1H3PH 3MX0A 3QDMD 3SBWA 1QEWA 3WXVL 5HVWA 1DDHB 3I6LE 1I8LC 1CLOL 4P57A 4WWKA 1G9NL 4PB0H 4MXQD 2ZG3A 4L9DA 2MQ0A 3VGBA 3ULVD 2Y7QB 2ZNWA 3OR6A 1TJHL 2UWEF 4RMTA 2XZZA 3ABZA 1KEMH 3FQUA 4MHHI 1D5MA 3MLTA 4U1GB 3T0EA 5B3JE 4KXZI 5HGBB 2E7LA 2IGFH 3TJEL 4CMHB 1UCBH 3Q5TA 4JHAL 5D72L 5DEZA 5I16B 4HIIA 3DURA 3ROLB 1IC7L 5CBEA 4GMTH 4C55A 3KDMA 1JNHB 2P8PA 1JGLL 1MF2H 4X4ME 3GSNB 1P5VA 2X1XR 3SE3A 4OBSA 1IGTB 2R1YB 4RGNC 3R06A 5CJOL 3F12B 3HC0B 1K8DA 5IB4A 3F58H 5DK0A 5C0NC 3IDMA 4HEPG 5JXAL 1QVOA 3V6ZA 4OZGE 3VH8G 3VI3F 4QTIL 2P8LB 3OBAA 4GW1B 2WWKT 3SJVA 5IT2L 4LCCA 3RBSA 2GK0B 1HSAB 4F2MA 2VLJA 3MGTA 4U1LA 3BP4A 2ERJB 3G9AB 4HUUB 4OCNC 5EBMA 4Z8FL 2X89D 4OLXH 1AGBB 4ONOA 4C54A 1MI5B 5C09D 3IDIB 4HXAL 1A14H 4PJ7E 5FA3B 4NM4L 3LPGA 4AIZA 4X0KB 3QISA 4MA7L 4NC0B 1EO5A 1NPUA 2EE6A 4QXUL 4TN9A 2JKXA 4FZ8H 2HA1A 4HBQA 4S0TD 1UM5H 3VFVB 5GXBB 5JTWA 3QIBB 1UJ3C 2Q7YB 1I1AA 4R0LB 1RIVL 3P4NB 1MCWW 2P5WA 1MQ8A 4LSVL 4CNIA 3ARGB 5IBLC 1EH9A 4DCQB 3TH4T 1QD0A 2GJ6E 3DV6A 1BAFH 4PV8A 1EV2E 2Q3AA 3AXLA 3ARFC 4GRWB 3HE7C 4MAUL 3WFCH 2AK4D 3RY6A 3NCJL 1DLHA 2P5ED 3CFCL 4FQHA 4XCCH 2BNRD 4K2UL 1C08B 5LKNA 1XZ0A 2BK8A 2QL1A 1T66C 5KSBB 1FL6A 3WV0A 4HZAA 4FMFA 4PD4J 3CX5J 3IDJB 1UXSA 3D0LB 1UH3A 3GBMH 1LQSR 3A0OA 3S88H 4FS0A 4IHOA 4YFDB 1FE8L 2X5PA 3ZTJG 2PO6A 1LWRA 3MYJB 3UJTH 1EXUA 1MCJA 3NZ8A 4PRBA 5GQBA 2FBOJ 2FJFA 3WKNA 5KSVB 2AV7B 1FNGB 3O4LD 5TPWH 1CE6A 5IKCA 3QUKB 4KMTL 1Q94A 1A1MA 5HI5C 4NQCB 5CKGA 4YBLC 5T3XL 4DGIH 4F33A 3O2DL 3IB4A 4FQLH 1C12B 1BBJB 2GUOA 1UCTA 3KGRA 1L4IA 4D9LL 1JPTL 2QKIB 2EEAA 3NVQA 5FUCE 1BJ1H 3ZE1F 3PGDB 3HFML 1E4XI 3MV01 1L0XA 4NO3B 1TZHB 4PP1C 4K3GA 4X8JB 5D7SL 1I4FB 4YXKH 4RX4A 4YHNA 3B9VA 2AEPL 2ARJQ 2IBGA 1BFVH 2QQNH 3BQUC 4XC3H 5EU4A 3LQMA 5SX5K 5TH2A 3OB0H 1JF1A 5GS1C 3CDYA 4JKMA 4ZNEE 1A0QL 3DVGB 1YEIH 4NGHH 2BFVH 4MJIB 1AXIB 3UTTA 3RZCC 1HHKB 3BISA 2GAZA 3FCTB 4QHNA 4GAYA 4KDTA 4EUPB 1BQLL 1O0VA 4XMPH 4P5MB 4TQEH 2VDLH 5EBWA 5HHXH 3O8XD 3FO0H 4G6MH 1Y0LA 1KCUH 2ZPKL 5ACLA 3FN9A 4HCRH 4QRPB 5IHZA 1RIHH 1C1EH 2ADIA 3K8LA 2QV2A 4PP2B 2ZWLT 5IMMA 4JG0L 4NN5C 1QQDB 2CIIB 2D9QB 5H94B 4M6NH 4Y5VC 4IBLT 1FIGH 4RWYL 5ESAA 1TMCB 2Y5TA 5J6HB 1KIPB 4N5EC 1RJYA 1FPTH 1JZ7A 4HK0B 5J6GA 5C0AA 1NCBL 3LKQA 3PIQB 4P2RA 3GO1H 3SDAD 1FLRL 4I3SH 3GSUA 1N4XH 3LKPA 4EZMA 3IU4H 2N1KA 4RGOL 3HRZA 4BH7B 3TIDA 5ENWA 3KR3L 3ZTJH 1T0MB 2IAMB 4WW2B 1MFAH 3TYGH 4LGRB 3PGFH 1B0WA 3TF7C 4M02A 3V0WL 2R2BA 4L9LA 4K71C 1NBYB 3Q1SL 4OFPA 3DSNA 4JAMB 5HY9A 1YNKH 1CI5A 5TFSL 1HH6A 3K0WA 3QYCA 1G6RA 2A9NH 2Y07H 1T4KA 4HS3A 2PR4L 3QUZB 2MHAB 4LDLB 4ENEC 1MELA 2HTKD 4BFGA 2FNBA 1F4XL 1KENL 5BRZA 1CGSH 1OVZA 3AS3A 2BNRE 2J8HA 4NKDA 4NQEA 4XP1H 5B38B 1J0YA 2I26N 4UT7H 3MJ9L 2ZOLB 5EU6E 2C3VA 5BXFA 3KWWB 3SDYH 4HUWA 3FO9B 2EO9A 3LAFA 3FAXA 5D1XD 4KI5D 2PW1A 4QTHB 3IVKB 4HJ0D 4NZUH 5JOFB 3IF1B 3PABB 3TO4C 5CHNA 3UTSB 2HFFA 5HHOB 4PJFF 3O4LE 4JFXA 5KTEH 1TZIB 1INQA 3CZFA 3VFNB 4QGYA 4WNQA 1M7XA 4M1GL 3QRGL 4WO4D 4I48A 4LRIC 3Q6GH 2NNAB 4MNQE 1ZSDB 3W39B 4J3XA 4OLZH 4O5LH 1JI2A 4Z0BH 1RUPL 5MERB 5I66B 1VA9A 5I9QC 2KQNA 2QQKL 1J8HB 35C8L 3OKEB 4Q6YA 4A6YB 1NGPL 2UZIH 5IBUG 2IFFL 4MS8D 2ZCLL 3M8OL 4PJBB 2XKSA 5LAXB 5E4EC 4W4OC 3QUXA 4Y89A 1MSPA 3FFDB 3EYQC 2OTUB 3WXWL 5ICXA 2VISA 4WI2A 4DFIA 4KJWD 5DC4B 4MGXA 2GSGA 3TCXA 2EZ0C 3IETB 4WEBL 1ZLVK 1GGTA 1YC8A 4S1QL 3FB7A 4Y4KD 1IKFH 3O9WC 3NFSH 4WU5B 3UJJL 5FUCC 4AL8L 5IB5A 4EDWL 1NDMA 1MIML 2Z91A 1ORQA 2VLKA 4N68A 4MXQC 5IIEB 5CBAA 4LEXL 1DANT 4PY8J 5IVZB 5MEOA 4L3CB 4U1JA 2OMNA 3MXVH 1HQ4A 1FGNH 3BP5A 1X5AA 4I18C 4P99A 1QRND 4R4FL 3BPLB 2D31A 4GAJH 4HDIA 2NY7L 4NM8L 3OKMA 2EO1A 2QADD 1EFXB 2OYPA 5I1LB 1IGCH 4ODSL 3OR7B 5T3XD 3LEYH 4K8RL 4P9HH 5I1CL 3AS0A 2B0SL 3FHAA 4JKPL 3GNML 3MRLA 3AREA 5HJ3A 5JLZB 3OKDB 4GAFB 3L3GB 1R3HA 3V4UH 2VXUH 5KBNC 4NRXA 5H37G 3FT3B 1JWMB 3PP4H 5EOCJ 3I3EA 1F2QA 3BZFB 3U2SA 4JRYE 4LEOA 2E9JA 1HWHB 2SEBA 4PGCB 3ZT7A 1L9NA 1J7VR 4NWTH 3QPXH 5CEZL 2CXKA 1MNUH 5MEQB 3WHE0 4Y19A 1QP1A 1OSPL 3VFSB 4P3CL 1LO5B 1ZXQA 3VXRA 5CZVL 1AQKH 1CD0A 1T5XA 4LSTH 1LO3H 4QLRA 5CWSA 1FYTA 5CMAA 2HAZA 1I7ZB 1G7QA 1EHLH 4P2QA 4MNGA 3RWDA 2NY1B 2V17L 2X7LA 3TA3A 4H0IA 4ZODA 4ZUUA 1B2WL 1SVZA 5MENE 3QXTA 4UDUB 2YD5A 5FHBH 5SWZA 3BPCA 5IMOA 4IMLB 1I1YA 3I6GA 1OAZL 5J13C 3QNYB 1BEYL 4TPRL 3N85H 1PG7L 5F44A 4JFOB 3MRCB 4PJXF 4WHTB 5IBTL 4YXLL 1CGYA 4FTVE 1DVFB 3VJ6A 4OFVA 3LZFL 1QSFA 4YDJA 1ODAA 2PTUA 2LFGA 1M71B 1UWEH 2B5IC 4YJZL 4HIEB 4HPYH 2VKWA 1NGYB 4X5XA 3GHEH 4N9GA 1NCDL 3MNZB 4E5XA 3OKOB 3GGWA 4PJ8A 1J0IA 1NMCB 3H8NA 4ONHA 3D2UD 1WFOA 5AG9A 5I1HL 1AP2A 1JPSL 4LCYB 3GRWH 3EFDL 4OCMC 5F8QC 2AVGA 1ETZB 5C07A 2EKSA 4X5WA 2BVQB 1JWUB 3X17A 3HI1A 1KCRH 1Z5LA 2YPLD 1U92B 3PWUB 4XH2B 2E27L 1DFBL 1H3TA 4C59B 2XA3A 4X6EA 1XGPA 4PJCE 4ELKA 4UINL 1U8QA 1LK3H 5F7MC 4OCYL 3ZHDA 5TGBB 2ZOKA 4RA3A 4G8EB 2VITA 4HWEH 1ZT4B 5E8OA 3NA4A 2R0KL 4HS8L 2ICCA 1Q1JH 1R5VB 5H37H 1LO4L 2GT9A 3GSRB 5F72S 3TVMD 3VXQA 4DZBA 3MLVL 4LVNB 1GAFH 4XP6H 1IM9D 5KVEH 3U30B 5C08B 1NGXA 4OZIE 1BOYA 2VDMH 3TGXA 5J12C 3BKML 3V5HA 4E41B 3TBWA 1KNOB 1OGAE 3VFRA 1QRNE 4Y16B 5KVFL 1EBPA 4KHXL 1AXSB 3MV11 2HFEB 3DX8A 1CT8B 1MVFA 2HJKA 4HBCH 1CDYA 1N7ML 3MSPA 3L5XL 4JY4B 1IAIM 1I9IH 5E7FA 3CAFA 2COQA 2HRPL 3Q3GB 3V6BR 2OJEB 3B9DA 3T65B 1D9KB 1UACL 4Z9KB 1NCUA 2DJ4A 2DQHH 4M7ZB 3UTPE 4HIXH 2QQQA 1XCTB 4N8CL 4L4VB 3B2VH 3QULA 5I16A 3AB0C 3WNPA 4U2YA 2MKWA 4KKBD 4N1CA 1RU9L 4Z7UE 1CK0L 1FGVH 1C5CH 3BP7B 5BO1L 5T1KB 1IKNA 1X4ZA 4WVRA 4LPCA 4Q74A 2VH5H 5HDQL 4JO1L 1IGTA 2R1YA 4J3WA 5DJ8B 4YHZL 3LCYA 1V7MH 2WBJB 3KLAA 1JTOA 3QT2A 4JQXA 4NC2B 1KT2B 3MO1A 5ID0B 1CFQA 3CVIL 3CZJA 2P8LA 3DUUA 2W59A 5EC1B 4P46B 5DJDA 2OTWB 4K3EH 3MV8D 4L8DB 4OF5A 4O51B 4ZS7H 1H3PL 3D85D 1NAMH 5B3NA 4I2XA 4CGTA 2YRZA 1U8LA 4HIJB 3U36A 1TIUA 1WSST 2DM2A 4JFEB 5D93B 4WI9A 3DOSA 3L6FA 4K8RD 4JRWA 3IDIA 2X09A 2CDGA 2NCMA 5FA3A 1S5HB 3V6OA 1JPFA 4UMGA 2BMKB 4X0KA 4JG1H 2GIYA 5IW6B 2HTKC 3TN0D 1EX0A 5E8EB 3QIWD 2PETA 1KEML 1HHIA 2V6HA 1KACB 3VFVA 4POYA 2V2WB 3HR5A 3QIBA 2Q7YA 5HHMD 3VD4A 3P4NA 1QA9A 2MMXA 4NZTH 1GRWA 4KRPB 4R9HA 3WEXB 1UCBL 4LSUH 2J5LB 4ERSL 3T2OA 4MCZB 3MV9E 5CEZD 3WD5H 2V9TA 3P30H 2BSED 2CQVA 4IRZH 3N1GC 4GMTL 4YFEA 3WNLA 3ZZ1A 1ES0B 4J4PD 3FFCB 4CKVX 2YPLE 4U6XA 2C1PA 5E6IA 1C08A 1SEBA 4LCWA 4NJ9H 1UH2A 3VFOA 1T22A 5EORH 1KBGL 3V4VH 4WI3A 4F80A 3RFZC 5EWIH 3EKCA 4CAGA 3FN0H 5BV7L 3GJFH 4BSWA 3PF2A 2CDFA 5DA4A 3QPQD 3WO4B 1GZQB 3MYJA 4XP9H 3BHBB 3ESVF 4WI7A 1FG9C 5TDNB 4GT7A 3UTZA 3VDAA 4NHUB 3RJQB 2R2EB 5IB3B 1FNGA 4OZGF 1MWAA 2A38A 3VWKB 5C71A 4OLXL 3SDDB 2Q8AH 3V6FB 4F57H 2ITCB 4NQCA 3EYOB 2AJSH 4MS8C 1A14L 3PL6B 1QLEL 3RI5F 3B9KC 2QKIA 3QUYA 3PWJB 4P3DA 3KAAA 3GM0A 4NUJB 2JJWA 1YQVH 3W11D 2X41A 4FZ8L 1RZKH 2EKJA 1UM5L 2JCCB 1BBDH 4NO3A 4TNVK 5C70A 1TZHA 2W92A 5EU5B 3OTTA 2Z31D 2FL5A 2IH1B 3CU7A 4S1RH 1Z0NA 2VZSA 4G6FB 2RFXB 4CN1A 3DVGA 1UB5A 4K9EL 4NUGH 4MJIA 2HT4D 3WFCL 4K94C 1HHKA 2PXYD 4S2SB 4GXUN 4W68A 4XCCL 4QHUB 4PJGF 3MRIA 4GRLD 2P8MA 2FZ3A 3MFGB 3BX7C 3FRUA 4OF7A 3DI3B 3P9LA 3S88L 4G3YH 3L3OA 3U4BH 1DSFH 4ZPTA 3V0VB 1U8HB 5I1IL 1RZJL 4XCNB 3IFNH 4HG4K 7FABH 4XPGL 4OUUA 5DTFB 5L7XL 4U6TA 4PTUB 2RB8A 5FO8B 4G80B 5TPWL 1WGOA 2VSCA 1QSED 1LEGA 1EZVX 5E56A 3VFPA 4N0UE 1OAYH 3MBEC 4I3RL 4F15C 4DGIL 4E9LA 1KIPA 4JFFB 4U6YB 1AQDB 4HK0A 3DI2B 2K7QA 4X7SH 3MMEB 5F7WC 4LOUD 1E4WL 3WN5C 4QWWC 2Q1EA 3MXWL 3ARQA 3P0YH 1XF1A 2HFGL 3UX9B 5CGYD 4YXKL 4BH7A 5BMFL 3DO7B 1UKTA 4XMKH 1FO0L 1BFVL 2QQNL 3QI9B 2O5YH 3CMOL 4V1DA 5D9SA 1T0MA 4APQC 2XQBH 3HI6H 3HLAA 3LQAH 3R4DA 3ZKMD 4XP5H 3QBTB 2BFVL 5IEKA 1A64A 2P7TA 5D2LB 5IFAH 1FJ1B 1PKQB 3QUML 3I50H 5HHME 4JAMA 3C60D 3ULVF 1YN6B 3EOAB 1KB5H 4XCFL 5TE4H 4XMPL 5CP3A 5GSVA 3IT8D 4TQEL 3B83A 2ZCHL 2ADJB 5HHXL 1T2JA 2MHAA 1WFTA 3FO0L 4PYHA 4RIRB 3ULSB 4A2LA 3P9WB 5ICYB 5FKAB 1P1ZB 4RSVA 2PNDA 1JGDB 3UAJD 1RIHL 1A22B 1C1EL 3RY4A 2Q87A 1X3DA 4L5FL 1PEWA 2X4PA 2ZOLA 3VI4F 2X4SA 5TDOB 1TNNA 3FO9A 3JSSA 4M6NL 4Y4HA 2CKBB 1U8IA 2DIAA 4FP8L 4YXHH 1R0AH 3IVKA 4JREB 2DS4A 4RQQB 2VDNH 5JOFA 1FPTL 2HVKB 3K2MC 2X4NA 5DMGD 3IF1A 3UTSA 4C56A 4Y2DC 4O4YH 1CWVA 4LLVB 4MZ2A 1CFTB 1TZIA 1W72H 5FXCH 5I19H 4DK6A 4GW4A 4D0CA 2Y25A 4I3SL 3KXFB 4HS6A 3VFNA 2Y4SA 2Y06L 1CLYH 2W1NA 1CFNB 1N59B 3F7YA 4GBXA 4HC1A 3SCMD 1MCKA 4N8VB 1MLCB 2JJVA 3QFJB 3TT1H 2YOCA 3BFOA 4RRPA 1LD9B 3A6BH 4FABH 5IV2A 5HDBF 3KYKH 3DX9B 3S9DB 15C8H 1DN2A 3OKEA 5E9DA 3REWA 1M05B 4A6YA 1BQHB 2I60L 1YNKL 5IMLA 5D7LA 4HH9B 6CGTA 3GKWL 5LAXA 4GQ9L 2Y07L 4UUJA 5DJ2A 4ZSOB 1OP9A 2VJXA 4U4BA 1GC1H 4UT6H 5F97E 1B4RA 3GHBH 2OTUA 4ZAKD 5F7DA 3U7YL 5C0GB 2QSCH 4OFYD 1WAAF 1JIBA 2FR4B 4HUVB 7CGTA 5EOTB 3IETA 2JLLA 4BH8A 4WTWA 4Z76B 4PJ5A 2ADFH 4BZ1L 4WU5A 5DZOA 4UT7L 3D5OF 4JPIB 2I5YL 3SDYL 3QCUH 4H20H 1JL8A 3SQOH 3O41A 3U7WL 3EBAA 4ZTOH 4PREA 5IVZA 4LLDA 4EEEA 1DBBH 4M03A 2RCSL 5TDPA 5SWSB 1AHWC 5KTEL 5GJSL 2W9EL 5A3ID 4MJ6B 1HXMA 4ELMB 3FB8B 4K7FB 1RZIB 4BUGA 5I1LA 2VXTL 3KYNB 3OR7A 4NYLB 3MRDA 1KCLA 1DBKH 1KIRB 3Q6GL 2A6JB 2NLJB 4J6RL 1CGVA 1QLFB 3H9YA 4O5LL 1A3LH 4Y1AA 4URTB 3P0GB 4Z0BL 3OKDA 4LNVA 3L3GA 1OTUD 5ANME 2QSTA 3HPLB 4JO4H 3CVHA 2DJUA 3OZ9H 2H1PL 2UZIL 4EOWL 4JFDD 2LTQB 2VXQL 1OP5H 1B0RB 5TE6L 4K55A 3DX7B 2AJ3B 4OM0L 3ZO0A 1WIOA 3NCYS 2V5TA 3QIUA 3IDNB 5GHWL 3GSNH 4CRPA 3THMH 5DVLA 1IKFL 3NFSL 5D1QD 4I4WA 3VWJA 3Q2CA 3IS1X 4K3DL 5E2UL 1KJVB 4OI7A 1I7ZA 3GUTB 3IDYB 2CRYA 4FFWC 1N5YH 3PUCA 2ED7A 5TQ2L 1RJZA 4OV6F 3G5ZB 3CH1B 2HP4A 2NY2B 3MXVL 4I0PB 4UIMA 1FGNL 1NQBA 4AENA 1R5IA 4KJYB 2GITA 4EUPG 4M9OA 3TN0C 3U9UB 1OB1A 3QIWC 3LKSB 2EDFA 3ILPB 3TZVC 1BMGA 1BIIB 3B6SB 4KJPD 1VFBB 2P42B 3LEYL 1H3UA 4P9HL 4JFOA 4O02H 4OZHE 3H3PH 2F58H 4UTBH 4HD9A 2BOBB 1DVFA 3P73B 3B3IA 1KLGB 1TVHB 2Y6SD 1M71A 4LVOC 3AUVA 4D0DB 3BOVA 3V4UL 2R0LH 1CICD 3PP4L 1NGYA 5ACMA 4MLSA 1NGZB 1P2CB 3CLFL 3EYFA 2CUHA 5ITFB 3E3QE 3ZYOA 2A6IA 3MNZA 4YBQC 4PJEF 3OKOA 1YMMB 1HE7A 1RUKH 2NXYB 5D1ZB 2E6QA 4H88H 4NWTL 4Y5XB 3DTXB 1MNUL 2OI9C 3ZKXC 4LCYA 5KN5B 2DRUA 5AZ2H 5BS0A 4X7TB 4L4TB 2DBJA 5FOBB 1YYMH 4U1HB 4QXTB 5F1IB 1WCBB 4NRZB 5DJXA 1NBZB 2CIKB 5EIIA 1A7BA 4XBPA 5CLWA 2PYED 1U92A 4XH2A 3AM8A 5DHVH 3TBYB 4KWUA 1CDCA 5DUPH 1UA6H 1X7QB 1LO3L 1JVKA 2F9BT 3U79A 1Z2KA 4HX1B 1EHLL 3ECBA 3NA9L 1R5VA 3HRPA 4XNQB 3MRGB 5FHBL 1DR9A 2BY2A 1YY9D 1A7QH 5CIPB 4BJLA 3CSYB 3CFKA 3C8KA 1T5WB 4H26B 4P2OB 1GOGA 2AXFB 4QHMB 2H9GB 3QHZH 4X6DE 4PB9L 4JZJB 3KYMB 3RPKA 3LY6A 2UYLB 3HUJE 5B38G 4M6OH 2RQ8A 1X4YA 1FVEA 4HPYL 3HTLX 4KI5F 4GW5B 2PXYC 3GHEL 1FAIH 2M1KA 4EQ3A 1HYRC 3QRFM 3GK8H 4RFNC 3U0PB 3KHOA 4KZEH 3SE4C 3T8XB 2OJEA 1MUJB 1D9KA 1X5YA 3GRWL 4Z95L 3UTOA 4EVNB 4OKVB 3BKJH 3WFBH 4EUPH 3SY0B 2JIXA 3CH8A 2MCPL 1KCRL 3TWCL 1XCTA 2ESVD 1IL1B 3KPRD 1E27B 4L4VA 4GLRH 1QBMH 3D39D 2FBJL 1YEJH 3CFEB 3OQ3B 3FOMB 1LK3L 3MLXH 3O6FC 1U41A 1DL7H 1YJDH 3RKPA 5CJ8A 4P4KB 4HWEL 4X6FA 5HGDA 1N0XH 2JJUA 3SKMA 4QXGH 3P77A 5DJ8A 4ZXBD 2O5XL 2WBJA 1DQML 4XP6L 1TQCC 5ID0A 2WUBL 1CU4H 4FHBD 4YX2H 5JHDB 4ZDHA 3UO1L 1XF4B 5CGYC 3U46B 5EC1A 4P46A 4YGVB 5LGKA 5D2NE 5IP4A 1WBYB 4ZYKB 3VE0A 3TJHD 5CUSH 3QA3B 2A6DB 3U0TA 3C5ZC 3DECA 4ZQKA 2DQGH 3L5WB 2FSEB 4HIJA 4N0YH 4X6CF 3X11B 3C60C 4PG9B 1SYVA 5LG1A 5C92A 4HBCL 4YHIB 1BWWA 3E8UH 4MDJB 4HKBA 1I9IL 2BMKA 3ARZA 4NNPH 1BQSA 1TQBC 4KK9D 4GRMB 4PBXA 3QEQD 3ZE0F 2DQHL 1RVFH 5CJXA 3AAZB 5L88L 4HIXL 4NQDA 3K8MA 4ZUSB 3DYMA 2YK1H 4MCZA 4MAYC 2R1XA 1LEIB 2OR7A 5DJYB 3HG1A 1C5CL 3MROB 1ES0A 3FFCA 3WS3B 4PRHA 5D71H 5DMGC 2OZ4H 3MREA 1A7NH 3QDGD 2OL3A 5GS3A 1CFVH 3EGSA 5GGQH 4U6HB 3SPVA 2IANB 2J4WH 1U8PB 3BGFB 4DAGH 3BPOB 5AYUH 4YDKH 1LEKA 1S9VA 1FN4B 5I1GH 2AEQL 3E3QC 4NNYB 1VENA 4GKOA 4PJHF 3BHBA 5TDNA 4WWKD 5HYJE 1NAML 2H45A 4NHUA 4WTZA 1L6ZA 2CLRB 4LSQL 3MBXH 4R90L 5F9WB 3PP3H 3AU1B 2ATKB 3WJLC 2OS7A 4YDVB 2ITCA 1N2RA 1WK0A 3PL6A 3VFMA 3S35H 4I9WE 4JG1L 5IG7B 1A6VL 3RVVC 3MLSH 1S7WB 5DQ9B 2CO7B 2IQ9H 3VRJB 2FCBA 2JJSC 4Y7MA 5DJZA 2JJTC 4JFYB 1G6RL 4NZTL 5EU5A 5I1AA 5JOPD 5ACZB 1LP9F 4RMRA 4FXGB 2IH1A 2WLYA 4DGVH 3LN5A 1GXEA 1P6FA 5AUMB 2RFXA 3BEVB 3LEXA 3BO8A 2ZKHL 3WD5L 4PJAE 2VDQH 4TVPE 4IRZL 1YNLL 1S8DB 4Y5YB 1UXWA 1J18A 1I85C 4S2SA 2OK0H 2VLRB 4QHUA 2Z8VC 4NJ9L 1R3KA 3L1OL 1Z3GH 4I77H 3D39E 3V4VL 5A3IC 3SJVD 2NMSA 4RAVA 2GI7A 1RJCA 1SVCP 3FN0L 2D2OA 2VLJD 1A6PA 3V0VA 3RNKA 1U8HA 1BJ1J 1NC2B 4L8BB 1BVKB 3HZVA 2AERT 5ISZD 1JN6A 3C6LD 1CD8A 5DTFA 5GS2H 1OT2A 2XRAH 2NY5H 3G6JE 5FO8A 2XG4A 5ALBL 3MNWB 1J05B 4HW6A 2ENSA 1W8OA 4AJ0A 4U0RB 4WCYH 4UT9L 2Q8AL 4F57L 3IGAB 1NANH 4Q6IB 5F3HA 4JRXA 1BFSA 3EYSH 4H1LB 5LGHH 1AQDA 4LSSH 3KJ4C 3SKJL 5EC2A 1S78D 3MMEA 1KPVB 1JWSB 2V5RA 3CFBB 2CJUL 2DLEA 4XGZA 5A2LH 1MCWM 2P5WD 1RZKL 2AP2A 3JWNC 2HT2D 4JGMA 5ESVB 1CCZA 3QI9A 4ZUVB 4ZOAA 5E2WH 4S1RL 4KGLA 3K7UA 1FVDB 3SO3B 3B9AA 1KJ2A 1JBJA 4N0FB 4ONGL 2PTVA 3MUGA 1RZJC 3WLWD 3JTTB 1ZGLM 4JDTL 1PKQA 1FNLA 4PLNC 5B8CB 5D2NC 5CKAA 1YN6A 1B0GB 2VL5A 5EIVA 3BE1H 3VXME 5MI0B 2ZUTA 2I9LB 4Q0XH 2PO6D 1FZJB 5F6IB 5ICYA 3S8WA 1NKOA 4QOKB 4EKXA 1P1ZA 1UB6A 2HKFH 2YXMA 5HYSB 3IFNL 4LVEA 4NKOB 3UROR 4AQOA 3BN9D 4F8TA 3KYOB 3G08B 1A4JA 1EO7A 5D7JB 3WS6C 1S7RB 2HLAB 5J9PA 4P23A 2Y6SC 3GEWB 3QDGE 3JVGC 5CCKL 1MCPH 3F5WA 5TDOA 5L9DH 4DTGH 4U0QB 4CJ0A 3DMMB 4N8PA 1CICC 5JXED 4D9QD 3ROOA 3OJDB 4NZRH 1OAYL 3IDUA 2V2XB 4NO2B 3NN8B 1FAKT 1ORSB 1U3HB 3SE9H 1S9YB 3RWCB 1CYGA 4PJGA 2E9BA 1CVSC 2NZIA 3O3UN 4Z0XA 4MB3A 2UV3A 3MGOB 3EIFA 4RX4D 5SV3A 3HZYB 2C3XA 1JGUH 1JNNL 1FVCB 5FUOH 2B20A 2MQ3A 4MNHA 3H9HB 2Z4QA 1N59A 4XMKL 5JW5B 1KN2H 2O5YL 5CINL 3RWJB 3C8DA 5IJKA 2VDOH 4N8VA 1MLCA 3UTTD 3MOQA 3T0EE 2EDYA 3HI6L 3LQAL 2DQUL 3K80A 4XP5L 1LD9A 3D9AH 1VGKB 4M4RA 1YY8B 3MA7B 4PS4L 1CL7I 1FV1B 4GAGL 5D70L 4LAQL 1BQHA 1TENA 4HH9A 5H35A 2QTEA 5E5MA 1JHKH 4UDTA 4ZSOA 5CEYA 3ALWA 3MACH 4DW2H 1YN7A 3QG7L 4NCC2 4EIZC 1MHEA 5HHPB 2VAAB 3QQ4B 3L7FB 1NCCL 4HFWA 1X5JA 4PJ9D 4HKZA 3PDOB 3QP3A 1MCHA 4QKXB 4HGWB 3WIHA 2BXYA 3SJVE 3QDMA 4JO3H 2VLJE 3G5XB 3CDFA 4XZUB 4Y4FB 4EDXB 4YHYC 4JR9H 4P59H 5C0AD 4U49A 2Z8SA 2F5BH 5T33L 4IRSB 4U3XA 5HPMB 2GY5A 2YBRB 3D69A 1BQUA 2GCYA 1JYXA 4KAQH 1U8NA 5I19L 2WK2A 4MJ6A 3BW9B 5T1LD 3FB8A 4G8GB 1RZIA 1VACB 2QEJA 4LNRB 4F8QA 3LV3A 2G9HB 3BWAB 4YC2C 5LQBL 3EJYC 4XNMB 3VCLB 4KPHH 3TT1L 1V7NH 3RHWK 2NY6D 1IT9H 5FYJD 4FABL 2P5WE 1WZLA 3JZ7A 15C8L 5GGRY 4YEFA 3I6KA 5C0BB 5T3ZH 1LE9A 3N1PC 2GTZA 1EDQA 5C7XH 1N26A 4ZXBC 4PRID 1B0RA 2FHCA 1KC5H 2AJ3A 4LCIH 3VRIB 5BRZD 3GHBL 5DMIH 3EDKA 1ZAGA 4F9LC 1HSBB 2BRQA 3CU1A 3UJIL 2ADFL 4TNWK 4JJ5A 5EO1B 3TJHC 1EHNA 1NANI 2UVFA 4XXDA 3ARPA 3S6CA 1TETH 4E0RA 1IC5H 4J3VA 1JGEB 4ZTOL 1A6AA 2GTWB 4N90D 5F7LB 1MOEA 5GIRB 1Q0YL 3R1GL 2G2RA 5C09A 1RHHA 1DBBL 4I0PA 5F96H 2UUDK 1UWXH 3ZL4L 1CXHA 2UZXB 2XY2A 3U9UA 4KMQA 3LKSA 4D9QE 3ILPA 1VFBA 4GKSB 4OF0A 2QQLH 1WAAA 2ICWB 1DBKL 5F71A 3H42L 3FB6B 4G43A 4L3EB 4C4KO 1KLGA 2I07B 4D0DA 3E6HA 4RMUA 3GMOB 4KMLB 4G8IA 1UZ8B 4EI5C 4ZUTB 1D5XA 4JO4L 1T20B 2AK4A 1XEDA 3MV7B 2CRZA 3G9VA 2DTSA 3V5KA 2P5EA 1H3WM 3B2UC 2WM0A 1P4IL 1UEMA 4OGZA 4JB9L 3UTTE 4F3FA 4UBDC 5D1ZA 2L4OA 3DTXA 1QPPA 1MHPL 5IK3B 4CUCA 3BIBX 2AEWA 4Q9BA 3GSNL 3HZKB 3SBWC 4QXTA 5A2IH 4NQXA 5F1IA 1WCBA 4NRZA 2CIKA 3X3FH 4NPYA 4WWKC 2P44B 4D0BA 2AV1A 2DAVA 3O45A 3U0WH 1MPAH 1X7QA 2FWOA 3RJDA 3IFOB 4M1CD 2VB5A 3WLBA 1ULVA 4M61A 4XVJH 1SY6A 4BFIB 3NABH 1RJLA 1URLA 4AQ1B 3ELAT 3T0EC 3QQNA 3BD3A 1EUUA 1EEZA 4C4KT 2LAAA 2E7LC 3MRPB 1QYGH 3VXSB 1T5WA 1CVRA 2ED9A 4AEEA 4QHMA 4MDIB 4S10A 5C0AE 4QEGA 2H9GA 1IEHA 3JV6B 5A2JH 3H3PL 4P2RE 1GOHA 3VXTA 2ZUUA 4UTBL 43C9A 3KYMA 3MZTA 4FQPA 1A4KB 1TJGH 4DKEH 1I7UA 3DV4A 3T0XA 3SE3C 2R0LL 1PX3A 4XNYH 4P5TD 4TNVF 1QHPA 2WIIB 4K23L 5FO9B 4QF1B 4DWHA 2IFGA 3D3VB 4LCCC 3T8XA 4PPTA 5GGUA 5FYJE 4RGNB 3O8XA 1MUJA 3MUY1 4LIQE 5AZ2L 1IAKB 5ADOH 3VXRD 4XAKD 4TUOA 3I84A 5GGTH 2VWEE 1IL1A 1FYTD 3FL7A 3MLZH 1S7UB 1BF8A 3TA3D 1XR9B 3FOMA 3NIGF 3OGCB 4N8VG 3QEGL 4LLWA 4NQEE 3N9GL 2BSSA 3VXPB 2IJ0C 1MQKH 5I75C 3PXHA 4MLIA 1ZA6B 3FZUD 4MMXC 1OP5K 4HT1H 1S78C 1IE5A 1UWGL 2XN9D 4PJEA 1I1AC 3HC3L 1YECH 4BZ2H 1G9MH 1D5BB 4OCWH 4RFEB 3X13B 2D7PA 1EMTH 1UM4H 3AC0A 3SDAA 5JHDA 2NTSP 2VC2H 3FONA 4N90E 1BZ9B 1XF4A 2HT2C 4IRJB 4KUCD 3BGMA 1NUDA 4WWID 1QSFD 4YGVA 4LIQH 5T5NF 5GGRB 5C0JB 2GW5A 2YZ8A 3LHPL 1UJ3B 2K7PA 2XI9A 1X44A 3RY6C 3KLHD 3QA3A 2A6DA 3NOIA 3WLWC 4QT5A 4LFHG 2FSEA 2H32B 1FNSH 5HHNB 4PJ8D 3GK8L 3LKNA 3ARFB 2BHZA 4RZCB 4MDJA 1JNJA 5DK2B 4ZFOB 5L8JB 3H7BB 1F6AB 4RAUB 2R4RH 2PO6C 5C07D 3HAEA 1IQDA 3QCTL 1U3ZA 2ZG2A 4GRMA 4R8WH 3PWPA 4KK5C 4UQ2A 3SOBL 3WFBL 3BN9C 5JIPA 4X9HA 1FSKB 3RVXD 2NW3B 1QBML 3KPLB 1YEJL 3V5DB 5J57B 2X1PA 3MLXL 5IB2A 1LEIA 2YN5A 1DL7L 1YJDL 2J12B 2W0LA 5D1XA 5FEBA 5FGBA 1XCQA 3WS3A 4IOFD 3FT4A 4NQSA 3U6RB 2NPLX 1O7SA 4QXGL 1ACYL 2VLKE 2EIDA 5GISH 2CKBH 1RQ5A 4FNLH 3B8SA 1MJ8H 4YZFE 4HFUH 1QFPA 1CU4L 5J11C 4YX2L 4XPAL 5DRNA 3TNMB 5EDXA 4KK8D 4U7MA 5JNYB 2ITDB 1J11A 3PWLB 1FN4A 3T1FB 4PRNB 3U4AA 4WO4A 4S0SD 1U8KB 4ODBD 3BQUB 4KDTC 2C7UB 3DVFA 5L2JB 3QWOB 3ZE2F 5DHYA 3AU1A 2ATKA 5KS9B 1FZKA 4AEHL 1FC2D 2ARWA 4QGTA 1ZOXA 3O81A 3BZDA 5ERWA 3TPKA 3DIFA 1IFHH 2IBZX 3T4YB 5IG7A 2XA8H 3WKMH 2A6KB 4IS6B 1FH5H 1WCQA 5DQ9A 3K1DA 1CF8L 2BNQA 3VRJA 2DB8A 4U1IB 2EIZB 2J7LA 1C16A 4JFYA 2HT3D 3E2HC 3KLDA 5ACZA 4Y4KA 3QQ3B 3E6FA 5FYJU 2YK1L 5AUMA 1RURH 5JW3H 4Y19E 2V5SA 3VW3H 1HXYB 4WV1A 5CILH 5F88B 3PGCA 3H9SB 1KGCE 4KUZL 4Y5YA 3VXRE 2AXGB 4X6CA 3GI8L 4HKJB 5I1EH 5D71L 3T77B 4U1KB 4Y5VB 2OZ4L 2HTLC 1FYTE 4UOJA 5BVJA 4BM7A 2NY3C 3STBA 4X4YB 1A7NL 1WEJH 4MNGE 4P2QE 1CL7L 3EO0A 5GGQL 1GHFH 2HWZH 1EGJH 4R4NC 1QNZL 4DAGL 1NLBH 3WBDA 3GSQA 4MA1C 4YDKL 5SWZE 1EK3A 5E4IA 1BVKA 5I1GL 3W2DH 3WE6A 4R6UA 3O2DA 1WZKA 4L9LC 1KF9B 4G9DB 3NIDF 4KHTL 4JLRB 1MI5D 2ZZUT 32C2B 3MCLL 1E0OB 4NT6B 5EO0A 4OIIH 3OJVC 1OAKL 1S9XB 4Q2ZB 1F00I 1QSFE 4Q6IA 2VWEC 3PHQB 1ZE3C 1BP3B 3KYAA 1DBAL 4K71B 3DROB 5K9QG 5FK9A 1AIFB 3QIBD 4ZOEA 4O9HL 1R3IH 3CFBA 4LLMB 1KJMB 4A6YL 1H15B 2H8PA 2MFNA 2IQ9L 3ARGD 4XI5C 1KN4H 2E7HA 2VLMD 3ZHKA 5ESVA 3CFDA 4ALAH 4ZFFB 4DGVL 4PJ7B 4PJHA 4X9FA 4YPGB 1RMFH 3NACH 5C07E 5LBSH 2CDEB 4N0FA 2EXWD 2VDQL 2VZ1A 5D5MF 3RA7H 2E8YA 3OKLB 4LSRH 1YUHB 4JZNB 1AI1H 2DQIH 5B8CA 3MR9B 2WANA 1YEEH 4JFZL 1Z3GL 2EDXA 4I77L 1ZHLB 2H6PA 5KANI 4DK3A 1RK1B 2UZYB 1XF3A 1OM3H 5E2TH 5DJCB 5C9JB 3S3SA 1JPGA 1ZT1B 4QY8B 1FFQA 1MCNA 4JKKA 4LLQB 4NKOA 4Q58C 5JQ6H 3G08A 3P2TA 4O2CA 5D7JA 4QRQA 2HLAA 5CSBA 1LP9A 3F6IA 1X4XA 3QG6B 2XRAL 2NY5L 3OKNB 5T1MB 2KPNA 4NQCD 4HHAA 2R8SL 4ZFZB 4WCYL 5ADPH 3QUXC 2YPVL 2YD3A 2YWZA 3NN8A 2HVJA 3HMWH 3EYSL 1U3HA 5I9QB 3P4MA 1BM3H 5HI4C 3RWCA 4LSSL 4HUXB 1CXLA 4R2GD 3RBGA 2DMCA 3DXAA 12E8H 3MGOA 1F58H 5GRUL 3D2UA 5DRXB 5E4EB 4GSDH 3DHMA 4RDQF 2OR9H 2R29H 1N5AA 1F6LL 4MJID 5GSRA 1GCFA 4RGMC 5GRYA 3GBNH 3O9WB 2AQ1A 4Q9QH 3L9RA 1Q9OB 4GXVH 5DGQA 5IOPA 3Q5YA 3DNKA 4XX1G 5L6YH 5DWUL 3HZMA 3BYTA 2XTJB 4HXBL 3MJ9A 4PLKD 2D03L 1F4YH 3TVMA 1PDKA 1Q9KA 2EC9U 4Q0XL 4GOSA 1T0NA 4ETYA 2HKFL 1GIGH 1NGQH 4HJJH 1OAQL 3RKDD 3AREC 2IALB 4XBEH 4OGAC 3BZ4B 3INUL 3Q0HA 4W6XB 1W0WB 4PGEB 4HGWA 2YSSB 3ZDZE 1QG3A 5L9DL 4DTGL 4QCIB 3UBXB 3K74B 5TE7H 5HTSA 5CEXB 5JMRA 4NZRL 3G5XA 1U6AH 4DVRL 4Y4FA 4EDXA 1YEFH 4M6ML 4I2XE 4NKMB 2EH8H 5HPMA 1FDLH 2YBRA 2EXYD 5EU3B 1H3XA 3O6KL 3L3DA 4R3SA 5J3HC 1LNUB 4J8RB 5JPMA 4XAWL 1JGVH 5CJQH 3V6OE 2XPGB 1JI1A 4G8GA 1JGUL 3U4EB 5FUOL 3L3KA 1TDQA 1KTRL 2IAMD 1KN2L 3BWAA 3L3HA 3TCLA 3MRFA 3VCLA 3TA3C 1OY3B 4F37K 3QAZC 2FX7L 5ILTL 4P0DA 2YD8A 2K1MA 2FEDC 3ALXA 2H26B 3D9AL 1S7TB 4R4BB 1I9JH 1Y6NR 1LDPH 4ODXB 2WMPA 3V8OA 1UADC 5EOQH 5I17B 5C0BA 3QUZD 2O5ZL 1AR1C 3LN4A 4AY0A 4DN3H 4CVZB 3QQ9C 1NCWH 3BZEA 2DQEH 5F3BB 4POZC 4FXKB 3TPUB 4GRWE 4MQXD 3MACL 3VXOA 5B39B 1QUNA 4N1EA 4ODTH 3VRIA 3O3AA 2CUMA 4LCWE 5ICZB 3DGGB 3S34L 3OG6B 3AFLA 4OFDA 1N8ZB 3QWRD 3K4DA 5MEPB 2NX5B 3TO2A 3QO1B 4NFCA 1IGIH 5ESQA 3MV8A 2JK5B 4H8WH 1S9WB 3KLHC 2XIDA 1AGEB 2P43B 4HMDA 1GVIA 2A74B 3BKYH 2A73B 1PEZA 1JGEA 4H5SB 3QDJB 5JW4R 4PJ8C 1IAIH 1TZGH 4P59L 3UTSD 5K33A 5GIRA 3BUTA 5HHOD 2F5BL 4XCYB 2JTDA 2Y36H 1A1OA 5JA8B 4NQCE 1E4KA 2QR0A 5EU6B 2MQCA 4AM0A 1U95B 2CMRH 4KRLB 4GKSA 3EHBD 3NTCH 1VEPA 3ISWA 1Q9LA 2DL9A 1LO0H 4KPHL 3VI3E 4L3EA 1V7NL 1IT9L 4NBYB 2I07A 1J8HD 1LMKA 2DTMH 3N1MC 1UZ8A 3EOYG 1EJOL 3WFEH 2EDWA 3QO0A 4IOFC 1T20A 5C2BH 5KSAB 1DQLH 2FB4L 4J4PA 4MCYA 2FJHA 5DUBB 1ZTXH 5E03A 5C7XL 3TBTB 1N64H 3BP6B 4MJIE 5ID1B 4GG6B 1KC5L 4LCIL 4H1LG 5DMIL 4MNQB 4LASH 4PY8I 2HJFA 4FFZL 2OQJB 3M07A 4KK8C 1FG2A 4AZ8A 3CUPB 1YEHH 4LGPB 5SX5H 2DLFH 1G7PB 4HMEA 3BD5A 3ZKND 5J12B 3QNZB 5C0IA 5D8JL 3L3JB 3TV3L 4BSJA 3C09C 1TETL 1KG0B 1JCKA 1WWWX 1IC5L 3IFOA 2IMMA 3GMLA 3D25A 3WIIL 4E42B 3N1FC 1HDMB 5F96L 1EFXD 4O58H 1R3JA 2NYYC 4HPOL 3MRPA 2CRMA 4CADB 3RL2A 4YO0B 2QQLL 2HT3C 4P4RB 5HYSG 3RRQA 1ND0B 2Z31A 2B1AH 5FV1L 5EN2B 1IKNC 2D3VA 2F19H 1WQVT 3LSOA 4O2FB 1OWRM 1MFCH 3HS0B 3U9PL 4V1DE 1WC7B 3AB0B 2BP3A 3BUYB 3P4OB 1YA5A 3OAYH 4JQXC 4QF1A 2IADB 4YBHA 1KTKE 2GJZB 2XNAB 4GRLA 3SGDH 3PQYB 1MAMH 1IARB 5KZCB 4WGVB 4IIQB 1IC4H 5L0QC 5BZWB 4K3JH 1OAUL 4JRYB 3ZE1E 1ZGLP 2NY1D 3U0WL 3WCYA 1H0DB 1MPAL 3IYLW 4L29B 1XF2B 3J7HA 3V6OC 4JANA 1NFDF 1IC1A 2V2TA 4GKZB 1QSEA 3MOAH 1JYVA 5DDHB 4RNRB 4XVJL 4JM2B 5AAMA 3NABL 1ZA6A 5A16B 3CD4A 4YWGL 1QYGL 3CDGB 1L7IH 2KZWA 3IXAA 1D5BA 3FB5B 1H5BB 1DVFD 3FO1B 4IRJA 5ECJE 3UTSE 4C56E 4B50A 1UC6A 4DGYH 2KKQA 3LOWA 2AW2A 5BZDB 1U58B 1KLUB 4OB5H 4DKEL 5MENB 3OAZH 1F11A 1XR8A 4XPFH 4F7PB 2DQFB 5E6IC 1MHHA 3KPNB 4XNYL 4LLAA 2LV4A 1DZBA 4OQ1A 1F3JB 4AG4L 5HHNA 2Z92B 2FGWH 4RZCA 1AO7A 1UWXK 2A9MH 1TVBB 3BXNA 4L3AA 3H7BA 4FTVB 4OLYH 2ICEA 3W9EB 5E9DE 2X4UA 3QJHA 5EUOF 5D7LE 2QJDA 3VD7A 3FTGA 1MH5A 3BRFA 3L95B 1QACA 5KSUB 2DLIA 5FYLH 2NW3A 3PHOB 5I8KH 3IKCA 1FNEB 3V5DA 3MCKB 1JFQH 4PJ5E 1GSMA 3RVWD 3TIEB 3QUYC 1KCVH 1A3RH 3U6RA 2D0FA 4R2GC 5LGJA 1LK2B 4HT1L 1L0QA 1K4CA 5C08D 4J3OC 1CXEA 1FORH 4G5ZH 4ORGB 1YECL 4BZ2L 4MB4A 2DQJH 4TTDD 1G9ML 4PJCB 4OCWL 2PCPB 4E41D 5J7CC 1ZLVH 3B9KB 4XMLH 2ITDA 3I75A 4Y16D 4DQOH 3PWLA 5DMJB 3T1FA 4PRNA 4N0RA 5EBGA 2A1WH 4OAWA 4G6KH 5ITBH 1WTGT 4FA8A 3SCMA 1U8KA 3BH9B 3LQZA 2C7UA 5L2JA 3QWOA 2VAJA 5GJTH 4GO6B 5IQ9B 2C5DC 5F9OL 1FNSL 1MCCA 5E08H 3RUGF 4Y1AE 4I8DA 4OZIB 1XIWB 2W0KA 4MD4A 1UYWH 1VEOA 4OSUH 4FQQB 5FDYA 1D9KD 4OD2B 3EYVA 5C0DB 2R4RL 1OGAB 3T4YA 3UCRA 3GMMB 4FFVD 1X5IA 4R8WL 5H2BA 4Z5RB 5D96B 3ARDB 3X14A 3RKDC 4TOYH 4L4VD 4U1IA 4LKCA 3GMRB 4HJGA 1RZ7H 1ZLUH 4TSBH 3QQ3A 4QRTB 3MJ7A 5T1KD 5FECA 1GGBH 1MJUH 1HXYA 3H9SA 3KPPB 4ODUB 5C86A 2WBJD 1PW3A 4P2YA 4YHOL 4IDJH 2EXYC 3HNTH 1FFNA 4X4YA 1GGCL 3MBEB 5GISL 1NAMB 2NXZC 2CKBL 4IMKA 4P46D 1RI8A 4HFUL 5DSCA 3VG0H 4FQJH 4UOW1 4TULL 1JUFB 1RK0B 3WN5B 4ZUWB 4Z7UB 4KROB 4QXWA 5DQJB 2CLZA 1T6WA 2Z35B 1ZVYA 4G9DA 4JFED 2VUOA 5DRZB 2AJZA 2I24N 1MAJA 4APQB 1YEKH 1S9XA 4X7EC 4Q2ZA 1A3QA 1T7ZA 3PHQA 2F53B 4LHUB 3M1BB 4JFDA 2FIKA 2EYTB 4MQXC 4JN1L 1IFHL 4ZFGH 4J1UA 4HMCA 4I1NB 4CMMB 3WKML 2APFA 4JJHA 4LLMA 1H15A 3VGDA 4KRPD 3VFWB 1IBGH 2G5BB 5CAYB 4Y4HC 5JIIA 4X7CC 5FM8A 5E24E 3TNNB 5D1QA 4ZFFA 5GGSY 5GRVL 5BS0E 1I3VA 4YPGA 1JZ8A 1DCLA 5E8NA 4EI6A 3EAKA 1RURL 3FFCD 1NGWA 3RGVB 3F7PC 3VW3L 3LKRB 4JZNA 4MXWL 5I1EL 1S7SB 3MR9A 4CW1B 4OF8A 2HH0H 1Y6KR 1WEJL 2Q8BH 1U8JB 1OSZB 1GHFL 2HWZL 1EGJL 2WP3T 4GBXC 4HQQH 1P7HL 1NLBL 4XNXH 2OJZH 2Z8RA 4OLVH 4Y2DB 5I73C 3EHBC 3MV9B 3V52H 4UNVA 1ZT1A 5C9JA 2OCFD 4QY8A 5GRJH 1BGXH 3W2DL 4OKDA 1EPFA 4XVSL 2BVPB 2P49B 3QG6A 1MCBA 4KH2A 2XWJA 3SDDD 4PRDB 3MRQA 5EO9B 3HHRB 3PL6D 3D18B 2V7HA 2VLLB 3DVIA 1HEZB 3IDGB 1NSNH 3VH8A 3TYFB 2F54B 4BQCA 4HUXA 2A83A 4WW1B 4JPVH 2DKMA 4Y0GA 1R3IL 3U7AA 4EXKA 4YR6A 4MD0A 5MHSD 1FC1A 1KN4L 1P4BL 4G6FD 3ZKNC 2BCKB 3QXUA 4ALAL 3X3GH 2PYEA 1XGRB 1P7QB 4EJ1C 1R3LA 4LHJB 1RAMA 5LBSL 3S97C 1IGJB 4LSRL 4OUOA 4TUKL 4Z77B 4PJXE 3EDFA 3BMVA 5F1NB 4HCRA 4L4VE 1AI1L 1I9RL 2DQIL 3VXNA 5CP7A 1VESA 1YEEL 2UVEA 2DI7A 2FDBP 4Z7VF 2WUCL 3M45A 4QHKJ 2VQ1A 4M48L 2Q76B 3OMZA 3FMGH 1AHWB 5C8JB 1MLBB 3FQXA 4LMQI 5JQ6L 4DZ8B 2EIBA 5DJAB 1T7VA 4X98A 5GRVK 1I9EA 1L7TH 1W0WA 2DMKA 2YSSA 4NZDA 4QCIA 4X4XB 5D5MA 5E0QA 5ADPL 4JFFD 4NP4H 5CEXA 1IGYB 3MFFB 4P5KB 4OLWL 2JELH 1RD6A 4JQIH 3HMWL 4NKMA 1I3RB 3QIUC 1DN0A 1BM3L 1VERA 2LVCA 4W70A 3X12A 1YPZF 1U3YA 5I76B 2FYYB 2O26U 3LH2H 4YUEH 12E8L 3OX8A 4X6BB 1LNUA 1GL4B 2XWBA 3VWJC 3QI9D 2XPGA 5SX4H 3WFZA 2OP4H 3S3PA 2R29L 1KB5B 1I7RA 4N0UB 3I2CL 2ESVA 2R56H 5C6TH 3KPRA 4OZ4A 2BVOA 4KY1L 4FQ1L 2W65B 2YKLH 4X99B 4Q9QL 4NQDE 1S7TA 5HI3C 4GXVL 4XBGA 3IJSB 5IW1A 3C9NB 3C5SA 4KKLD 1PSKH 2QHLA 1J10A 5F3BA 1XGTA 4FXKA 2MCG1 3HG1E 1F4YL 4H25B 3TPUA 2DYPB 2YUWA 3FFCE 2Z9TA 3IKKA 4PRHE 1CLZH 1DVFC 4JHBA 1PD6A 1S7XB 1NGQL 1ED3B 4HJJL 1A6WH 1VSCA 3DGGA 1N8ZA 2VDPH 1I8MB 4YQXH 2V9QA 3RWIA 2NX5A 1G7IB 3TZVB 3QO1A 3QHTC 1VFOA 3O6LH 1W72B 3KPQA 1SJXA 4KI1A 5TE7L 5C0FA 1IMHC 1U6AL 1ONQA 1U8OB 2DF3A 3QDJA 4H5SA 4LVOB 3QZWB 3UMTA 1YEFL 1NMCC 1XGQB 3T2NH 2J8OA 2M8XA 2KH2B 2GSIA 3PWVB 2AJXH 2EH8L 3TBSA 3KXFD 3FQNA 1FL5B 2H32H 2EDKA 3AM8C 2J2ZA 2W07A 1M6OB 2CK0H 3GSXB 1I1RA 3QEQA 4JQVA 5IM7B 1VPOH 3MJ8A 3DRQB 1ZWIA 3QFJD 1GOFA 1P4LB 3ZKXB 3LEVH 1AGCB 2FGZA 4K07A 3CMGA 2EE2A 2R2HB 3V4PH 3T4AA 2ZJSH 4I0KA 4NFBA 3ETBF 4KZDH 5KSAA 3NPSC 4LVNC 1JHTB 1P6AB 1IEAB 5DUBA 3BP6A 1EEQA 3NH7H 1JZ4A 5ID1A 5T5FH 1SYSB 2X1WL 4GG6A 4TTDC 2GY7B 3SKNA 1HKLH 3VA2C 2OQJA 2MWCA 5I18H 1QR1B 3CUPA 3ULUL 1IM3A 1RUAH 5EA0H 1JYWA 4LK4A 3C2AH 1CG9B 1F02I 1TCRB 4M7JL 3C08H 4LQFL 1IGIL 4U1SB 4H8WL 5IVNA 4GRWF 4I5BB 1WVZA 4X9GA 1C5DB 3L3JA 5DD3L 4JN2A 5F89A 2WWKO 5IGXH 4FQXA 3RWEB 4LU5H 3KPMB 3VFUB 3MQIA 3UPRA 1N3NB 4JY5L 5CSZA 1TZGL 4XVUD 5KSBF 1KOAA 4E42A 5SWSD 2AI0L 1H3GA 1D9KC 3P4LA 4WU7A 3W5NA 2EIEA 5K9JH 2P48B 2NY4C 8FABA 4RFNB 2H2SD 1XT5A 3C5JB 4JEGB 2OM5A 3GSWB 4JRXE 4OQTL 5D6CB 4L4JA 1RY7B 4S1DD 3NTCL 3S7GA 1PYWB 4PGBA 2YUZA 2X42A 1N6VA 4N5UA 4ZNCD 3MRBB 4K7PY 1RZGB 4O2FA 1TPXC 4EN3B 2E7CA 3HS0A 5I1KH 3RIFK 3WFEL 2WBJC 5HVFB 1DEEA 1WC7A 5C2BL 3O6FB 3WSQH 3SGEH 5FDWB 1ZTXL 4OGYH 2IADA 2ZUVA 2RBLA 2GJZA 5F7EH 1PKQE 4P46C 3PQYA 1Z9LA 4LASL 1XFPA 5INCB 1NJ9A 3LRSA 2O93L 4IIQA 3CLEH 1QFWH 4R26H 5ANMB 2DLFL 5FYKL 3LD8C 5ISZA 4LRNL 5FM4A 2AGJH 5AYQA 3C6LA 5JO5A 4F7EA 5IVXB 3DSFL 2R1WB 4YHLH 1VDGA 1H0DA 2O61B 2C1OB 2NY2D 4I0PD 3S5LG 3C5ZB 1JK8B 1W8NA 5DDHA 4JM2A 4U6VL 4YGAB 5CJXC 4G6JH 4LLUA 3CPLA 1K2DB 1KTLA 4ONFH 1XH3A 5H8DA 2AXHA 1HCFX 5DFWH 1M7DB 1ZEAH 3CDGA 4YK4C 4WDIB 5DEGB 1H5BA 4PJGE 1LO2H 4M8QB 3ARVA 2KZ1B 5E6YA 3Q6FA 1FL3B 2ZNXA 1U91A 3L5HA 5HDLA 4HLZH 3T0AA 2EDDA 1OLLA 1ZS8A 1KLUA 1Q72H 2F19L 4F7PA 1VKXB 1BD2E 1MFCL 2ZSVB 4Q7DA 3GRWA 1U9KA 3LS5H 3UBXG 4MAYB 1NL0H 1YMMD 4NBXB 2Z92A 2NXYD 5D1ZD 5DHVB 4NRYA 2WQ8A 2VABA 5E94A 2L0DA 1TVBA 4JDZA 4JY6A 4OZHB 1MCEA 4L4TD 3SE8H 3W9EA 3WO4C 1MAML 1IVLA 2YD1A 3JV4A 3MRJA 5E00A 1CD1B 4PTTB 5C0CA 1QFHA 5F7UA 5E1AB 1IC4L 4BQ6A 2B4CC 4ZSOE 2H2PD 4WW2F 1AR2A 3ES6B 3I02A 5I8OH 3QJFB 5EU7C 1X5ZA 4MYWB 3IXTA 2VR5A 3PHOA 1FNEA 2BC4B 3PL6C 3MCKA 3I9GH 1HINH 3LIZH 3HMXH 4UI2A 1KULA 2XWTA 2RIKA 5JXEA 3MOAL 1F4WH 1D6EA 3RY5A 1CDGA 4BSVB 3QDME 1ZK9A 3BJLA 1WICA 1XGUB 3EOTH 4FFYH 1LK2A 1S7QA 3RPIB 1F8TH 4P2OD 3ZDXE 2XZAL 3U1SL 1A47A 3RP1A 4DVBB 2PCPA 2YPKB 4OTXL 5DLMH 1ZHKA 4PBWD 5B39G 3ULVE 3GMPA 2HMID 1T3FB 5EIQA 4DGYL 4YHML 4KKAD 1UENA 1M7IB 3UYRL 2WW8A 2K3TA 3WYRA 5M7QA 4XPFL 1YMHB 3SDXF 3K81A 1ZHBA 5IQ9A 3PV6B 1NFDA 1CXKA 5C0EA 4MVBC 1OCWH 3GIZH 3VI4E 1XIWA 2FGWL 3D0VA 4NNXB 3WFHA 1N6QL 4FQQA 5IHBA 1FZMB 4OD2A 1D6VH 4OLYL 4X6DB 1G7JB 3FQTB 3CC5B 5C1MB 3ARDA 2EEDA 3VDBA 5F1KC 2AAVA 2DIBA 3WL9A 4PJ9A 4YHKH 3LDBB 3OPZH 5I8KL 1IEBB 4HUMB 2I9TA 4P4KD 1VHPA 4Q9RH 5HGHB 1MRFL 3ULUD 4PJBF 4OFKA 5IFJA 3IU3A 3OAYK 1H3VA 1A1NA 4ODUA 1KCVL 4NKQB 1A3RL 5CGTA 2WV3A 1NAMA 1PQZA 5JHDD 2IQAA 1FORL 3HPJB 1HILB 5HDBE 1MRCH 3M17B 3V7AE 2DQJL 4HK3N 5C09E 4M93B 3QI9C 5DYOA 3KJ4B 4R7DB 5EUOA 5IFHL 4PJDB 1JUFA 4U33A 5T1LA 5I1JH 2CLVB 1ZHNB 4XMLL 4ZUWA 1S9KC 1YYLH 5DQJA 3K3QA 5BJTA 2A1WL 3H3KA 2J88L 3T2PA 4OF3A 1VGEH 3QDAA 1WAAE 4YPJA 2EEBA 5KVGL 3RWHB 4M7LH 1NUFA 3EZJB 4KKLC 4RMVA 5E08L 4NQUA 2F53A 4LBEB 1UYWL 4OSUL 1L6XA 5KG9B 4L8SA 2EYTA 3PWPD 4F37F 5D2NB 4PRIA 4XPTH 4GG8A 5KJRH 2AK4E 2MSPA 1YEDB 5AEAA 4TSAL 5DMKB 4GJTB 4TOYL 4P23C 2P5EE 5T1DL 2LVEA 4OD1H 3K2UL 5DURB 1XF5A 1T1YA 1KIQA 4TSBL 3DBXB 3IFLL 4LF3B 2Q6WA 4YAQB 1DBMH 4WUUB 3TNNA 3OAZK 2AJUH 4JREC 5EPMA 5INDB 1WISA 2XICA 2X70A 3RGVA 3JV0A 4M8VA 3SDXB 1RUQL 1E28B 3GJFA 5FYKD 3KPSB 1S7SA 5KAQG 3JWOC 2R0WH 3RUGA 3T1WA 1I1FB 3P9MB 2IAND 2BX5A 1G7HB 2HJLA 3VMOA 1BVZA 1U8JA 2CUIA 1JNLH 4OZFG 5E2JA 2ILLA 1BX2B 3VG0L 2EDOA 3QFDA 1O7VA 4GUPA 4FQJL 5IJKC 1CDBA 1EAJA 5F93C 4HV8B 5DFVC 3QXAB 4X7FC 3VDCA 3EJZD 1KTDB 2Z93B 4UILL 2W9DL 5EO9A 4CJ1A 5I30L 3GSVB 3D18A 2IG2H 3ZLQC 5IQ7H 2BOCA 3IDGA 5DVKA 1EEYB 1YEKL 1AKJB 1EA9C 3TLRA 3NIFE 1FNAA 5TQ0H 3O0RL 3A6CL 3FO2B 1KSRA 1I3GL 3OV6A 2F54A 3DWTA 3BESR 1K4DB 4BQBA 2E6JA 2BNQD 4TVSa 3SGKA 2HLFC 1D5IH 3AY4A 5HYJB 3ME0A 1BVLB 1A7PH 5AAWA 3OG4B 4WUKL 5DR5H 1B6DA 1A9BA 1XGRA 2ICES 3A67H 3WNKA 3ULVC 1T1XB 3STZA 2VLRD 4UB0H 4KQ4L 3VGEA 5F1NA 1GH7A 1OARL 2YHGA 43CAA 2X4RA 1OTTD 1FFPB 4MD5B 4R7NB 1DE4B 3CFIC 5J1SC 4M43H 2Q8BL 4JDVB 3V2AR 5HBBA 1WUNT 1NC2D 5FV2A 3ARBB 1XAUA 2EYSA 1HQRB 4HQQL 2OJZL 3DETD 4XNXL 1FZOB 4PJAB 3RTQA 5GRJL 1BGXL 4NJAL 4PJEE 5FFLA 1OTSD 2A77H 1T1WA 4HF5H 1ZLUK 5ALCH 3IRZA 1G1YA 4DZ8A 2JB6A 2DQTL 2QSVA 1CR9H 1J1OH 5JHDE 3BKCH 5IROA 4F7TB 4EQ2A 5GS0L 2XY1A 5SWQA 4YC2B 3MNVB 3RU8H 2LTQC 5HHQA 4P5TA 1NSNL 1R6VA 1V3JA 3CFJA 1A7OL 3O3DA 2X4TA 5I76A 4JPVL 5K9OA 4RISH 4UU9B 4MWFB 3T08A 1J12A 4IOIB 4KTEH 4LSPL 4M5ZH 3G6JB 5FB8B 2M2DA 5IR1A 5K59E 1J5OH 3G04A 2BRRH 3MJGX 4XP4L 2Y5EA 4OZFH 5M94B 1MJ7L 4DUWA 1KB5A 1J1XH 3X3GL 1HHGA 3IDYC 3S98A 3PWPE 1KXQE 1FFOA 3QNXB 3KS0H 4RMQA 2VUYA 1P7KB 4M7LT 5BW7A 1SM3L 2NY2C 4I0PC 5DS8B 3LVEA 4X99A 4JZOB 4YDIH 5JR1L 1CIUA 2XACC 3IJSA 3C9NA 1MFDL 3MRHB 1YZZA 4QRSA 3G5VB 2BJMH 2YD9A 1AGFB 4QOKD 3DPBA 5DI8B 3EDEA 2GFBB 4G42B 4KI5E 1S7VB 2XN9A 4PJIB 1BECA 5D7IF 3KG5A 2CGRL 5D7JD 2IEPA 1ED3A 4NQVA 3GI9L 3VXUB 4YDLC 1UKSA 3DMMD 3WO3B 4JHAH 2DD8L 3F65A 1L7TL 2NTFB 5D7KD 4LPYA 1KIUA 2XZCH 1IC7H 1W72A 3QXVA 4NKIL 3RIAF 3VXMB 3DX6B 1U3HD 4GQPH 4OV5A 4NP4L 1CZ8L 3MRRB 4V2CB 4WFGD 1U8OA 3MOBH 2DWEA 2JELL 3VMNA 5D1ZC 4JQIL 2P4AB 4EI5B 4Z7NF 5CJOH 3DXAD 3GMNB 3W9DA 4OLUH 4Z7VA 3LH2L 3JTSB 4LKXA 5B21A 2X4QA 4TSCH 5FCUL 3D48R 5IEHB 2BDNH 2I25N 5A43C 5C6TL 1QEWB 1PLGH 2YKLL 2OX5A 2VDRH 2BNQE 4UQ3A 1TCMA 1MCFA 4NDMA 3L5IA 4FQCL 2PF6A 3ORJA 2MNUA 5FA4A 4BQ8A 2ID5A 4XHJD 3PV7A 1MEXH 1JHTA 2DQCH 1IEAA 1PSKL 3OR6B 1K3IA 4M1DL 4M00A 1YPZA 4HKXA 4LHUG 3T3MF 4X6CE 3FQUB 2VE6B 1D5MB 2HMIC 3MLTB 1CLZL 3T0EB 1QZ1A 1A6WL 4PRAB 1QR1A 2APWA 1RIVH 1I1CA 1DDHA 2J8UF 4HIIB 2XFXB 1C5DA 3O6LL 4W6YB 5CBEB 3ZE0E 4Y4FD 1PFCA 3VFUA 1M1SA 5T3XE 4M7KL 4MMZC 4GKNB 3JWDC 2P8PB 2Y7QA 2C3HA 2Y1VA 1N3NA 3T2NL 4K2UH 3O8XC 3R06B 3FRPG 5IB4B 3UDWA 5JPNB 3C8HA 3HNVL 5DK0B 3IDMB 1F45A 4FQIL 1QVOB 4YE4L 4G8GD 1PVHA 3V6ZB 1F2XK 3E1F1 1FE8H 3KJ6H 2J6EH 5D6CA 5D7IB 1ZMYA 2CK0L 4LCCB 5HGBA 2IPUK 4K94H 2A2QT 4F2MB 4ZFOL 3MGTB 4U1LB 3ROLA 1W0YT 3V4PL 1RZGA 3NFPB 3SHSA 5EBMB 5C0BD 4EN3A 1JNHA 3ULUC 1IILE 2OSLB 3GSNA 4JPKH 3V9FA 4KZDL 4MQ7B 4PJHE 5T3XH 3F12A 3HC0A 2K9UA 3O2DH 1CGXA 5HHVL 5FDWA 3LMJH 4WY7H 1G9NC 3CNKA 5F70A 3NH7L 3SDAC 1GJIA 5T5FL 5I75B 2JCCF 5ABDE 4GW1A 1HKLL 3HFMH 5INCA 2GK0A 1HSAA 5EH1A 5IWLA 5I18L 1I1AB 2CR6A 5D7SH 5EA0L 4CNIB 3C08L 4HUUA 4ZO8A 5B22A 3DV6B 5F1SA 1A0QH 5IVXA 1AGBA 2QSQA 4PB0L 5IGXL 4G8FB 1MI5A 5FYKU 4NC1E 1ADQH 1F42A 1LP9E 1DLHB 4FQHB 1J86A 2VQUA 3ALPA 3V95A 1UXSB 2C4FU 2FO4B 5GS0D 5K9JL 3FKUS 3QEUB 4HK3J 2ZPKH 4IHOB 4KKCD 3BDYH 3S3JA 4R0LA 2IGFL 4OCXH 4M8QA 4WFGE 5DVMA 2HRLA 4L3ED 3MLRH 3ARGA 4WEMB 3NZ8B 4PRBB 4DCQA 3DXAE 3TC9A 1NC4B 2FJFB 4JG0H 3H7LA 5D1XC 2J8UB 4KI5C 4LMQE 3CXHK 5FGBC 4YIQB 5TJWK 1CE6B 5IKCB 3MV7D 4KKNA 2ZSVA 4HJ0C 1MF2L 5I1KL 1A1MB 1QBAA 5DVOA 4F33B 3F58L 5KSBA 3NFNB 4ZS6D 4K3HA 2GUOB 4OGYL 5DHVA 3BGFC 3IDJA 3D0LA 1NCBH 1T0PB 3F62A 4PLJD 5B4MD 3F7RA 4WO4C 4KJQD 5CJBA 2VN4A 4NIKB 4PTTA 5E1AA 3RVTD 5EU4B 3KR3H 3ES6A 5TH2B 5KSVA 5J11B 2AV7A 1JF1B 5F9WC 3KHQA 4DEPC 1G0DA 1NUNB 1OQXA 3EJZC 5D2LF 4WFED 4YHLL 2BC4A 3QUKA 1P5UA 2R23B 2R69H 4HWNA 3F7VB 2AXJA 3Q1SH 1NEZB 2FO1A 3PJSB 3VGAB 1C12A 1BBJA 5JW4N 4BSVA 1N6UA 5JOEA 1NMBH 3VXSD 5EBWB 2PR4H 3MGAA 4KJWC 3PGDA 4ONFL 4MA8H 1Y0LB 1ZEAL 1F4XH 4Y4KC 5IHZB 4X8JA 1I4FA 1KENH 2YPKA 4YLQT 1LO2L 1CBVH 1MY5A 1T3FA 3U83A 3BRGC 4WV1C 3MJ9H 1BAFL 1M7IA 4Y5YC 1XMWA 1Q72L 5C6PB 3UP1A 4HWBH 2E5EA 3FCTA 3MRMB 2Y5TB 4EUPA 1FYHB 1NL0L 4PBVC 3D3VD 1RJYB 1DP0A 4P5MA 1ZLSH 5J6GB 3QZWG 4RGND 2X1OA 2QADC 3GBML 3LKQB 4X80H 3ZHLA 5C0ND 4P2RB 3SE8L 1G7JA 3FQTA 1T21B 5DJ6B 4QRPA 3CC5A 2NY3B 3LKPB 5KVDH 3UJTL 3TIDB 3RL1B 4PP2A 1OTSC 4M1GH 3NBNA 2KQMA 4WHDA 5E99H 4MA1B 1QQDA 2CIIA 5H94A 3E0GA 4Q6IC 3I9GL 1RUPH 1HINL 2YS4A 2R2BB 3LIZL 3HMXL 5J6HA 1JRHH 4Q97A 35C8H 5HY9B 3MV8E 1NGPH 4FQLL 3CX5K 2D7QA 3PIQA 4FFYL 4HS3B 1F8TL 1WTLA 1TJIH 1EFQA 3HPJA 3UC0H 1G7LB 3CJJA 4IRJD 3WXWH 1R24B 2D7OA 3K4AA 5DLML 4XC3L 1A2YB 4WEBH 4PJDA 1ZHNA 3SO3C 4NKDB 4NQEB 1UM6H 2IAMA 4WW2A 3UJJH 2C3VB 5D6DA 1YEIL 4AL8H 5BXFB 4NGHL 5IBLD 2E9WA 4EDWH 4HUWB 1NMAH 5B8CC 3ZDXF 1YQ2A 5EBLB 1NBYA 3KPOB 5IF0B 1Z9MA 4OGXH 4LEXH 2PW1B 4YHPB 3ARFD 1AO7D 1OCWL 1JE6A 5MI0C 2UUDH 4L3EE 2VDLL 5F6IC 3QUZA 4R4FH 2HFFB 5CEZE 4ELMF 1D6VL 4G6ML 1KCUL 5J1AB 2NY7H 4YFLF 3OXRB 1INQB 4HCRL 4NC1C 5D7JC 4HGKC 2ED8A 4PV9B 5B38A 2C9AA 5I1CH 5AZEH 2B0SH 3QWRA 2OZ4A 3HN3A 3KWWA 3BPNC 3GNMH 4S11A 1F6FB 3VG9C 1KEGH 3RI5K 4WUUA 1FIGL 4Q9RL 5INDA 4P9MH 4QTHA 1U3HC 1PBYA 3SDXA 3OKYA 5HI5D 3Q48A 3PABA 3KPSA 2X44D 2FHFA 2APTA 5HHOA 3QUXB 1I1FA 3GO1L 3P9MA 1G7HA 4WFEE 5BOPA 1F90H 4HEME 2XT1B 1N4XL 3IU4L 2VISB 1HYSD 2GSGB 5GGVY 2VR4A 3FB7B 2NY0B 4U2ZA 3MODH 1YYLL 1OSPH 2NNAA 3W39A 1ZSDA 4TRPH 1MFAL 3BQUD 3TYGL 3PGFL 3QXAA 5MERA 5I66A 1F4AA 1VGEL 2Z91B 4KXZH 4QRRB 2VLKB 2X1QA 1J8HA 5MEOB 5EZOH 4RGMB 4XHJC 4U1JB 3TVMC 4PJBA 5FM5M 1HQ4B 2XTLA 4N9OB 2A9NL 1PZ5B 5HGAB 4XB7A 4O00A 3FFDA 3OAUH 2B7DT 4XPTL 1FP5A 2Y72A 3I6LD 5KJRL 3FOLB 4ZPVB 1A5FH 1CGSL 1BVLA 1BEYH 3NGBC 4TPRH 1PG7H 4XP1L 4N1HB 4YXLH 3MRLB 5F9AC 4BA8A 4XC1H 3AREB 1INEH 1BLNB 4Y4FC 3H9SD 2AJUL 5LJYH 5IIEA 4NRXB 2CXGA 3VGFA 2X4OB 5DXWA 4L3CA 4NZUL 3PE9A 5IHLB 2ICWJ 4MD5A 1NCDH 1FFPA 1Q0XH 1KCKA 2R0WL 4R7NA 2SEBB 4N5ED 5CFHA 5BOZG 1QSEE 1EFXA 4MJ2A 1JPSH 2EDTA 3ARBA 1U0QA 1AJ7H 2QHRH 6FABH 4Y19B 2IPKB 3VGHA 2E27H 1DFBH 5DD6B 4OLZL 4KKBC 5JLZA 4UINH 5CWSB 5CMAB 1Z9SA 3HCVB 4OCYH 3FT3A 1JWMA 3MNVA 4MNGB 4P2QB 3RWDB 3TA3B 5IQ7L 3BZFA 2R0KH 4ZUUB 4W4NA 5TQ0L 4PGCA 1G0XA 3BSZH 5SWZB 1DQTA 2VIRB 3BPCB 5HXMA 3NCYP 5JORB 3MLVH 5MEQA 3WUWG 4OM1H 1SEQH 4MWFA 1D5IL 4UU9A 4IOIA 3IJYB 3W0WB 1AO7E 3VFSA 1OQOA 1LO5A 5DR5L 3UPCA 3NIFF 3VJ6B 5F6HJ 5DVNA 4CN6A 1QSFB 4YDJB 5KVFH 3QNXA 2YUXA 4KHXH 4K8RC 2FECI 5DS8A 4N9GB 2N4IA 4UDUA 4RWHA 4GAJL 1E4KC 3MRHA 3MRKB 4E5XB 1JZ5A 1AGFA 4IMLA 3GGWB 3F6LA 4ONHB 5DI8A 1IGCL 1AP2B 2MTPA 1S7VA 1UACH 3QNYA 4KKCC 1CGUA 4PJIA 1EVTC 3RX7A 3MRCA 2EH7H 4WHTA 4X5WB 1Z5LB 3HI1B 3K8KA 3VXUA 4XNZB 2A77L 3CXDH 1WZ1H 1MFNA 1OD7A 5ALCL 1XGPB 1E4XH 4ELKB 1U8QB 2VXUL 3BKCL 4HIEA 4J4PC 4P2CG 5LWYH 3RU8L 2ZOKB 2VITB 1CK0H 1JF6A 3ULUF 2W91A 5DC0A 5E8OB 5BO1H 1RIUH 2DBLH 1E4JA 1NAKH 5HDQH 4JO1H 3S4SG 2P1YA 4YHZH 5HVHC 3NIGE 3QPXL 4DZBB 3V8CA 4OF6A 3QPQC 1ETZA 4M5ZL 1NGXB 5F9JB 2BVQA 1JWUA 1J5OL 5I15H 3PWUA 3V5HB 2EZ0D 2BRRL 1JF5A 1KJ3H 3TBWB 1AQKL 4LSTL 3VFRB 3O9WD 1ZA3B 1OHQA 1X5XA 5TGBA 4LLYB 3GB7B 2LABA 4G8EA 3DX8B 5EFIB 1NCNA 4F7CB 1ZT4A 4YDIL 3WDIA 3CXHJ 5K59F 2HJKB 2XTJD 3B5HA 3C09B 4DKFH 3GSRA 2XQYG 1QSZA 2BJML 3NCMA 3W11C 1PY9A 3H9SE 1WFUA 5C08A 5DEFB 5GRWA 2VE6A 3S37H 3N85L 3BRDA 2Z31C 4E41A 4PRAA 1KNOA 2YD2A 2N7AA 9CGTA 1GGYA 3UZEA 4Y16A 4PR5B 3QULB 1AXSA 2HT4C 1UWEL 4ERSH 4OFIA 2XFXA 2HFEA 2XZCL 1CT8A 4GKNA 4GRLC 4JVUA 3MOBL 1C7SA 1ZLWH 2OBGA 3EO1B 4JY4A 5JPNA 1JPST 3Q3GA 1KBGH 3T65A 3KLAB 4OLUL 5K93A 4GS7B 3MO1B 4XWOD 1CFQB 1DJSA 2DLTA 3DUUB 2ZG1A 1NFKA 4LVHC 5BV7H 5D7IA 4JFDE 2L7UA 2IPTH 1MCRA 5DJDB 4TSCL 2BDNL 1BJMA 5L0QB 1PLGL 4I2XB 1MREH 2VDRL 1CDJA 3NFPA 1U8LB 3BP7A 3U36B 5T1KA 4Z7OE 2FEEL 2OSLA 2NZ9D 1Q1JL 3DARA 3L6FB 5F7FA 3EDDA 4MQ7A 2CDGB 4M4PA 2VR9A 1MEXL 1JPFB 1QLEH 2DQCL 4LOUC 2P47B 2W38A 1GAFL 3EFFB 1KT2A 5KVEL 1UZ6F 3ZE2E 4IRJC 5BCAA 4OCLC 1HHIB 1HNGA 2VDML 1I7TB 4R97B 2NX5D 3HR5B 2VOTA 2OTWA 1CN4A 3V0AC 4L8DA 1QA9B 4O51A 3CDCA 4K7PH 3ZKMC 4HG4J 1ZT7B 4L8CB 3MLWH 3QDJD 4K9EH 3WFDH 1ZVSB 4G8FA 4JFEA 4NO0B 1AC6A 1ROWA 4WTXA 1S5HA 4I13B 4U6XB 2C1PB 5E6IB 3BN3B 1SEBB 4LCWB 3VFOB 5IW6A 1T22B 5EU6D 1P69B 4G7YH 1H9VA 5E8EA 3OWEA 2UWEB 5I8EB 2FO4A 3MYZA 3QEUA 3UAJC 4NN7C 1FSKC 2V2WA 3KJ6L 2J6EL 4S1SH 5AWNH 5I1IH 2DM7A 4BSWB 1RZJH 4ZTPH 3H3BC 2CDFB 1V8HA 4WI8A 4K94L 1A6ZB 3B2VL 5F21B 3WEXA 3OSKA 4XPGH 1NC4A 5L7XH 4DFHA 3UTZB 4LSDA 2J8UA 1FGVL 1MWAB 4YIQA 5KSAD 3MJ6A 4RAHA 4IDLA 3SGJA 4JPKL 2VH5L 2PYEE 4ODWB 4P3WA 4I3RH 5AD0B 2G5RA 1V7ML 3NFNA 3NIDE 3LMJL 1EIBA 1OOAA 4WY7L 1KPUB 4MNQD 4ZD3H 3QUYB 4P3DB 5LXGH 2CR3A 4C58B 1E4WH 4GMSH 1HYSC 3DYPA 3MXWH 4R2GB 1G7MB 2HFGH 4HAGA 4AIXA 1GZQA 2XTJE 4K3EL 1JHLH 5BMFH 5I6XC 4ZS7L 3SCMC 2FL5B 3JUYA 1FO0H 4D8PB 3CMOH 2J1KA 2F74B 2R2EA 4FQXD 5IB3A 2V7NB 3IS0X 4RDQG 3VWKA 1UB5B 2R23A 3SDDA 3V6FA 4KV5F 3EYOA 3F7VA 4M62H 3QUMH 1ADQL 3EW3B 3VMPA 1NEZA 2EDHA 4OCSH 1IQWH 3PJSA 1U8MB 5GPRA 1PKOA 3MRIB 4XCFH 2P8MB 2FZ3B 3PWJA 3VFTB 4ZAKC 2ZCHH 4NUJA 5D5ME 3FRUB 3P9LB 2JCCA 3L3OB 4UTAH 4ZPTB 3BDYL 4OCXL 4A2MA 3L3IB 3MLRL 4L5FH 3TT3H 3UTQB 4LSUL 4CN4A 4OUUB 4X8XA 3QH3B 1ZV5A 3P30L 5BV7C 3SDCB 3T09A 1LEGB 2I27N 2XXMB 4FP8H 3VFPB 4Z6AT 1BJ8A 2ESVE 3MRMA 1SHMA 3KPRE 3R0NA 4IMKC 3PQYD 5EORL 5GGTA 2B1HH 1QO3B 1CQKA 5CD3B 2FX8H 2FJGB 5KZCD 5EWIL 5LVEA 4B7IA 1T21A 5DJ6A 1OW0A 4XCNA 5FKPB 1KV3A 4RBPH 2NXZB 2Y06H 2RAMA 5GZND 4XP9L 3RL1A 4JRYD 3PHSA 3TFKD 3ILQD 5JA9A 4PTUA 4V1DB 5D9SB 3O2VH 4G80A 5E95B 1OTUC 3B5GA 3HLAB 2J3SA 5F7NC 3CK0H 5IEKB 1EVUA 2R69L 2P7TB 4TVPH 2AJSL 4JM2D 2NX5E 5CGMA 3TM6A 4JFFA 4U6YA 2I60H 4JPWH 4K9EC 3GKWH 5GSVB 3AS2A 1NMBL 4GQ9H 5E7BA 5IUSA 1YQVL 1CIDA 4G9FB 4GLRI 3QDJE 4MA8L 1LILA 5FUZH 1G7LA 1BBDL 1R24A 3U7YH 3WJJA 2XKUA 5D1QC 3BH8B 3P3YA 3DO7A 1CBVL 1A2YA 4OI9A 1D3CA 2HFTA 5MEND 4BZ1H 4M6AA 2X4PB 2X4SB 4LPXA 4NUGL 2I5YH 3QEQE 5D2LA 2V9RA 4Y4HB 1FJ1A 3AMKA 3KPOA 5EBLA 5IF0A 1U8IB 4HWBL 3U7WH 4YHPA 1HNFA 3NAAH 3EOAA 1GGIH 1OL0A 4FTVD 2X4NB 1ZLSL 2RCSH 2ADJA 4C56B 4X80L 3ULSA 4RIRA 3QCVH 4G3YL 5J1AA 5C0CD 5FKAA 1DSFL 4KJPC 2W9EH 1DANU 5GJSH 4LL9A 2ZSWB 4RA0C 3U4BL 3OXRA 4GW4B 4D0CB 1JGDA 3WDHA 1QRKA 4HS6B 5I74C 2AKRB 5KVDL 2VXTH 5JZ7D 7FABL 4B53A 3F7YB 1HN1A 4PV9A 1OPGH 4GG6E 4GBXB 1J87A 5E99L 5I73B 4J6RH 4JFHD 3ZSSA 3CGTA 3PG2A 2CKBA 5IV2B 1JRHL 4Z7WF 5M95B 5E9DB 3REWB 5CJ5A 4RQQA 2HVKA 4LHQB 5IMLB 2H1PH 5D7LB 4EOWH 2VXQH 2FECL 4X7SL 5TE6H 5DJ2B 4UUJB 1IZKA 2Y9RT 4LLVA 1CFTA 1TJIL 3B9KD 4OM0H 3ZYIA 3P0YL 3UC0L 2BVUA 3KXFA 5F7DB 1NCAH 3AMLA