1NCDL

Refined crystal structure of the influenza virus n9 neuraminidase-nc41 fab complex
Total Genus 50
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
50
sequence length
214
structure length
214
Chain Sequence
DIVMTQSPKFMSTSVGDRVTITCKASQDVSTAVVWYQQKPGQSPKLLIYWASTRHIGVPDRFAGSGSGTDYTLTISSVQAEDLALYYCQQHYSPPWTFGGGTKLEIKRADAAPTVSIFPPSSEQLTSGGASVVCFLNNFYPKDINVKWKIDGSERQNGVLNSWTDQDSKDSTYSMSSTLTLTKDEYERHNSYTCEATHKTSTSPIVKSFNRNEC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase(o-glycosyl)
molecule keywords INFLUENZA A SUBTYPE N9 NEURAMINIDASE
publication title Refined crystal structure of the influenza virus N9 neuraminidase-NC41 Fab complex.
pubmed doi rcsb
total genus 50
structure length 214
sequence length 214
ec nomenclature
pdb deposition date 1992-01-21
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1ncdL02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1ncdL01
3QDHA 3E6FB 4AIOA 4O00A 1A5FH 4DCQB 5BVPL 3GO1H 3C6LA 1QFUL 5DD3L 3FONA 1XGRA 3VWKD 4Y7MA 1LEIA 4QHMB 3ARFC 4NQCD 1KLFA 4POUB 4MJ4A 3ZMRA 2YD1A 5BMFL 4JHWH 4TQEH 2DDQL 4XVJL 4HH8A 1ORQB 1P84K 4PJ8B 5B8CC 3TPUB 2YN3A 4HGMA 2IFFH 5IVXF 5MP6H 2YR3A 15C8L 1YNTB 2IFGA 4QOKD 2CUMA 3I3DA 3KJ4C 1CIUA 3GHBL 2XPGB 3OZ9H 1HN1A 1FE8L 3O8XA 3JVGC 3VFGH 2H2PC 1JK8B 4UINL 4NO0A 2OCFD 1ACZA 5DURD 3PWPE 1JGDA 1R3IL 5ANMB 5C09E 1JRHL 4Z7WE 3STLA 3VFUA 4RGNC 2X4TA 1WFTA 4KRPD 5B4MD 1QR1A 1BQUA 3ZO0A 1M71B 2XWJA 1M05B 4L8BA 4LMQI 4XNXL 1QO3A 5EU6A 1LNUB 3ZTNL 5BS0E 3S88H 1LVEA 2JF1A 3TWCH 3LB6D 3DUUB 3EO0B 4XVUD 1A6UH 3C09C 4PJFB 3IDMA 3P11H 4LSPL 4NFCA 4PLJD 4KY1L 5D1QA 1D5XA 1PQZA 3OKMA 3S35X 1JTTA 3O6FB 1ORSA 1R3LB 1WV7T 5F96H 1U3JA 1VA9A 4MCZB 4QXTA 3S36H 2BVPA 1YZZA 1Z9SA 4G7YH 1T04B 3SE3A 4GKNA 3L5XL 3SGDI 3LHPH 3D18B 1MI5B 5IJVB 3ESUF 1SJHB 3LN4A 4Y4FD 3VXMD 3PL6A 4KRMB 2R9HC 1K6QH 2NZIA 4JM4L 2UY7A 4CNIB 3I2CH 3HTLX 3OWEA 4JRYD 4DEPC 1WZ1H 1MY7A 4PJDA 1DANT 3OKLB 5BQ7B 2BSSA 3LQAL 1DBBL 4BJLA 5IMMA 5I0DA 5EPMB 3KYAA 4M1CD 1I3GL 4IIQB 4MGXA 3RHWF 4WFFE 1N5AB 5GHWL 1Q9WB 3VFTA 1JF6A 5I1IH 4XXCC 5CMAA 2R0KH 4MLSA 2O5YL 2O26U 3A6CH 5KAQF 2OJEB 1G9ML 1TZIA 2CDEA 1OPGL 4I48A 2P24B 3VMOA 3MBEA 1HHKA 2EC8A 4IMKC 1YA5A 3WBDA 5DD5H 5F3BB 5A2KH 5DJZA 5DC0A 4QGYA 3D6GA 3OB0H 2I9TB 4CN1A 3OKKA 4ONGH 4PJEF 4M1DL 1OAQH 2HTKD 1TETL 4KGJA 3JV4B 4FN0A 5C0BE 1HOCB 4H1LG 1X6LA 4MJ2A 2OQJB 1ZSDB 3HN3A 4GS7C 1G6VK 1L0QA 2VDNH 1YNTA 3B8SA 1RZ7H 5EG6C 1NGZA 4FQ2L 5FO9B 1B2WL 1YEGL 5IHUL 2HP4A 1AGCA 4DOHE 5JR1H 3L3OB 4ALAH 5LGHL 3GRWL 4G8GD 5I1GL 4UBDD 4EQ2A 5ESQA 1I3UA 5IVZB 4YFEA 2NNAB 2VLME 3PWNB 1JK8A 5I15H 5CBEB 5K9JL 3PP4L 1HKLH 2FX9L 1HIML 3NIFE 5IHBA 2HVKB 1CFSA 5D70L 3WN5C 4OGYL 4XP5H 3O6KH 1GCFA 1RK1B 1FORH 4PBXA 2BZDA 3VCLB 5ACZA 3NABH 1CFVH 1HILA 5J06A 4WUKH 4P5MB 3SGEI 1JPTH 3U4EA 4AG4L 5D2LF 3GBNH 4NN5B 5E2VL 4BQBA 4NQTA 5DMIH 4LLQB 2JLLA 2MCG1 1IEHA 4PJFA 4AMKH 1NFDB 4Y16A 3N85H 4GRLD 5C2UB 5C08E 3AXLA 4H20H 3DARA 4U3XA 4JKPL 3TBWA 5DHXB 1PKOA 4JQIL 1NAKH 1U8IA 3O6FA 3I75B 2DQFB 1VFAB 1S7TA 3MBXH 4OZHF 2YA1A 1XF5A 1JNHA 1MI5A 4MA3B 2GJ6D 1RURL 2AV7B 2JB5L 2I9LB 1MUJA 4NQED 1OQOA 4PG9A 4PTTA 2ARJA 2VXSH 2CRMA 2G5RA 4JFPA 3CVIH 4YHZL 1AKJD 1U8KA 4QXGL 4XPFH 3OKLA 3OSKA 3X11A 4PGBB 2CXKA 4UQ2B 1FZKB 4YIQB 4XNUL 3MLRH 4C56A 4XNMB 5KTEH 4TNVK 1E6OH 1IAIH 4KTYA 4UUJA 4ZSOA 4XNZB 1NCBH 4U1HA 1ZWIB 4QRRE 1YEHL 1FZMB 4KRLB 3QZWB 3QEQE 3IDNA 4PJ9C 4I18C 4LEXL 4TOYH 5CJ5A 4D9RE 3P4NB 3LPWA 5LJYH 5TGBB 3SDYL 4HF5L 2P24A 4NRXA 4RMWA 3MLVH 2ICWB 4BKLB 4ZNCD 3LKOA 5L0QB 1WT5C 3JZ7A 5GRJL 3QH3B 4GQPH 3ULUH 3D39D 3F6LA 4MXQD 3UTTD 2ICWI 5DHYA 2G5BB 3SOBH 5E8EB 2PYEB 1QLRB 2Q76B 3JV4A 1NGQL 5D4QA 3S96A 1HOCA 4JG0L 4UB0H 2OQJA 3MJ8A 5ESAB 3HZKB 3DJ9A 5HDQH 3BGFC 3ET9F 2XV6B 4HWEL 5FO9A 3QCUH 5FM5O 1RIUL 1NL0L 1WBZB 2FJFA 3PHSA 1U95B 2IG2H 2Q20A 4F57L 4L8SA 4XBPA 4EI5C 3PGFL 5IIEA 2NNAA 4KAQL 5ISZD 1XZ0B 2VDLL 5SX4H 4X99B 4QCIA 4HCRH 3SDXE 1ZT1A 4NKIH 3BE1H 3ZE0F 5L6YL 3GJEA 4ODVL 4K71B 1K9TA 2VLJB 3WXWH 1RUPH 2FWOA 1DVFD 1OP5H 2W38A 2QBWA 5DJDB 3FRPA 2H26A 3UDWA 5ENWB 3OPZH 4FG6C 4E41D 5E70A 5IMKB 1MAMH 1NEZB 3RWHB 12E8H 4XWGH 2DD8H 4KK9D 3W9DA 4ZUWB 2FECI 2VSCA 2HKFL 4N0UB 5JHDB 4LLQA 4JO2L 2WP3T 5FM5M 5FUCC 1INEL 2P8PB 2A1WH 1MLCB 2BCKB 4BQ9A 3VXNB 4WFGD 3QDMD 5E2TH 4KUCF 2J5LC 1H3UA 2DQFA 1MCOL 1WWCA 2FJGB 3F7VA 5J6HB 2W0FA 5GS0L 1BQLL 5LXGL 5L2KE 3T3ME 4JFXB 2AV7A 3UBXA 1CI5A 5ELIA 3VWJC 2RCSH 3NFNA 2Y6SD 2AJUH 1GOGA 1F00I 2AJXH 3TA3C 2EKSA 3CFIC 5J11C 1F4XL 3H9SA 4MWFB 1ZGLM 4QHNB 5FYLL 1FDLL 5GIRB 3MJGX 4PGBA 5F7LB 3V6OE 1A3QA 3IETB 3NIDF 2HT3C 2NY1D 1TJIL 1KEGH 1FZKA 4YIQA 1SVZA 4PJ5D 3S4SB 3BEWB 4ODSH 1I8KB 4XNMA 1WFUA 3HI6L 3O6ML 3RZWA 1OW0A 3MMEA 2VXVH 4FXLA 2UWEF 5T3XH 1ZANL 5EB9A 5FO7B 3CDYA 3LPFA 3U2SB 4Z7WB 5IWLC 1GXEA 2ED7A 1Z3GH 3FT2B 3QZWA 4M93B 5KSVA 4U1MB 3VRLE 1WF5A 1G7PA 5K9KA 1J86A 4PLKC 4YDKH 3U83A 2IQ9L 4LLUB 4NUGL 1LGVA 1AHWA 2E3VA 4S10A 4LCYB 3SE4A 4R96A 1A0QH 1TVDA 4ZUVA 4J3UA 2QHRH 3MRCA 1BGXL 4R0LA 4X6EA 1DBKH 3K81A 5EUOF 1GGTA 4WHYG 4WUUA 2BRQA 3NGBC 3V0WL 5JLZB 1I85C 1E28A 5AG8A 4YJZL 3QHZH 2V7NA 1QSEB 4ZOBA 1FG9C 4MLIA 2P5WD 5CSGA 5HY9B 1UT9A 3AS1A 2D0GA 1MRCL 1RV6X 2A9NL 4IDJL 4DN3H 1A7OH 2F54E 1WAAA 4RFNC 5ADPL 1U95A 3BD4A 3K3QA 1IAIM 1XFPA 5CJBA 5FHAL 1UZ8A 2DQCH 1JWUA 4EBQL 4EDWH 1MFBL 1ZHNA 4LRIC 2UUDH 3MXVL 6CGTA 1D5BB 4DK6A 3G5XB 4OZIA 2X4SB 4LLWB 3P4LA 4JRYE 4K94L 3UTPD 4J7RA 4HAGA 1Q0XL 3EZ8A 3B5GA 4HMDA 4OZGA 3BZ4B 4Q74A 5CZVL 4O2FB 3ABZA 2H9GA 1K8IB 2VOTA 3PWVB 1G1CA 5KW9L 5SV3A 1GGCL 4N0UA 5JORB 5JHDA 3VI3F 1GC1L 3MO1A 1G0YR 5C6TH 1MLCA 5TJWK 2X4PA 4I3RL 5IROC 4TRPH 1AE6H 3TEUA 5AYUL 1U8OB 1XGYL 2OTWA 5DD0H 4Q9RH 1CU4H 1F3JA 3RVVC 2XQBH 2YUWA 2L0DA 1IAMA 5IBLC 1U92B 3VD7A 5C1MB 1MCHA 5JPNB 5A3ID 3DRTA 1EAPA 1EERB 3RGVD 4GOSA 2VB5A 5F9AC 5GIRA 1NAMB 5C0CB 2NY0C 3MZTA 2OXGA 4LP5A 4OLYL 1ROWA 2P42B 2NXZB 3LS5L 2AK4D 5CHNA 4UAOB 2X5PA 5E9DB 3DX7B 2PETA 4WI2A 1D6EB 2F53D 3MGTA 5TE7H 3S36X 4WI3A 1EFQA 3C9NB 4Z7WA 2FZ3B 3BAEL 2YKLL 4X7SH 1KIPA 1CXFA 2A77H 4L1HA 4PY7B 5I76B 4WU7A 1FV1B 3HPJB 1EFXD 5SWQA 4ZTOH 2OX5A 4LCYA 4BFBD 3MR9A 3TBVA 4F7MB 1D9KC 1QRKA 2X9XA 3K46A 2QR0A 1Q0YH 3RRQA 1UKTA 1S9XA 1CD9B 2C3HA 3BPOC 5BZWB 4BK5A 4HUVB 1AC0A 1GJIA 3T4AB 1QRNB 4ZFZA 4LBEB 1IM9A 4JFDE 2FLBT 5DFTA 3CZJA 4NJAH 5CIPB 3CCHB 5SWSB 4YFLI 2P44B 4D9LL 5HHOB 4DN4H 1GAFH 4UQ3B 1RU9L 3ZKND 3VFMA 2IBBA 1AJ7H 3CLEL 1MJJB 4F7CA 1I9RH 3IFNL 3SKJH 4OCYH 2Q3ZA 1KB5A 2DQTH 5F7FA 3BN3B 1V7ML 1QLEL 2FRGP 2RR3A 2GJ6E 3C5ZA 2W0PA 3P77B 2NTFB 1MFCH 1J12A 1MH5B 1CDIA 4NKQB 4OI9A 4PD4J 5BW7C 3MNVB 3EKCA 4Y5XA 4PRDB 3VFOB 1EBPA 2VLRE 5DK2A 4NM8H 4NC2B 1KN4L 4POZD 4N8PA 5HPMA 1BFOA 1KN2L 3BZ4A 4O2FA 4A6YL 4M5YH 1EMTL 2W9EH 1OTTC 1JZ7A 3PWVA 5DGQA 1JPFB 4RAUB 1KUMA 3U0WL 5IB2B 2FH6A 2CXGA 5JORA 3CSBA 1IL1B 2ADFL 4MYWB 2ERJC 1AH1A 3QI9B 3WFHB 4MD0A 1A3LL 4PV8A 3OHXB 2AEQH 3LEVH 2CLVB 1SJVA 3DUSB 3QIBD 4NCC1 3WJLA 1P4IH 2C26A 1U8OA 2VABA 1FAIH 1KEMH 3SKNB 3FRUB 5B3JF 4MJID 4L3CA 4JZJC 3O9WC 4FHBD 4EXKA 5FHBH 5E7FA 1CGUA 5DZLA 5EA0H 1NFIB 4DUXA 1UA6H 2VH5L 4R90H 5C0BA 3KXFB 1U92A 4AIXA 5DJ6B 4X9HA 1QFWI 2FB4L 5GGUA 3RTQB 1GRWA 3HAEB 4KVNL 1MCPL 4W70A 1J8HD 1CGTA 3WFCH 3KPMB 1QBLL 1Q9OA 4GKSB 4JO4H 3CXHK 4U1SB 3IXAB 2ESVB 2CLZB 1NAMA 3G6AB 4XCYA 4BZ1L 5AWNH 1VSCA 4OQTL 4XP4L 3SGDH 4LRNL 5H94A 4J4PA 4NO5B 5DJAA 4LVNC 3DX7A 3B9KA 5E4EB 1Y18B 3H42H 5AZ2L 2IPUG 2XTLA 5T3ZH 1VGKB 2G9HA 1PKQE 2EDTA 1FGVL 5ISZE 2FZ3A 3QWRD 4C4KO 4UTAL 4MNGB 3LKSA 4PY7A 5T5NG 4I0PB 5I76A 1FV1A 3QIUB 2NX5E 4LLDA 3ISWA 4TSAL 3T2NH 4V1DB 1BX2B 5BZWA 2B5IB 4P2RB 5JMRA 2VKWA 3HCVB 4ZAKB 5LCVH 3T4AA 4E41E 3LKQA 5C08A 4GAJH 4EDXB 4FNLL 4PRIB 5J13B 4NRZB 1M7IB 2VLJD 4D0DB 5SWSA 3EYOB 4JPIB 1DFBH 2R56H 1QG3A 1RPQA 3JWNC 3QDME 1MJJA 5JW5A 4A2MA 3DHJA 2DF3A 1AY1L 3LQZB 3QIWC 1NC2B 2WBKA 5CINH 2JK5B 4NRYA 4YDVB 2I5YH 4KU1A 5JDSB 3IRZA 2K3TA 1JCKA 4MAYD 1ZV5A 4B41A 5C0AB 5SWZD 3RX8A 5F9WC 5TPWL 3B9AA 4HXBH 3LIZH 3UJIH 5HHVL 3L6FA 5SX5K 1AR2A 3U1SL 3MNVA 2IJ0C 5TQ0H 4XPTL 2XKSA 1IAOB 1DL7H 8CGTA 1T0NA 1WLHA 1LEGB 3BJ91 5TF0A 5GRVL 1BVKB 3NCJL 2H41A 1ACYL 4NBYB 1RFDH 1FRGH 4QRRA 4PJ5E 3QEQA 1JNNH 2ID5A 3GSVA 1VADB 1IL1A 3QJHB 1IGML 4PJHF 3QI9A 4UT7L 1N5YH 4XXDB 3QHFH 1SBSH 1WITA 4RGOH 4FRWA 4J8RA 3GSXA 2A83B 5A2IH 4HKJB 4OGXL 4QRUB 5DVNA 3B3IA 5C2BL 2X4RA 3SKNA 3SGEH 3FRUA 3GI8H 4RBPH 3JTTB 2I25N 5IKCA 4EUPG 4U1IB 4KK5C 3D3VD 2ADIA 3TO4B 2RGSA 3ULVC 3QQ9C 5ICXA 5DRWA 1JWMB 5F7DB 2Q8AH 4KK8C 1KPRA 3KPMA 4RFOH 4FXGB 5EIIB 4N0FB 3PHOB 3TZVC 2JELH 1MHPH 2F8OA 2ESVA 1C5BL 3G6AA 1AGFB 2P5WE 5JQ6H 4KTDH 4D9QD 1ZLUK 5BVJB 4NO5A 1ZA3A 5IVXE 3RWEB 4NQSB 1OSPL 3ZT6A 5K9OA 1PAMA 2HFFA 1P53A 5IEKA 3BDYH 3ALPA 1QSED 3U9UA 3I6GB 5LGJB 4AQOA 3H0TA 4JN2A 4P9HL 4WV1C 2ZG2A 3VGGA 1BQSA 1UZ6E 4ZD3L 4LHJB 1CXKA 4RMQA 3EJYC 2FYYB 2DTSA 3UTPE 3QO0A 4NNXB 3GMRB 1IC7H 1BX2A 5D6CA 5IM7A 5HGBB 3HCVA 3T1FB 1KIRA 4ZAKA 2A2QT 1J1PH 1R24A 3ULVF 3EGSB 4EDXA 2WUCL 4F2MB 3TIEA 2YRZA 4NRZA 1FYTB 4Z77A 5I73B 1M7IA 2P8MA 1XR9B 2NY7L 1PX4A 3L3IB 2AJYL 3O81A 5DRZB 3NH7H 1YJDL 4WEBH 2Y4SA 4QT5A 2FO4B 5BRZB 5L2KA 2ZUXA 3G04B 4CU7A 3ZKXB 3LQZA 1NC2A 4ZQKB 5MI0C 3VWKA 3KLHD 1CT8B 1KCUH 3G9AB 1I1RA 5TE6H 5C0AA 4R2GD 3QEGH 1MCKA 4MVBD 1OWRM 2CR6A 2ADJB 4ETQB 1U8LB 4LPCA 3ARVA 1FYHB 2XA3A 2BSED 4EI6B 1RZFH 3M17A 2F74A 2DKSA 4Q6IB 3K2UL 4KI1A 5H37H 1AFVL 4ELKB 1S5IH 1CLCA 5GRVK 2Z91A 5E2WH 5KVDH 3AU1B 4JY4A 3PF2A 4QRQB 2DQGL 4NKMB 5DGRA 2AK4E 2G60H 4GLRH 1YEIL 4HX1B 2DYPB 3LS4H 2AABL 1VADA 3MYZA 3MROB 4D0CB 3LN5B 3RY4A 4HBCL 4X8JA 4ZOEA 2F53E 5EO0B 5C0CD 4M4RA 1MRFH 1NMAH 1S8DB 3RAJH 4RSVA 2P5EB 3TJHD 4JO3H 2A83A 5I71B 3PJSB 4BSVB 4QRUA 4TVPL 4OBRA 3BN9C 5E9DD 5GJTL 5I1EH 2R2CA 4IJ3C 1X5GA 3JTTA 4PS4H 4GQ9H 4U1IA 1FH5L 5ETUA 1P7KB 3SKUD 3MRKA 1RSFA 2IMMA 3R1GL 4YBHA 4GG8B 3MNWA 5FYKD 3DVGA 4IMLB 2VXUH 3R8QA 1KLGB 5EIIA 4FXGA 8FABA 4N0FA 4KMQA 1IEAA 2DQDL 3IDXL 3LCYA 2F54A 1NDMB 3MODL 4JREB 1BM3H 4GRMB 1S7WA 2GUOA 4MMXC 1IGJB 3LRSB 1AGFA 2OTUA 4WTWA 4LKCB 4R4ND 4CVUA 3GUTA 5BVJA 5KS9F 2YMXH 3ARSA 2O61A 3TV3L 5D9SB 3RWEA 4Y4FA 2HLFD 1CBVH 4UIMB 3CPLB 4RISL 1EV2E 35C8H 3GB7B 3ARZA 2VXQH 1O7SA 4K3HA 3I6GA 4RCAA 4JRYA 5KANG 4LPWA 1I1AC 4MXVF 5E99H 5HHOD 3FCTB 5C8JB 4PB9H 2YPLB 2CRIA 5JXAL 4DFHA 1DLFL 1MAKA 4L8CB 1ZHKA 3KHOA 5T1DH 1A4KB 2J6EL 3T1FA 4ENEC 5E94B 5I8EB 1WVZA 3U0PB 3EUUA 2D7TL 5HHMD 3P9MA 1LMKA 5AEAA 1QBBA 3L5IA 4QXUH 1QQDA 1R3KB 5FDWB 4OFIA 3DYOA 3K1DA 5DRZA 1HDMB 2JJUA 1FLRL 3BSZH 4H5SB 4ZXBB 2FO4A 1ZT4B 4I5BB 5BRZA 3CGTA 4HPYH 3G04A 5DZNA 3JWOL 3VFWB 3O3AA 4YZFE 3NCCB 4J6RH 1JE6A 3TT1L 1PYWB 1TZGL 5F9JB 4MJIE 4KK6C 1CT8A 1G6RL 1A9EA 2VLLB 3BUYB 2F15A 1JHLL 2EIZB 2VO5A 3QFDB 2WBJD 4LK4A 2JJTA 4PJBF 1JF1B 3MLZH 3RIAK 3UAJD 1J8HE 3L3KB 4EI6A 1CLYL 1CXIA 1W0WB 2R1XA 2HFEA 1SEBB 1PBYA 1KIQB 4ELKA 1WISA 5D1ZC 4GG6F 2PKDA 5CZKA 1V8HA 2C1PB 1L7TH 4X5XA 2R23A 2HFGL 4BSWA 4H26B 5FCUL 3OKYA 3S3SA 4OFDA 2YK1H 4JB9L 3IFOB 1Y6NR 1FZOB 5F1OB 3PE9A 4X9BA 3ZTJG 5CP7B 4D0BA 4KGLA 4MJ5A 5DFVD 4FTVE 4BSVA 5DEFB 3QG7L 1XGTB 1CQYA 1GYAA 3QHTC 4JFDA 4Y4KD 2NR6D 3O2VL 4N9OB 2VSDA 3O45B 2BC4A 4G6FB 1GIGL 5F1KC 1RK0A 4XP6H 1K4DB 4GRLA 3QIUD 4IMLA 2HTLC 4HKZB 5D7JD 3IVKA 1MNUH 1NGYA 1B0WA 3FAWA 4GRMA 4Y1AB 2E5EA 3PP3H 4MA7L 4XX1E 1NSNL 5ALBH 3VJ6B 4V1DD 1O7VA 2ITCB 3LDBB 3GIVB 1UB6B 3ZZ1A 1RJLA 2A38A 2GJ6A 3OXSB 2E27L 4PRID 1IFHH 3NVQA 4KKCC 3GB7A 4P3DB 3OL2A 5GSVA 1L9NA 3IJYA 1B0GB 2DL2A 2VLRA 2W65A 4KJPC 4TUJB 5C8JA 5SWZE 4CVZA 1CICC 2FATL 2YPLA 1MFEL 5F7KC 5D93C 4L8CA 2IAMB 2Y07L 1OWWA 4O02H 1NAMH 3CFCH 4NWTL 5MERB 4M48H 3ZHKA 1MCWW 3FO2A 4LLYB 4B7LA 5D1XB 1I1YB 1G9NL 1X9QA 2VDPH 3L7FA 2Y06L 5DFWH 5E94A 5FUOL 1F02I 1JHTB 2E9WA 5I8EA 3NIGF 5DSCB 1TPXC 1RIHH 3BWUC 5E8OB 4WW2C 4S1SH 5EO9B 4H88H 1AR1D 4L3EB 3MA9L 4LHQB 1EAJA 4H25B 1F90H 4DUWA 1OB1A 4H5SA 4ZXBA 5FAAA 2FLRT 1ZT4A 3HI5H 4I5BA 4BELD 1V7NH 4EN3B 4KDTA 3MV01 4X4XB 1OAUL 2W9DH 3EFDH 4S1QL 4PY8I 1K5NB 1PYWA 3QDGD 2WMPA 2ZKHL 2BNQE 3MRBB 1FZJA 2VLLA 1DUZB 2C4FU 1B3JA 3PHQB 3D3VE 3QFDA 1UXSA 2QSTA 2ZUQC 4Q0XH 3BYYA 2X1PA 4QWWC 4KHTL 1LILA 1P7QA 2E7BA 4M7KH 2AKRB 43CAA 5FA4A 1JGVH 4TTDC 4JR9L 1TJGL 1K8DA 3TO4D 5KSAA 1PKQA 3G6JF 3SCMC 1J0KA 1YEJH 4OTXH 1WCBB 2VZOA 2VL4A 1PFCA 2CDFB 3T0WA 2P7TB 4KKAD 1FZOA 5JPMA 1BJ1J 1NBZB 2NX5A 5CP7A 2JTDA 1T7ZA 5C0JB 5IGXH 5CJOL 4G7VH 3TLRA 1XR8B 5EZIL 2HT4C 4EZMA 4P3WA 1CD1A 3CZFB 1IKFH 3VGAC 43C9A 4MHHI 1M7DB 2AI0L 1CE6A 5E08L 3BD3A 4MCYB 1X7QA 4E41A 3SJVD 5H8DA 3FT4B 3Q6GL 1E4KC 4NUJA 5A16A 3NOIA 2QEJA 3SDAC 2WM0A 1B0RB 3IGAA 4UDUB 4EOWL 5KZCB 5HHPB 2ZWLT 1NGWA 3FN3A 4YH6A 4J2XA 3QDMA 3AREC 3GRWA 3QUXA 3MFGB 1VPOL 4XNQA 4DVRL 1XAUA 4OM1L 4OLUL 1U42A 4LSSH 2ITCA 4OD1L 1S5HA 1PY9A 1FN4A 3KJ4B 1V05A 5F7EH 3OXSA 2BMKA 4F9PA 4LVEA 2FBJL 4MNHB 1CF8H 1FYTD 5CGYC 2EDWA 4I3SL 1KTLA 2QSCL 3QO1B 3PIQB 1B0GA 1N4XH 3GSUB 4WO4D 4LAQH 1N6QL 3L7EA 5GGQL 5CFHA 1QUNA 5FDYA 2IAMA 3E6HB 3WS6A 1MY5A 3QCTH 1OGTB 4U1GB 5MERA 5T5NF 3O3BA 5D1XA 4GRWE 5IHZA 2IBGA 4X9IA 4AM0B 3SDCC 4FQCH 4RNRB 2PXYC 1U6AH 2QL1A 5ILTH 1T66C 1FG2A 3C09B 5J0BA 5DUML 3ROLA 4LDEB 1HH6A 2QQNL 2WNGA 2SEBB 3ETBF 1X5IA 4EN3A 3KPRD 1F4YH 3MLXH 2A6IB 2DTMH 5C0ND 3GHEH 1TQBB 1RUQH 2K7PA 4KPHH 2ICCA 4PJEB 4C59B 3FB5B 3BZFA 3HC3H 1KBGL 4YDJA 4QYOB 5I1JH 2HWZL 2Q6WB 5ITBL 5I8KL 2GITB 3O4OC 4DEPB 2P5WA 3UTQB 3WCYA 5HHXH 5FYKE 2ZOLA 1BZ9A 1CFQB 4X6DB 4AH2B 4BZ2H 1JHKL 5IVXA 2K1MA 3ULUC 3VE0A 4XH2A 4ODHL 1NCAH 1Q9KB 3F58H 5EIVA 4PGJA 3DECA 3F62A 1AQDB 2YD6A 4L4TB 4ODWB 2C3VA 4OUUB 1AI1H 3RI5F 4UIKH 2NY3C 5KVFL 3MOQA 4MX7A 5D6DC 4Z9KB 4OF8A 1INDH 1J05A 3QEUA 2BHUA 2XIDA 5EZOL 2H32A 3QXUA 3VRIA 5EORL 2B1HL 2A0LD 5GS2D 1F3RB 2JCCE 4LHUA 4ODTH 3UBXG 1TJHH 3MA7A 1M7DA 3QULB 4MCYA 4LASL 2NPLX 1C16B 3NFSH 4LLMB 4UT6H 3LQMA 3VFVB 2AP2A 5D2LB 1U91A 3TBSA 1N64L 3VW3L 5HHME 3MQIA 3WIHL 1FNAA 4GW5B 1KNOB 4QNPF 4IRSD 4GS7B 5FKPB 1F6LL 3WO4B 4OZHB 2QQLL 3V4VL 1IJ9A 2N1KA 1G7IA 5MENB 1AQKH 1WSST 2MPAL 1CL7L 1QLFA 4PIRF 3UZEA 4MNHA 1BVZA 1E27B 1I7ZB 2EC9U 2IGFH 3CLFH 4UTBH 1EEZB 4JFOA 1OAYH 5LWYL 5JW3H 3BZDA 3IU4L 3QO1A 2B1AH 4AJ0A 1LE9A 3RGVA 3OXRB 3WN5B 4OCXL 4P57A 3HE7D 1SJXA 3E6HA 4Y4HC 5IQ7L 5HYSB 1X4ZA 1OGTA 2AK4A 4K3DH 5TDPB 4JM2C 3L1OH 1DN0B 4Y5YC 1I4FB 3FTGB 4R26L 3SPVB 5EWIL 2XTJD 3U9PL 1KELL 1NEUA 3SE8L 2DLFL 2X4QB 3CMOL 4Q58C 1CTOA 5C3LD 1A14H 1NC4D 1SYSA 4MDJA 5KOMC 2MJWA 4LGSB 4G43A 3ZDYE 4X5WB 4L5FL 4MNQE 1EFXA 3K80A 4UILL 2VC2L 2SEBA 2Z8VC 2MCPH 4MAUH 5FGRA 2A6IA 4P5KA 1I8LC 1S9VA 3KNBB 4FZEH 1QFWM 3TN0C 5MEQB 1N59B 2ZUWA 4FMFA 4LIQL 2EDQA 3CFKA 1YNKL 3O2WL 3FB5A 5F3HA 5J6GB 1F58H 3GMPB 4QYOA 5AD0A 4DQOL 4O2EA 2GITA 2PO6D 4X80L 3V4PL 1VESA 4R9HA 3UTQA 3F7PC 5F7UA 3KLAB 2MNUA 3RNQB 1CD0A 3BKML 1OF2B 4YGAB 3K7UA 3RNKA 1JTPA 1M1SA 1AQDA 5EU7C 2BOBA 1NBVL 4KVCL 4ODWA 2X1OA 4TSCL 1ZS8B 4WI9A 5IBTH 3P2TA 3IXTB 1ZLSL 2A9ML 3TIDB 2FSEB 3EYQC 1RUMH 1EHAA 4M5ZL 1CG9B 4CW1B 3AUVA 2X42A 3QULA 4GXVL 1GZPB 2YSSB 5DK0B 5TE4L 4QHKI 3DMMB 1AGBB 1C16A 4DTGH 2BJMH 2OI9C 4FZ8H 1D5IL 4ZFOB 5D2LA 4DKEL 2RFXB 3LEXB 4Z8FH 3TYFB 1Q9LB 5IW6A 1LO3H 5E8PA 5I75C 3S5LB 2COQA 5DVKA 1N3NB 5IEHB 4GW5A 1KNOA 3QIBA 3VXQB 2ZCKL 3NCFB 3QJFA 5FKPA 4YQXL 5GRUL 5BVPH 2G2RB 1QFUH 3IDIB 2EDJA 5DD3H 4MJIA 1IQDB 3T65B 4HGWA 4W4NA 3BPLC 4W81A 3O8XC 3RWFB 4YAQA 3BHBA 3AAZA 5BMFH 2DDQH 4XVJH 4Y88A 3QDGE 3DYPA 1C1EL 2DQEL 2R8SL 5C07D 2R29L 1TCMA 4YGVB 15C8H 3RX5A 1TNMA 3KYNB 4GKZB 4A6YB 5CAYB 4IS6B 3GHBH 5E4IA 2X41A 2D9CA 3C8KB 1FE8H 5CWSA 5C0FB 3LKPB 2OP4L 4Q2ZB 4R4BB 4BFEA 4K07A 1I4FA 4UINH 1N2RA 3TGXA 4XAWL 3CK0L 2UWEB 1BBDL 1R3IH 4FTVA 1JRHH 1MHHA 1ZHLB 3G5VB 1U2CA 4K3JL 1WZMA 3OJMB 5D1QC 2IANE 2R2BA 2XN9D 1SY6L 2ICWJ 3CNKA 4XNXH 3TNMB 4H8WL 4X4YB 5EZJB 4XVTL 3ZTNH 3ESVF 2IEPA 3Q5OA 3SE3C 1FJ1B 4Z7OF 3IFLL 1BECA 1N59A 5ACMA 3PL6C 5DYOA 3PXJA 5EUOB 1LK3L 2MQCA 2XKNB 4PGCA 3SEPA 4LSPH 4HIEB 4R3SA 3SJVE 4NIKB 4KY1H 1H0DB 3VWJB 4U6YA 3TA3B 3VGEA 4XGZA 1JPGB 2DQJL 5DMJB 2AXFB 2YRLA 4U1LB 3L5XH 3RNQA 3FQTB 1OF2A 2NW2B 3OKOB 1R5WB 4HS3B 4JM4H 4OIAA 2QHLA 3ARFD 1OGAB 5KZCD 1YY8B 4OZFG 4MAYA 4OUOA 3N1MC 5JA8B 4G8FA 3MPCA 2F5AL 4YX2L 3T2OA 4IEFB 3LQAH 1DBBH 3MBEC 1EUUA 1I3GH 5E6IA 2C5DC 2BNRD 4CW1A 4M62L 4PTUA 2J8UE 2E7MA 2YSSA 4PJ7E 5GHWH 5CJXA 2BFVL 2DLEA 3DMMA 1A6ZA 3G6DL 2H2PD 2W60B 4EEEA 2O5YH 2RFXA 5E5MB 5HGHB 1IILE 4HBQA 1AGEA 3X3FL 1G9MH 1OPGH 3J7HA 4I13B 5I1AB 1FCCA 3S5LA 5JW4R 1KPUB 4PJDF 4RGND 1XGUA 4AYFA 1G7MA 1N3NA 4NQXA 4KKNA 1MQ8A 3EDKA 5CBAA 3DWTA 2BNQA 5DI8A 1IQDA 4M1DH 3KPRE 3VXRB 1JGUL 5K93A 1TETH 2H3NB 1SBBA 2F8XC 5FYJU 2N56A 3T0EE 2W0LA 4XMKL 2DJSA 3TBYA 3MNZA 4YGVA 3T8XB 3HMXL 4FQ2H 4A6YA 1B2WH 1YEGH 4IS6A 5IHUH 3OAYK 3WXVL 5LGHH 3GRWH 4QRPB 5I1GH 1IGYB 5C0FA 5CLWA 4R4BA 2IADB 2R9HD 4XWOC 1KACB 5K9JH 4M8QA 3PP4H 2FX9H 4I0CC 3UCRA 1HIMH 4HUXB 4KHXL 5A1AA 5D70H 5FB8B 1KSRA 4Y16C 4ZPVB 3MGOB 4OGYH 5DHVA 4OJFL 4NSKB 2ZSVB 4K8RL 1ZVSB 3O6FC 1T1YB 2HLAA 5E1AA 4GAYB 4P9ML 1FJ1A 4AG4H 5E2VH 4PJXB 3VG0L 4MZ2A 4MD5A 2A6JB 2DBLL 1H3XA 2APXA 3VXTA 3X12A 5M7QA 1TQCC 3PWLB 4NQDD 1R5IB 1DZBA 4OQTA 1H0DA 4JKPH 4DKDC 1ZLWK 4ODBD 3L95A 5KN5A 1D6VL 4Y2DD 1OP3H 2Q7YA 4JQIH 3H7BB 3TO2B 1JPGA 4QTIL 4YBQC 4U1LA 4P48A 2NY0B 4MJ6A 1RAMA 1CXLA 3BO8B 3BP7B 4IIQC 1RURH 4GO6B 5BJTB 2JB5H 2BVQB 3FAXA 2YPKB 1OGAA 2JJWA 5DJ2B 3PDOB 4MS8D 2Y25A 4YHZH 2FIKA 3QRGL 3DV6B 3IJHB 4QXGH 1I1CA 3BESR 3PV7A 4EVNA 3PGDB 1U8JA 3BUTA 3T0AA 2W07A 5MEND 5F6IC 4XNUH 1KJ2B 1S3KL 4P46A 3ULSA 1T0MB 5FM4A 1AGDB 4N8VA 1XF3A 2AJZB 4UI2A 1YEHH 3BPOB 1DQLL 5HGHA 3HZYA 3V6FA 5JW4N 2GCYB 3P4MB 5CD5C 2AV1B 4LEXH 2XTJE 3RA7L 4NO2B 2HVJB 3SDYH 1OARH 4HF5H 1F6AB 1DCLA 2VDRL 3BWAA 3PABA 5F70A 3RWDB 5HPOA 3F12A 4JFQB 2H32H 5GJSL 5GRJH 4JVUA 1JNLL 2CUIA 4G9FE 2DMKA 2VR5A 4L8SC 3MRGA 4YXHL 4QGTA 4XHJC 1NGQH 4PRPD 4QO1A 1GZQA 3KPNB 4JG0H 1S7XA 4YEFA 4Z7NF 3ARDA 3MYJA 3K2MC 1BQHA 1L7IL 4HWEH 2ORBL 3MV9D 3RZCA 1RIUH 1NL0H 4G42A 5I66B 3VFPB 2LVEA 4F57H 3UDWC 5E1HB 3PGFH 2XG4A 4MQXC 4ZTPL 3CFBA 2EEBA 2VDLH 3P73A 1PGRB 2J3SA 4TNWF 3BH8A 3QNXB 5T1MB 4NN5C 3CFEB 4GG6E 4S11A 2E7CA 5L6YH 2CLRA 3DROB 4RWYL 2FL5A 4ODVH 1FIGL 1IE5A 2ERJB 2JCCA 3BP5A 4NKDB 1NANI 2YZ1A 3QP3A 1LO0L 1MF2L 3MJ7B 3WUWG 3BGAA 4Z7UB 5JXED 5DRXB 5E2JA 2ZG1A 2CRZA 4LQFL 3OR7B 4P0DA 3FFCD 4FFWC 2HKFH 2VITB 4JZJB 3O9WB 4LCWE 3HE6B 1KPVA 4D8PA 4JO2H 1AXTL 1INEH 4JG1L 4HKBB 3SDDA 5DC4B 4PJ9D 1X4YA 3VXSD 3H7BA 3U6RA 1MCOH 1SEQL 2V2TB 2WIIA 3V2AR 5GS0H 5EC2B 1BQLH 5LXGH 4XPBL 2E6QA 3BO8A 4U2ZA 3BP7A 2ATPA 1A6TA 3MSPA 3U46A 4LVNB 3KS0J 2YPKA 1A6AA 1EEYA 1OW0C 5GZND 2AJSL 3CUPB 3PDOA 3BGMB 1B4JL 4YDLC 3V5DA 1F4XH 2R2EB 1MFDL 4P3CL 4JDVB 5FYLH 1FDLH 1AIFA 3DX9A 5DJCA 4XPHL 3MRLA 4HS6B 5C07E 5D7KD 1AHWC 2ZPKL 3B6SB 1TJIH 3SE4C 3GSNL 5KVGL 3FQXB 2ATKA 1S9WB 5TDOB 1UXWB 1QVOB 3HI6H 3O6MH 2KL6A 4EI5D 4R0LC 5CEYB 1ZANH 2XG5A 1Q8MA 1K3IA 5A43C 3IF1A 5DMKB 3P4MA 5DZOA 1BD2B 2AV1A 1FNFA 1LWRA 2IQ9H 2NY2C 4MNQA 5DR5L 2HVJA 4NUGH 4OIBA 3WJJA 4WI6A 4PJHB 3NIGE 1OM3L 1DUYB 2F19L 1E4JA 1QKZL 2APFA 1T03L 1BGXH 3WHE0 1RJZA 2Q87A 5J3HC 4FG6D 1EJ6A 2XN9E 3V0WH 3QIWB 3HG1B 4ORZC 1KV3A 2HKHL 1Q94A 3KPNA 4KJYB 5TF1L 2EXWC 4OKDA 5F9WB 2UZXB 1CN4A 1IGTB 1MRCH 1S7SA 3KPTA 2A9NH 1IGFL 4IDJH 4W6YB 3SN6N 5ADPH 3VFPA 4P4KB 4GMSL 1G7JA 2IH1A 1FC2D 2C7UB 3EYUL 2O93L 5FHAH 3CDGA 4WY7L 4PGZA 2GFBB 4EBQH 1MFBH 1BZQK 3RUGB 5IUSA 3MXVH 1RHHB 1S7QB 4HV8A 3VWJD 4A2LA 1E4XL 2ED8A 5CLTA 1P5VA 5C0EB 1QBML 4K94H 1KJVB 3GZKA 1EJOL 1Q0XH 3FN9A 1DLHA 1D5ZB 4J3WA 1A22B 2V5TA 5CZVH 3HZVA 2BXZA 4JZNB 1FBIL 5KW9H 3ARGB 4X7DC 3CVHL 1CIDA 2XACC 3I50L 1F11B 1GGCH 3DVFA 4LCIL 2BNRE 5EULV 5ID0A 4K7PY 5KSBF 1HXMB 1GC1H 3HE6A 5E56A 4NKOB 1W0YT 2Z35A 1RZKL 3PXHA 5TFSL 4I3RH 3MJ9L 1FFOA 2V2WB 2R4SL 4PLKD 1DE4B 4OZIF 2C4FT 5AYUH 3QEHB 2JIXA 3TZVB 1F42A 1XGYH 4H0GA 4RGNE 5I8CB 4OZGF 1JFQL 4H1LA 3QDGA 3T4YB 1MCJA 4L29A 2ED9A 4X7EC 3CUPA 3QUZB 3BGMA 1QSFD 5HTSA 4OV5B 1ZHBB 3WLBB 4PJCF 3AROA 2R2EA 2UZYB 4JDVA 1CK0L 3HC0B 1J9CT 2HG5A 4C58B 5I8OL 4OLYH 4HS6A 2J6EA 3B6SA 3IDUA 3LS5H 1UQSA 1S9WA 3HLAB 3VXRD 4X9FA 4I3GA 1M6OA 1DQTA 5CEYA 1VEPA 3GKWL 1BPVA 3BAEH 3WL9B 2YKLH 3OGCA 2IANA 1YEKL 4NHCL 4QRPD 2E6PA 2Y5TB 5L7XL 1KXQE 4HFUL 4JHZA 1G6RA 2VISA 2EXYC 4NNPL 1MWAL 1HCVA 5I17B 3MV7D 2NXYB 3HG1A 1BF2A 2R69L 3UYRL 4W6WB 3G08B 3C5ZC 5ABDE 4BH8B 1NLBL 4KQ4L 4D9LH 1BJ8A 1IGTA 3N1GC 1RU9H 3UTSE 4M9PA 4NQDE 3CLEH 1KCSL 1T89A 4Y5XC 4HEPG 3SQOL 1JP5A 1DTUA 4P4KA 3IFNH 2X70A 3REVB 5IQ9A 3MREA 5KS9B 3OAZK 3RVVD 1V7MH 1QLEH 3GEWB 5IBLD 1F8TL 3ARBA 5B21A 1IRAY 5K9QG 1KJVA 5SX5H 4WJ5B 4LSVL 4PRNB 1KN4H 2NY0D 2J8UA 4PJ7A 1KN2H 2PYFA 3WJLC 4A6YH 1EMTH 1P5UA 1B88A 4Z78B 1NUNB 3MCLL 4YHML 1QPPA 5DMGC 3U0WH 1T2QL 1UH2A 4IJ3B 2VQ1A 3QUYB 1YEFL 4M00A 5CKGA 1HXMA 2ADFH 4HIJA 4KDVA 4YO0B 4XPGL 2DLIA 1MHEA 5IJKA 2CR3A 3QBTB 1A3LH 4JFEB 4R7NA 4HMCA 4NQVB 1FP5A 3FMGL 3O4LB 1D9KD 4KKLC 2XY2A 5I8CA 1MPAL 2YUZA 4J4PC 4LFHD 3R06A 3B9KC 4F33B 4YR6B 3HR6A 2VH5H 3E8UL 2PN5A 2FB4H 4KH2A 3T0EA 3QUZA 4KVNH 1MCPH 1BWWA 4PP2B 1ZHBA 1QBLH 2D03L 1Z0NA 5TDNB 3KPOA 4J3OC 1HZHL 4PRPE 4MDIA 2EDFA 4BZ1H 1I1AB 4OQTH 4XP4H 4PJBB 2VERN 4LRNH 4YHNA 5HGAB 4LCCB 2J4WL 3MV9E 2WIMA 3HLAA 2OL3L 5AZ2H 1A9BB 2DI8A 1A7QL 4JZOB 4F7EB 5JW4Q 1GGUA 5DT1L 3T2PA 2HMIC 1FGVH 4L9DA 3VD3A 5DWUL 1JYWA 3KWWA 4LCUB 4UTAH 4FOMA 1G0DA 1FNHA 2QLVB 3LMJL 5GZOC 4TSAH 3V7AG 5C71A 4OZ4B 3BEVB 4WU5A 1FL3B 4HH9A 3QQ4A 4HK3J 3PNWA 3JUZA 1OTTD 1J0YA 4FNLH 4OCWL 1SQ2N 3NIFF 3DETC 3FFCE 4XBGB 4OF6A 1KXVC 4GKOA 2AXGB 4BH8A 1IAKA 3BISA 4BH7B 1OCWL 1CDHA 2PTTB 2XKUA 5I6XC 5T1LB 2EC9T 4LNRB 5CCKL 4IRSA 3VXSE 1AY1H 3D85D 1MCNA 3VH8G 2NY6C 1YUHB 5EN2B 2Y7QA 3O9WD 5J4MA 5KS9A 1UB5B 5D1ZB 3S9DB 1WBXB 5JOFA 5B38A 5TPWH 4ZFGL 3EDDA 4POYA 3JWDL 2NY5L 5HHVH 4U2YA 3QI9C 1FNGA 3U1SH 1P1ZB 4XPTH 4PRNA 1HKFA 3PQYE 4UNVA 4XVSL 3R4DA 3HE7A 3DVNA 4O4YL 1HHHB 3D5OF 1CDJA 3NCJH 1ACYH 1V5JA 2YS4A 3S8WA 4YO0A 5E8NB 1IGMH 4PUBL 4UT7H 3EO1B 3RWJA 1MJ7L 4YNYA 3RTQC 3QQ3A 4OGXH 3RJQB 3GMOA 4ERSL 3N1PC 5C2BH 4G9FA 3O4LA 3BZEA 5F71A 5JNYB 3QWOB 4D2NA 5IMOB 5HI3D 5CEZL 3D87B 1T83A 1BD2D 1CL7I 3GSRB 4QY8B 4ZS6C 4KQ3L 3ES6B 4L8DB 4JFFB 4PR5A 1MVUB 5TDNA 1TMCB 4HAFA 1C5BH 2PO6A 1ES0B 5FUCE 2DBJA 4M1GL 4MQ7B 4PJBA 1NJ9A 5KG9B 3MLTB 1CTNA 1HQRB 2VLKD 5D93B 1OSPH 5HI5C 3S3JA 1G7LA 1A9BA 4K7FB 1JNJA 3AMKA 4GG6A 3N9GL 4F7EA 1YQ2A 2BDNL 2WWMC 4ZAKC 3G6JB 3GNML 4GW1A 5HI4C 3HS0A 3DXAD 4P9HH 4R6UA 1TPXB 4HUMB 1T3FB 4ZD3H 3SBWA 4MA8L 3KPQB 2DM7A 1FL3A 3H9HB 1SJEB 4X7CC 3ZT7A 1LO5A 4PGEB 2ZUSA 4JQXA 4LCWA 2H6PA 2L4OA 4BQ8A 1MLBB 5L8LB 4XP9L 3C6SB 2WUCH 1NMCC 3ECBA 3RWCB 3SDXF 3MRMB 2I07A 2AXGA 2NY7H 2AJYH 1YJDH 5EC1B 3ZHLA 2PTTA 1CS6A 1KB5L 4LNRA 1GSMA 5ADOL 4DZBA 5FF6A 2ZUQB 4FXKA 2RIKA 5JTWA 4KZEL 4PBWD 4RDQG 1SHMA 1AP2A 3WV0A 4KK5D 1UB5A 4P99A 4N0YL 4LU5L 1LO2L 2ZUUA 3QQ9D 3RVTC 3SCMB 1G7HB 2B4CL 2GY5A 4PJAB 3K4ZA 5EUKB 2F5BL 2P8LB 2LV4A 2AW2A 5C07A 3K0WA 1QSFE 1IGIL 3AFLA 3TZVD 3CFDB 1HYSC 3K2UH 3QXAB 1AFVH 4X6CE 1A7RL 3DO7A 3WKNA 4LQ1A 4KRPC 1BOGB 1U8NA 2DQGH 4PJGF 4BZYA 5A2JH 1YEDB 1YEIH 3FFDB 2OM5A 3TCLA 2AABH 1YN7B 5KSUA 3WIHA 4HSQA 4HBCH 3I02B 2AEPL 4BFIB 2V5MA 2ITDB 5IF0B 4HLZG 3SDAB 4PLJC 4TVPH 1ZGLB 4KROB 4PY8J 5GJTH 3IDJB 3K8KA 3TYGL 3DVIA 4RAVA 5FIEA 1AD9A 3EJYD 3WS3A 5IMOA 1FH5H 2EZ0C 1RUAL 2DI9A 3A6OA 2KQMA 4K7PX 3R1GH 4QY8A 4ELME 3MV7E 4JFFA 3VRLF 1IC4L 4WW1B 5FA3B 3I6LE 2DQDH 3IDXH 1II4E 3EYFB 3MODH 4PREB 2AGJL 7FABL 4ZOCA 3BKJL 1HQRA 4MQTB 2LAGB 3TV3H 4JFYA 3RKPA 2W1NA 4RISH 5DA4A 2DWEA 4H1LH 4YHYC 3CFJA 1KYOJ 4KXZI 4J1UB 4U1KB 2BY0A 2PXYB 2GSIB 5JXAH 1T3FA 1DLFH 3E3QC 1N6UA 3TVMB 5CEZD 3KPQA 2A73A 4EKXA 4KWUA 4F7PA 4PD4K 3VD9A 3U36B 3H9HA 5LVEA 4RGMB 3ZKXC 2J6EH 1HQ4B 2BNUA 1PSKL 4OD2B 2WLYA 2D7TH 4WI5A 1D5MA 3C6SA 4EIZC 2IF7A 3OV6A 4U1NB 2HJKB 3MRMA 5FYJL 4YWGL 5D5MB 1HSAA 3MRFA 3KPSE 1H15A 5FK9B 1FLRH 2JJTC 4U6XA 4IRJB 1XH3B 3O0RL 3O4OB 2BSTB 4J23A 3BN9D 3I6KA 3JWOH 3MRPB 1KCRL 3TT1H 4LARL 3MRRB 1TZGH 1KTDB 1G6RH 1ZMYA 4UBDC 2FR4A 1JHLH 5SV4A 2OSLB 1FVCB 2GT9A 4JFED 1UJ3A 3FOLB 5F1IB 5EUKA 1C5DB 4I0KA 3ARXA 1TCRB 2NY3B 3BRFA 1ODAA 5GRZA 1CLYH 3DGGA 4IBLT 5I71C 5F97E 4AENA 3QXAA 1W8OA 3SO5A 1RJYA 5DJXA 1QFOA 1INQB 4DKFL 2WINB 1RZJL 2ZJSL 1U8HA 2HFGH 5FCUH 4PRBA 1YEDA 3QQNA 4XX1G 3L3HB 4OLZL 2GKIA 4JB9H 1RZ8B 1YN7A 2Q86A 4GFTB 4BFIA 1I1AD 4K9EL 1NEZG 4GRLC 5IF0A 2NW3B 5L9DL 3QG7H 5SX4I 4JREC 3WUZA 4G80B 4NN7B 4NYLB 2D7MA 5JIHA 4RA0C 3SGJA 3O3EA 3O2VH 5E7BA 4ENED 3CSYB 4X98A 5IB3B 1GIGH 1JV5B 2Z92A 5CZXD 4M02A 5DTFB 3Q0HA 3PWJA 3UTSA 4NQDA 5FA3A 5LGKA 4PV9B 1XCQB 4Y2DA 4MA7H 1NSNH 2H8PA 2XXCB 3LSOA 3RVUC 1UWXH 3OJDB 1NCWL 4HHAA 4AT6B 1L6XA 2E27H 3FT3A 3W11C 4JM2B 1HINL 3MTRA 2HA1A 2Z93B 4ZNEE 3H2WA 4Y5YB 5HHQA 1WZLA 4U1KA 2FATH 5T1LD 3BT2L 1MFEH 1Z9MA 1I8MA 2R2HB 3TVMA 4GXUM 2Y07H 2FJHA 4ZXBC 1Y6KR 4NWTH 4OCLC 1HQ4A 5F89A 1G9NH 5FUOH 2Y06H 3O2DH 1X5HA 3LY6A 4OD2A 1ETZA 4Y19D 4YHLL 2HJKA 2BVUA 3MA9H 1IC1A 5MEPB 4EXPX 3LQAC 4BK4A 4IRJA 5LAXB 1XH3A 4EUPA 1FHGA 5TQ2L 3P4OA 5EOCJ 3U0TB 2BSTA 1RVFL 1OAUH 4S1QH 4NGHL 1LQSR 3L9RA 5JIPA 4FFVD 2ZKHH 5KSAC 4M61B 5CSZA 4HJJL 32C2B 2B0SL 2E7LA 3ROOA 4PRPA 1G9MC 5ALCL 4OKVA 1HH9B 2CDGB 1QFHA 5FEBA 2XRAL 1NUFA 2HTLD 1R3HB 2MMXA 4K23L 3MUY1 3QG6B 4APQD 3MV9A 4KHTH 1P7HL 2UZIL 1T21B 1KT2B 2IC2A 1INQA 1U8PB 2WINA 1TJGH 2CKBL 4JLRB 4JR9H 5T1KD 1JGEB 4O58L 4OGAD 4HULB 2VLKE 4PRHD 3L3HA 1RZ8A 2ZOKA 1CE1L 3C6LB 4KKCD 3FONB 1LEIB 1IBGL 4U1JA 1V3JA 5CJOH 4KJPD 1CICD 1I3VA 5EZIH 3DXAE 5EZLA 3QUXC 4G80A 3JBG7 3ARYA 2AI0H 5E08H 4QLRA 3MV8B 4NYLA 3Q5YA 4KI5C 3HUJF 4E42B 5JXEA 3MCG1 4TNVF 3Q6GH 3WHE1 5DC9B 2EE6A 3CSYA 3OB0K 4ZFFB 4I9WD 5IB3A 1JV5A 4F9PC 3HMXA 3BPLB 4LGRB 3L5WB 3O8XB 1U3HA 3W82A 4EOWH 2Y6SC 3H3KA 3RWIA 2Z31D 5T33L 4NO0B 1VPOH 5D72L 1PZ5B 3VXSA 4DVRH 1JGDB 4LEOA 4OLUH 4OM1H 1FSKC 4XCFL 5ECJE 4N8VG 4OD1H 2VR9A 1JZ8A 3VFUB 2IPTL 4X7TA 2IAMC 2X4TB 3WS6C 1FVEA 4WHYH 4OCNC 5FYKU 2EDYA 1QR1B 3VD5A 4QKXB 2FBJH 5D1XC 2XWJB 1UM5L 4L8BB 4JKMA 2DLTA 5B22A 5EU6B 4I3SH 1J1XL 2QSCH 1LDSA 3GSWA 3FHAA 5GGVY 3VDCA 1N6QH 3EJZD 2A74B 3PQYA 4OI7A 1TIUA 5GGQH 3IDMB 2QKIA 1NCDL 1D5XB 4EN3C 4TTDD 1ORSB 4QXTB 2BVPB 1EPFA 3FQWA 4UU9A 1GHFL 3LN4B 3PL6B 2XQYG 3QYCA 3QA3A 3FO1B 5DUMH 5KSBE 1J5OL 3EOTL 2QQNH 2XZAL 5LAXA 3G5ZA 4LF3A 2HT4D 4PJDB 4XT1C 1T6VN 3B2VL 5IMMB 5CS7A 1IEBA 4N9GB 3D2UB 1JZ3A 2P48B 3VXPA 4NN6C 4XTRC 3D69A 1DN2A 1KBGH 2HWZH 1N6VA 4PRAA 5I8KH 5ITBH 3W39A 3SDAD 1HH9A 2CDGA 3VFTB 1QOKA 4QRTA 5CMAB 3ARED 1JHKH 1X5YA 1MIML 3BP4A 5TH2B 4PJCE 1CZ8L 1MCFA 2CDEB 1TZIB 4ODHH 3RDTB 4I48B 3RL1A 1JGEA 3MBEB 1HHKB 1OY3B 5IK3A 4DGYL 2ZP0T 1UH3A 1YPZE 5KVFH 5DJZB 3UO1L 3MRDA 4OCRL 5CGYD 4XBEL 1KLUA 2MHAB 3OKKB 5EZOH 2CD0A 4KZDL 2PTVA 5EORH 2B1HH 2VDKL 1W72L 4ZUSA 4LGPB 1EBAA 1NFKA 5DS8A 3T3PE 3F8UB 1I9IL 3MV8A 3V6ZA 4LASH 3U30C 5CEZE 4E42A 3FO9A 1NGZB 3UJJL 1J0IA 3IDYB 4CDGC 5D2NE 1AGCB 4ZFFA 5J1AB 5I1CL 3HHRB 3SDCD 3L5WA 2PXYD 4JPVL 5ESQB 1U36A 1N64H 3SKMA 5I2IA 5IOPB 1YC7A 3EW3B 4U6VL 3VW3H 1FO0L 3NTCL 1T66D 3WIHH 5A3IC 2VDML 1PZ5A 1UZ6F 5C9JA 3RGVC 2W0KA 1CFSB 3SHSA 5LBSL 2QQLH 3V4VH 4BM7A 4K2UL 1KB9J 3ZYIA 1EK3A 4ORGA 2HH0L 3MUGB 4U1GC 2MPAH 1CL7H 4HLJA 5ACZB 2ILLA 4JRXD 3QDJB 3QFJB 2BSRA 4H0HB 1HILB 5LWYH 3U4EB 1QSFA 3IU4H 1E4XI 3ZT5A 4QRSA 1JL8A 3P9LA 2A74A 5BV7L 3MRQB 4OCXH 1Z6JT 5GS0C 3UC0L 4Y16B 1P6FA 2Z8RA 3AXLB 2AQ3A 3CVHB 5IQ7H 5ICYB 2I26N 4AEHL 5FGCE 3ULUD 3TBWB 3SO3C 1U8IB 2ZUTA 1S7TB 2D31B 4R26H 4F3FB 2NY4D 3NCMA 5EWIH 3U9PH 1KELH 3SE8H 3FB7A 2DLFH 3CMOH 2UVFA 1XF5B 1JNHB 1NPUA 3QXTA 3H8NA 3INUL 1TQBC 4NC0B 3FO1A 1UACL 1MUJB 1S78D 2M26A 4L5FH 1TQCB 5BOZG 4UILH 2VC2H 4PG9B 4PTTB 1YECL 2ARJB 4Z7QE 1JYVA 1B9ZA 1I7TA 4JFPB 2UV3A 1R5VB 3PDGA 1U8KB 3QUMA 4K55A 2ZG3A 4Z0BL 1WQVT 3ZKNC 5JOPD 3X11B 4LIQH 4JJHA 4N9GA 1LHZA 2LU4A 3D2UA 1YMME 3MV7A 1YNKH 1CDGA 3O2WH 3THML 3UPCA 4C56B 3MRHA 1V3LA 3EO9L 4G8EA 4DQOH 4RDQF 4X80H 4PJIE 4UUJB 3V4PH 4ZSOB 3GSNA 4U1HB 4JVPA 1KCLA 1P4LA 3IDNB 5TH2A 5L88L 3BKMH 3DBXA 2K7QA 3TC9A 2R1WA 4WTXA 3RDTA 4I2XB 4NRXB 4Z7VE 1T22A 2EIDA 4ODUB 1NBVH 4KVCH 4L4VB 3LKOB 5F6IB 4TSCH 4FMKA 3HRPA 1OP9A 4XZUA 2V7HB 5IB4A 2MHAA 4NO3B 1ZLSH 2A9MH 5DHYB 5GS1A 4JCLA 5DJYA 3VMPA 5HVWA 1MWAB 4C55A 3S96B 4M5ZH 4WEMB 4C4KT 3MJ8B 1MCRA 3QIBC 4GXVH 4CU6A 1NMBL 1LEKB 4Y4HD 5DDHA 5F88A 5TE4H 4CMMA 3HRZA 3WO4C 4JM2D 4FQXB 3HA0A 1O0VA 2FJFB 3N50A 5J1AA 1D5IH 4DKEH 3EYVB 4L8SB 4XBPB 5JA9A 2YUVA 3KPSA 1A1OB 5IIEB 1NFDF 5IB5A 4K94C 5IOPA 4Y19E 4ISVA 3E0GA 3MXWH 3ZKMC 4QCIB 1CDYA 1K2DA 3EYSL 1UADC 2ZCKH 1ZT1B 4YQXH 1C5CL 5GRUH 2D7PA 2YD2A 1XCTA 3GJEB 2NZ9C 5K59E 3EBAA 2FWOB 3TN0D 3MUGA 2H26B 1GC1C 3QDJA 3QFJA 1XEDA 3EDFA 1C1EH 2DQEH 2R8SH 3W9DB 3L3JA 2R29H 2UUDK 5HYJD 1KCVL 3VFSA 3MRQA 4U0RC 1KF9B 3C60A 3UJTL 1HYRC 3CVHA 4Y5VB 3OAYH 5ICYA 4M6AA 4YZFF 2OP4H 4EQ3A 2D31A 3F7VB 4F3FA 4P2QD 2W0FB 4OSUL 3MJ9A 5FYJE 4XAWH 4CVXA 4LSRL 3CK0H 4KXZH 4ZDHA 1BBDH 4RAHA 5DQJA 2FX7L 3GM0A 3H9YA 4PRHE 5AZEL 2YRPA 3UBXB 4K3JH 4QHLA 5D7LB 5EBMA 5HBBA 3NFNB 3EYQD 2EKSB 1SY6H 1J8KA 1RD6A 3H9SB 3SY0A 4H8WH 1R5VA 1BP3B 4XVTH 3UBXI 2HN7B 4JCMA 5GISL 4QHUA 3IFLH 4HIIB 4YEEA 3P0YL 1LK3H 1PX3A 1GOFA 2KZWA 1CQKA 5B39G 1HSBA 2KKQA 4GBXB 2BY1A 4HKXA 3MMEB 4I9WE 4MAYC 1X5XA 3WDJA 1ZLWH 3PV6A 4YDLB 2OL3B 2DQJH 5DJ0A 3Q5TA 1N0XL 2EDLA 5KSVB 2ICEA 4HPOL 3A67L 1G7PB 5K9KB 3OJ2C 4ZUTA 3GMNB 4EUPH 3D85A 5E6IC 1AHWB 4I2XA 3G5YA 2B39A 4FP8L 4ODUA 4R96B 5CJXC 4L4VA 4ZUVB 2HJFA 3DMMC 3MUHL 1Z9OA 4F7TA 1KOAA 4WWKB 4JJ5A 3MRCB 2V7HA 3MUZ1 4R0LB 4X6EB 5DEGA 4NO0D 4NO3A 1AO7B 3TBTB 4WUUB 3VXUB 1YN6A 4XNYL 2F5AH 3GI9L 4YX2H 1E28B 2DQIL 4HIHA 3OR6A 2DQUL 1ED3B 4HUUA 2NY2B 1MWAA 3T2QA 1AXSB 2V7NB 4M62H 1YNLL 1LEKA 2BFVH 4BUHA 3G6DH 5T5FL 4FQXA 2YBRB 3P30L 1OTUC 2Z4QA 1IGCL 3EYVA 3LD8B 3MJ6A 5ERWB 1A1OA 3X3FH 1CGYA 4O9HL 1UZ8B 1CFTA 1IQWL 1JWUB 1ZHNB 1CLOL 4JFZL 1G7QA 5LG1A 4P5TA 4UNUA 5AUMA 5D1QD 2IBZX 4GLRI 1DEEA 4U6TA 1WC7B 4OZIB 3DTXB 1JGUH 1F3DH 4OZGB 3PL6D 2XWBA 3W0WE 4GJTB 1Z0MA 4XRCA 2H9GB 1PLGL 5I1DB 3UP1A 4XMKH 1EDQA 1Z2KA 4FQQB 1C7SA 3HMXH 4GUPA 1L9MA 3MO1B 3OGOE 3WXVH 1E6JL 4Y5VA 2X4PB 2DRUA 2VLKA 1PW3A 5AAMA 1QHPA 1W0VB 3LAFA 1MEXL 3QCVL 2OTWB 4KHXH 3H6JA 3MRJB 3BH9A 4PJGE 1F3JB 4X83A 1DANU 4YE4L 3DXAA 5D7LA 3UYOD 1ZOXA 4OJFH 9CGTA 4K8RH 2FIRT 5IESL 3DRTB 1EAPB 4NQCE 2JKXA 5JOEA 3MBED 4P9MH 3BD5A 2HN7A 5B38G 4JQVA 4HIIA 3VG0H 3VDAA 1G0XA 2GK0B 2DBLH 5GXBB 2C1OA 1JZ2A 5CHNB 4QOKE 2NLJA 3WIFA 3KLHC 4GBXA 4RQQB 1D6VH 4R2GC 3PWPB 3MGTB 3K1KC 4M7ZC 1I9JL 4PJ8D 2OL3A 1TDQA 5C09B 3OKNA 3VD4A 1KJMB 3AC0A 4QTIH 1KIPB 5AG9A 1X5ZA 3ARTA 2A6DA 4Z0XA 3GMNA 4WU7B 5I74C 3RIFF 4XCEA 5SWQB 3V79C 2V2XB 4P46C 3MR9B 3TBVB 3WDIA 5BS0B 1MQKL 1RULL 1HEZA 4AIZA 5KVEL 2QR0B 4WWKA 2HFTA 2V9QA 3BQUB 1MELA 2P4AB 1DQQA 1S9XB 3OF6A 2UYLA 3QRGH 4JHBA 4ACPA 1AO7A 3TBTA 3VXUA 4JRXE 4ZFZB 1IM9B 1ED3A 5DXWA 5DD1L 1EEQA 1AXSA 3TJHC 1UKSA 1S3KH 1JPSL 3OJVC 5D7SL 3VFMB 5B3NA 2YBRA 3WYRA 4F7CB 3ULUE 4N68A 4XWOD 1DQLH 3WFEL 4KJWC 3K74B 5ERWA 1JPST 5KSBA 1KB5B 3BRDA 3RA7H 3WD5L 1UJTA 3JUYA 4Y16D 2HJLA 2PW2A 3VXME 3C5ZB 3ARDC 2VDRH 3V5HA 5GJSH 5IFJA 5FXCH 3RZCC 1JNLH 1P4BL 1WC7A 5JHLL 3DTXA 2HRPL 3O6FD 4ONFL 3NH7L 2B2XL 4X4ZA 4Y5XB 4R4NC 2VUOA 5DK2B 4GRWF 4JY5L 5T3ZD 4YXHH 1MI5D 5HPMB 1BFOB 4K7PL 4NT6A 5GGSA 4NFBA 3FOMB 4JFHD 1SMOA 3WNPA 2HLFC 2EH7L 1KFAL 5FFLA 5I1DA 5L8JB 2X44D 1HHIA 4FQQA 1RIVL 1L7IH 2ORBH 4LLVA 4PJCA 2FEEL 4MD0B 5I0ZA 2YEZA 3LV3A 4YBQD 3HMWL 4PV8B 5IP4A 4ZTPH 4WIQA 3GIZL 5E95B 1YPZA 1W0VA 2VABB 4WWID 1UC6A 4C56D 2LQRA 4L3CB 1JWSB 5IMLA 2Q7NA 3CC5A 3MRJA 3NPSB 4RWYH 3BRGC 1FIGH 4LPTA 3ZL4L 5C0BB 3WO3B 3SDDC 1LO0H 1MF2H 3U7WL 5GGUB 4RRPG 2GTWB 3HFML 1DBAL 3QNYA 2LU3A 1Q9OB 3T0BA 1CXEA 3RVWC 1V3MA 4XPAL 4LQFH 3GBML 1OVZA 5D2NA 4E5XA 4DOHB 4XCYB 2FGWL 1CCZA 4KKBC 3OKDA 2GK0A 1MFAL 5H94B 5DJAB 1AXTH 2FECL 3B9KB 4JG1H 4P9HC 1OAKL 3R0MA 3V0VB 3WDHA 3ZTJH 4RQQA 3E1F1 1QTYT 5CD5D 3PWPA 4G8GE 2BVEA 2G9HB 1SEQH 4N0CC 1DQDL 4B0MM 5C09A 2KZ1B 5IB1A 1KJMA 2JCCF 4P23D 4QF1A 4XPBH 2QSVA 3LKSB 1JGLL 4LLDB 1PJ9A 2DWDA 2V2XA 1BLNB 3RY5A 4OF5A 1JN6A 5BS0A 2WUBL 4PBVC 2AJSH 4IHOA 3BQUA 1B4JH 4XHJD 5ITFA 5IV2B 3L3DA 4P3CH 1MFDH 2D2OA 1YJDC 3LKQB 4XPHH 2WQRA 5C08B 1I3RB 1Q38A 3WJJC 2ZPKH 5HYJE 3GSNH 3N0PB 3RPKA 5KVGH 3DGCR 2YC1A 3JV6A 1C12A 2EDRA 3NCYS 5DK3A 4MQXD 5JW5B 4YFDB 1XIWA 2J88L 2NR6C 4NPYA 4P2QE 4NRYB 5DR5H 2VWEE 5EU7E 4Y0GA 1FFQA 4CJ0A 2LABA 1OM3H 2F19H 3M8OL 4P49A 1QKZH 1UEMA 4Z18A 5HGDA 1T03H 1RJCA 3L6FB 5I6XB 4NQEE 3IDGA 4NOFA 1MCEA 1YMMA 2X4UA 1LP9E 3OBAA 1T0NB 2NY6B 4FFWD 4JY6A 3FOMA 2HKHH 5TF1H 1JYXA 4QRRB 4V2CB 3F65A 3ZDYF 2CH8A 3QEQB 1M4KA 3GSVB 3H9SD 1IGFH 4F15C 3RWGA 3ZDXE 4Y89A 4GMSH 1U8MB 4Z7VA 4NP4L 3EYUH 4J8RB 3GSXB 4WY7H 4OZFA 3UX9B 5DMYA 3B3IB 2X4RB 4L9LA 3OAZH 1E4XH 1JWSA 5CD3B 5IKCB 3HE6C 5CSBA 1QBMH 2ADIB 4FQJL 2P1YA 3C5JA 5ICXB 3D39E 4U4BA 5DRWB 3RIAF 1EJOH 5C0DB 3UTTE 4FFYL 3QPXL 2GTWA 4F58L 1KPRB 4JAMB 1FBIH 4S2SA 4HG4J 1DR9A 4IOIB 3BVNA 3CVHH 4LCIH 3I50H 2PF6A 3REWA 5FM8A 3RQ3A 1LD9A 5DRNA 3AM8A 1A1NB 1ZA3B 4LSUL 4CUCA 4WUUD 3LKNA 4Y19A 5F1NB 1RZKH 3V0VA 5TFSH 1A7PL 3HUJE 2PYED 5D7IE 5K9OB 2FH8A 2HFFB 3MJ9H 3WLWD 5IEKB 3SDXB 2R4SH 3WFDL 4E0RA 3U9UB 3FQRA 3GFUA 5J89A 1NGXB 4D3CL 3H0TB 1IM3A 2D0FA 4JN2B 4U7SA 2DM3A 5GSRA 3V9FA 1JFQH 1LK2B 1CFNA 5J3HD 1BLNA 1CWVA 4J3TA 3KPPA 5I18L 2QQKL 2APTA 4FA8A 3QO0B 5DQ9A 2BY3A 5IM7B 5D6CB 5IV2A 4U31A 3FQNA 1KIRB 4PLOB 1IVLA 1CK0H 1OL0A 1R24B 4KKAC 5I8OH 4DZ8A 1I3RA 3RU8L 1YYLL 3TIEB 3JWOC 4Z77B 4APQA 2P8MB 1MJ8L 5MEOA 3IAQA 4QT5B 2C3WA 4WFGE 3BXNB 1TZHB 3GKWH 5L2KB 4YHOL 2GK2A 1MHCA 1T1WA 4HDIA 4P2OA 3VFNA 5JHDD 4X6FB 3VWKB 2ZCHL 1NMCB 1YEKH 2X89D 3V7AE 4NHCH 2L7UA 1LE5B 5L7XH 2VTFA 1A21A 4HFUH 1JMZA 2WV3A 1T89C 4NNPH 1MWAH 2D7QA 4P4KC 3M17B 2F74B 5FYKL 2HMID 2R69H 4JKKA 3UYRH 4XI5C 2X6MA 2Z91B 4JY4B 2V17L 3DURA 1NLBH 3TF7C 2UY6A 4KQ4H 3ARBC 4GW4A 3X3GL 2PTUA 4ZS7L 2Z31A 5I19L 4JPWL 1KCSH 3SQOH 5DURB 4X8JB 1U8MA 5DLML 1P2CA 4KRPB 3SGKA 3ARGC 2EYRB 5I1LA 1F8TH 3RIFK 5CD3A 2VZ1A 4DAGL 5FKAB 2FHBA 5ETUB 5IJKC 4XC1L 3MRKB 4LSVH 5C0DA 4HFWA 5EFIB 3MNWB 3MRIA 3DVGB 3N06B 2C3XA 8FABB 4JAMA 1IEAB 5ANME 2F54B 3MCLH 4YHMH 5DQDL 1S7WB 1T2QH 2GUOB 4IOIA 5HHNA 1YEFH 2OTUB 3GUTB 2O5ZL 1A1NA 5C0NC 4RFEB 2O61B 3DX6A 5F1NA 1KJ3L 4HEME 1IM9D 3T0EC 3QUZC 4Y4FB 5E8DL 3ILPA 3SDXA 1RZGA 3FMGH 1NGXA 2D7OA 2X4OA 4JRYB 1WK0A 4PJFE 2YA0A 4OB5L 3PP3K 2J8UF 4F37K 1G9NC 1MPAH 4PJ7F 1LK2A 2CMRL 2EXYD 3W0WA 3B9DA 1ZHKB 4OV6F 4RMVA 5F6HI 3E8UH 3NACL 2O5XL 4ZO9A 3T0XA 5T3ZE 3FJTA 3RVXC 2D03H 1MI5E 4ZMAT 1QFWL 3LZFL 1HZHH 3SKOA 4X0KB 4YHYB 3TH3T 5A2FA 3P9MB 3NN8B 1QQDB 3ALXA 4YK4B 2J4WH 4YUEL 3GJFA 2OL3H 3AB0C 5C3TA 4OFYD 1YMHB 1A7QH 1VFBA 4NOBA 3BXNA 1TZHA 4P23A 5DT1H 3GMQA 4PJGA 5DWUH 2NXYC 3O3AB 1N7ML 3B2UC 1U8QA 4X6FA 3C2SA 5C7XL 3X13B 1A9EB 3HKFA 3WUWA 4NQCA 3LMJH 1ZTXL 1LE5A 2VAAA 3WE6A 1BZ7A 1GGYA 3V6OA 3LRGA 4IRSC 1EO7A 4O51B 3P0VL 4ETYA 5CKAA 1JMXA 2X4NA 3FL7A 2R1XB 4QOKA 2HFEB 3I9GL 5DMGD 4OAWA 2B7DT 2Z9TA 5GRXG 1E4WL 4OCWH 2XQYK 2DIJA 4GAGL 4WEUD 4X5XB 2R23B 2VIRB 4BSWB 1OCWH 4HWZA 1QYGL 2CKBA 3V8CA 1A1MA 1VDGA 4LP4A 4NHUB 1J1OL 5CCKH 3TJEL 2VZVA 2AEWA 1Q72L 4D0BB 1WZKA 2JB6A 4MJ5B 3ARRA 3HE7C 2NXZD 2VR4A 4LSTL 4J4PD 4NZTL 1T4KA 3B9KD 4G8IA 2DICA 3HNTH 5IVOA 2EYRA 3V5KA 5HSFA 3K4DA 3QUYC 2QADC 4ZFGH 5I16B 1A2YA 3JWDH 2NY5H 1MAJA 1VFUA 3CMGA 1W72B 2XNAA 5E2UL 5FKAA 2XTJC 4JFDB 2GTZA 3RBSA 2BC4B 2P46B 4GAFB 3W81A 1RK0B 3OTTA 4XVSH 5EFIA 5HVHC 4GRLB 5GGRA 4YBLB 5GGSY 4O4YH 3IVKB 2HRLA 2GAZB 1NGYB 2DKUA 3F5WA 5K33A 4JDZA 3D1MC 3LKRB 1A6PA 2EYTA 4RFEA 1I7UB 4PUBH 3GGWA 3STZB 1CR9L 1T83C 2XZQL 1RJLB 1ERNA 1MJ7H 1QRND 1ZA6B 2P43B 5JO5A 3VXMA 2GJ6B 3QNZA 5I1HL 1MCBA 3WNKA 4ERSH 4LKXA 5GSVB 2P49B 5SWSD 3BIBX 5GZOD 1NFDE 3DRQA 3BDXA 3IJYB 3BJLA 1JZ6A 2W65B 2VLRB 4CVZB 4LCCC 1JRHI 5CEZH 1NH6A 4AQ1B 1YDPA 1FNSL 4KQ3H 1FPTL 3ILQD 1KENL 3FO2B 3DETD 3L7FB 4X0KA 5F7HA 1HCFX 4M1GH 2OBGA 3NN8A 1HI6A 2VQUA 1T20B 2LFGA 3SBWC 2VXTL 1UM4L 3MOAL 3S98A 1XGPA 3TESA 2E9BA 4NZRL 2Z8WC 5EU4B 1YMHA 5C0GA 5CILL 5HJ3B 1OB1B 3N9GH 4JQXC 3H9ZA 2BDNH 3MCKA 1GPOL 1X44A 4K3EL 3GNMH 1R0AL 3RBGA 4IOSD 3QEQD 1H3PL 1WEJL 3X13A 1FZJB 3C5SA 4WTZG 5F9DC 4D9RD 3QI9D 4MA8H 5K9QI 1I1FA 3WNMA 1UXSB 1UG9A 2EEAA 4DVBA 4O51A 1XGQA 3CU7A 3QXDB 2A6KA 4S1RL 1CGXA 4XP9H 1P7QB 43CAB 5FA4B 3UTZB 1BWMA 2Z8SA 1K8DB 4ZO8A 1ND0B 1LDPL 5KSAB 4G8GA 1PKQB 5D71L 3KJ6L 3KXFD 2VIRA 4HWBL 5H35A 3RTQD 5ISZB 1MOEA 2PYEE 1KB5H 4OM0L 4G5ZL 5ADOH 2OZ4L 4NHUA 5JPMB 2ESVD 2NX5B 1P9MA 1WWBX 4KZEH 1BVLB 2DN7A 2IMNA 2EE3A 3TN0A 1CD1B 4N0YH 4LU5H 1LO2H 43C9B 1CE6B 2B4CH 3MLYL 5I16A 1X7QB 4E41B 2FHCA 4YDIL 4ZS6D 1W72A 4CDHA 4KJQC 2F5BH 2OS7A 1IGIH 4NUJB 5A16B 1ZT7A 4I0PD 1A7RH 5F72S 3IGAB 1BREA 4XMLL 1NGWB 3WNOA 3OKEB 5KVMC 2GAZA 3QDMB 3KYOB 3QUXB 4XNQB 5C86A 4HK0A 1OTSC 2VLJE 5HI5D 2L7JA 4CMHC 3Q2CA 1UFUA 3BIKA 1FO0A 1AD0A 1S5HB 3LKRA 4OZFH 4P2RD 2WWMD 1FN4B 1I7UA 4ZAKD 3STZA 4E9LA 1ZA6A 2AEPH 3TP4A 4KV5E 2BMKB 3B43A 5J56B 5DD6A 5EO1A 1RZIB 4N0UE 2ZSWB 5JHDE 4NZUL 4NQEA 3TYGH 4CL7A 1KTLB 4RA3A 1LP9A 1U3ZA 1CVSC 1AKJA 1FSKB 3L7EB 4R7DA 1RUAH 2N7AA 1NC2D 4HJGA 1CLZL 2NY1B 4CU8A 1CGSL 1VFMA 4PJ5B 1IC4H 3O3BB 1T1ZA 1YC8A 5IHZB 5C0AD 5KOVC 1QPXA 2AGJH 7FABH 4LPXA 3VH8B 3BKJH 3IS1X 1T20A 1CXHA 4UV7L 1MJUL 2YD5A 5IT2L 1FG2B 2R0LL 1SMAA 4M6NL 2AQ2A 3ROLB 1HH6B 5EU4A 1FQ9C 5JQHC 4HC1L 5HJ3A 2AK1L 2DOCA 1FGNL 2VN7A 2VL5B 3RVTD 3D39A 4YXKL 4N1HB 3UTTA 4L1DA 2P47B 2M2DA 3L3GA 3BZFB 1K4CB 4LFHG 4YDJB 1HYSD 1ADQL 2P5WB 3CH1A 1PSKH 3QXDA 2ZOLB 1BZ9B 1HWHB 4FQ1L 5IVXB 1JI2A 3PGCA 3HUJA 5D7IA 3DX8A 4D94A 3UTZA 3VE0B 4XH2B 1J0JA 5FYJH 1FL6B 1XF4A 2E7HA 4YWGH 1ND0A 4P4RA 4D9QE 3LVEA 4NN6B 1F6FB 1PVHA 1UJ3C 5ISZA 2C3VB 1FFNB 3O0RH 2R0WL 3O3DB 4MX7B 1J05B 3L5JA 3QEUB 4G6JL 2F54D 5FOBB 1QSEE 1KCRH 2H32B 4U6HA 3VRIB 1BVLA 4LARH 3ZSSA 3FB8B 3MLSL 3EOAA 1SM3L 1DVFA 1JF5A 2EZ0D 5IFAL 4LHUB 2N7BA 2HT2C 1VFOA 4TUOA 5E5RB 3MA7B 4JHAL 4HJ0D 1DSFL 4MXWL 4NDMA 1OAZL 4JGJA 5HYQB 1U91B 3X14A 2QSQA 3TBSB 4RX4D 4DKFH 4KROC 1RZJH 1NCCL 2ZJSH 2ZUVA 1TTGA 5CEXA 3OKEA 3KYOA 1RUKL 1J0ZA 3Q3GA 4OLZH 3U30B 3SGJC 4YHPA 2R4RL 1G7IB 5DUBA 4K9EH 1QLFB 3ZDZE 25C8L 2E6JA 2YN5A 3B4NA 5GGVL 1RZIA 5L9DH 5EH1A 2ZSWA 4Y2DC 4JFOB 2GSGB 4WI4A 3BYTA 2X09A 1LE9B 1RMFL 3RGVB 5I1KL 5BRZD 2NTSP 3E6FA 3LOWA 4P57B 3JTSB 4DCQA 1XMWA 4S0TD 4G6AD 2AK4B 2D3VA 4PJ5A 4QHMA 4GMTL 1EHLL 4MS8C 4YPGB 3VH8A 2F53B 5JZ7C 1ORQA 4PJ8A 4H8WC 4JKLA 3TPUA 2FX8L 1SYSB 3TVMC 4X6DF 4MDJB 4Q9CA 4G43B 1NCWH 4M8VA 2RHEA 1EFXB 2BX5A 5C0CE 4RGMC 2XPGA 3SO3B 1HINH 1TNNA 2VL5A 3KYMB 4P5KB 4C54A 1S9VB 5E9DE 3WFBL 2DYPD 4G6ML 3BT2H 1Q1JL 3CFKB 5F3HB 1K4CA 2P5ED 5ANMA 4IRJC 5AD0B 4O2EB 1QR4A 2B20A 2DQHL 3GJFH 1M71A 1M05A 1LNUA 4YHLH 4B5EA 4JFDD 1FL6A 3RNKB 1DQML 2E7LC 4HT1L 2BOBB 4LSQL 3DUUA 3EO0A 1QRNE 5DF0A 2FCBA 1FFNA 4IRZL 2CQVA 5TQ2H 4XC3L 3O3DA 1OOAA 3LEYL 1RVFH 2EDNA 5FOBA 3NMEA 3S37L 5E00B 4NGHH 2V6HA 1R3LA 4LVOC 5CUSL 5SWSE 4MCZA 3FB8A 5HHOE 1T04A 1P69B 4HJJH 3DSFL 3KAAA 2B0SH 3D18A 5IJVA 1SJHA 3LH2L 5ALCH 2WK2A 3S34L 2C3GA 2XRAH 3SQBA 1EO8L 4CNIA 5HYQA 3UZVB 4OD3L 4K23H 2GYSA 4NC1E 4V2BA 2VLRD 2UZIH 2YPLD 5IW6B 2CKBH 4G9DB 1UWEL 5E8PB 5BQ7A 4KMTL 1FLTX 4NN7C 4O58H 4WNQB 4JO1L 3RVUD 3WSQL 4OFPA 5EPMA 3QSKB 3QIBB 3KLDA 3BKCL 5JXEC 4IIQA 3QJFB 4RWHA 4HXAL 3DHMA 1CE1H 1KTRL 1N5AA 4URTB 3W11D 2AJVL 1Q9WA 3Q1SL 4MJIB 3B5HA 1IBGH 1HXYB 4HGWB 2ARWA 4AZ8A 1YEEL 1U3HC 1U41A 3BHBB 3AAZB 4MB4A 4YAQB 1S9YB 3FZUC 2GSGA 2OJEA 1J8HB 3VGHA 1OARL 4ZXBD 3BKYL 4KTEL 3JTSA 1IMHC 5HDLA 5F3BA 2R0ZL 5CWSB 2I9TA 4WFHD 2CJUL 5GGRY 5GZNC 1UM6L 5T33H 1N2RB 4K8RC 5D72H 4PB0L 3NA9L 4YPGA 2F53A 4DWHA 3KXFE 4DFIA 4XCFH 3U4BL 4WHDA 1S7UB 1ZSDA 3WKML 1G9EA 4FTVB 2FEEI 1MHHB 2IPTH 4U0RB 1EGJL 1P7QD 3VU2A 3WIIL 4FABL 2ESVE 3B9EA 3L3OA 2R2BB 1UYWL 1UM5H 5KSAD 4M03A 1OT1A 1EO5A 4OBSA 2VN4A 5IVZA 3KYMA 1J1XH 3PWNA 4N5UA 2LAAA 5CBEA 5DYOB 1ULVA 3IKCB 4PGCB 2NX5D 2HVKA 1RQ5A 4R3SB 4Z95L 3IU3B 3DNKA 1NCDH 4U6YB 4MNGE 1RK1A 2D4FA 4XGZB 3VCLA 3BX7C 5KBNC 1GHFH 3MLPA 4P5MA 4CJ1A 4V1DE 1F4WL 4C57C 4G6FD 4P2RE 1J5OH 3EOTH 2XZAH 1J7VR 1NFDA 4DUVA 2DLHA 5HYFA 4MAYB 2AS5M 5SWZB 4PRIE 1OP3K 2YPVL 2MFNA 3TT3L 3QUXD 5E00A 4HZAA 3GKZA 4OCSL 4Y1AD 4G8FB 3I75A 1VFAA 3B2VH 5DO2C 3DPBA 5FGSA 4KI5D 2DIBA 4PYGA 3ZE2F 3GSOB 4LL9A 3VG9C 5E6IB 5FV2A 4PTUB 4MA3A 4TTGA 5CJQL 3C6LC 1A6ZB 2I9LA 1HNGA 3BI9X 3C87A 3C8HA 1MIMH 5C0AE 1CZ8H 1AGEB 3VA2C 1LO4L 4G9DA 1URLA 1ZVHA 4WNQA 1XGUB 2CK0L 1G7MB 2IAMD 4OLXL 4NQXB 2MKWA 4DGYH 4CN4A 4UQ2A 5CBAB 3K4AA 5D1XD 3UO1H 4OCRH 4XBEH 2BNQB 3MV11 5DI8B 1HXYA 4PYHA 3I3BA 4KZDH 1MSPA 2PR4L 4Y8AA 4ODXB 3D3VB 1ZWIA 3OQ3B 1FZMA 3VFRB 3V6BR 2VDKH 1S9YA 2XXMB 1W72H 4OT1L 1EZVY 4L3ED 1X6NA 3AY4A 1KYOK 1CGVA 4ZOAA 3P4NA 4XB8A 5TGBA 1J8HA 1I9IH 5HDBF 1J87A 1DBJL 3MNZB 4M7JL 3TBYB 4IOFC 4EN3D 2ICWA 3UJJH 4BKLA 3NCEB 4TYUA 3QH3A 1GGBL 5I1CH 3F7YB 4JPVH 4U6VH 2G5BA 1FO0H 3NTCH 5E8EA 2PYEA 4AEIL 1QLRA 2Q76A 2VDMH 4M8QB 4OQ1A 1BJMA 1S7UA 5ESAA 3HZKA 3QWRA 5LBSH 5IHLB 4K2UH 1MCIA 5EBLB 5DHVB 1SVCP 3P0GB 2HH0H 1WBZA 2HLAB 5E1AB 5EOCL 2LTQC 2WWKO 5AAWA 4XTRD 3RL2B 1XZ0A 2X2YA 4NJ9L 3EIFA 1L6ZA 3RGHA 4X99A 2H2SD 4MD5B 5BV7H 3IKCA 3VXTB 3UC0H 5L2JB 3X12B 4MZ3A 3RKDC 3IU3A 3L95B 4AEHH 5KN5B 2VLJA