1ZGLB

Crystal structure of 3a6 tcr bound to mbp/hla-dr2a
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
189
structure length
175
Chain Sequence
GDTRPRFLQQDKYECHFFNGTERVRFLHRDIYNQEEDLRFDSDVGEYRAVTELGRPDAEYWNSQKDFLEDRRAAVDTYCRHNYGVGESFTVQRRVEPKVTVYPRTNLLVCSVNGFYPGSIEVRWFNSVVSTGLIQNGDWTFQTLVMLETVPRSGEVYTCQVEHPSVTSPLTVEWR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Immune system
molecule keywords HLA class II histocompatibility antigen, DR alpha chain
publication title Structure of a human autoimmune TCR bound to a myelin basic protein self-peptide and a multiple sclerosis-associated MHC class II molecule.
pubmed doi rcsb
source organism Homo sapiens
total genus 32
structure length 175
sequence length 189
chains with identical sequence E, H, K
ec nomenclature
pdb deposition date 2005-04-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00969 MHC_II_beta Class II histocompatibility antigen, beta domain
B PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1zglB02
3.10.320.10 Alpha Beta Roll Class II Histocompatibility Antigen, M Beta Chain; Chain B, domain 1 Class II Histocompatibility Antigen, M Beta Chain; Chain B, domain 1 1zglB01
3GO1H 3F8UB 1DQTA 2VITA 3Q6GL 3MLTB 1T7ZA 3DYPA 3HC3H 4NBYB 5HVWA 4NQDB 3RNKB 3AM8C 5F7FA 4PJHE 1CTOA 2BVOB 1ZS8A 5DJ8B 4D9QE 1I8MB 3JV0A 1YY9C 4HXBL 3LHPH 1EZVY 5HGDB 3LH2H 5I19H 1GYAA 1HXYB 3O3BA 1YYLL 2WWKO 3EJZC 1KG0A 1V3KA 4XNYH 1MAJA 1AI1L 4EQ3A 1AGDB 2FCBA 3MLPA 2QEJA 3X12A 2D7TH 3QBTB 4X6CB 2DI9A 4LVHB 2OTWA 4UDTB 2P5EE 1MJUL 5J8OA 1I85C 4YGVB 3T0EA 5BMFL 3RTQA 4Z7QE 3WXVL 4ODTL 4XVUD 4L3AA 5D7JD 4NQVA 2Z8VC 4GS7C 2IH1A 5FO7B 2FX9H 4CVXA 5CCKL 1QTYT 4JDVA 2P8LA 1PJ9A 4KU1A 1CIUA 1AP2A 2X4PA 5D9SB 3RWCA 3MV01 4U6VL 1BFOA 2HFEA 5MEPB 3HNTL 1A0QH 1N0XH 2O5ZH 3WFHA 5IF0B 4OI7A 2AKRA 1G7PA 4PV9A 3U4AA 2MOVA 3HPLA 4XCNA 3ZSTA 1Z6JT 4X6EB 3WXWH 1R3HB 3MUHL 3CDGB 2CLZA 1DQQA 2IAMC 4NHUA 1CD1A 4HAGA 3VWJA 1OLZA 2QJDA 5B4MC 1JF5A 5I2IB 4FTVA 1CXFA 2BCKB 4M61A 5IQ9B 5A2IH 4GRLA 4OCSL 2W38A 4HWBH 1GC1L 5D7LD 3QUXC 3VCLB 4WFFE 3HNVH 2BJMH 3ARDB 5IMKA 3MJ7B 2DKSA 2GSGA 3QIUD 2CDFB 4OF7A 4X9BA 3HZKB 5KSAC 3OKKB 4S1DD 4X4XB 2F53A 5IOPB 2VE6A 1U3HC 5BRZD 1O7VA 1QSEA 3IXTB 3NCJL 3IJSB 5FIEA 1G9MH 2BVEA 3EHBC 1W72A 3L6FB 2OM5A 1UC6A 5GRXG 1B0GB 4R96B 1VCAA 4RAVB 1NFIB 2R2EB 3HFMH 4H20H 4LU5H 3OKLB 3MV8A 4NZUL 4Y2DA 1B4JL 3BH8A 5GZNC 3C08L 3U2SB 1FQ9C 3FB5B 1D6EB 3IB4A 4ZPVA 2CRZA 3MLVL 4TNVF 1RZGB 3WNMA 4XC1L 2AV1A 3O2WH 4EZMA 1NJ9A 3KVQA 3HI1B 5DMJB 3A6BH 2SEBA 2N7AA 2WINB 1JPFB 3SY0B 3TN0D 3OXSB 3OR7A 5DYOA 2HVKB 1RSFA 2ZCLH 4X7FC 2EDJA 1JTPA 3UTTE 3MBXH 4CNIB 4JG1L 2A73B 3ZYZA 3QJHB 5C2BH 3ARWA 4GMTH 3ISWA 3L3JB 4YEFA 5L0QC 1UVQB 3HE7D 4NQEB 4WWKC 4P9HC 4W4OA 3Q5OA 4S11A 2E7BA 1GZQB 3MLXL 1LDPH 4O2CA 3WHXA 4K71C 5FGRA 3MROB 3NACL 1QHOA 4LNRA 1K5NB 4UU9B 5CIPA 4F7MA 5TE7L 3NPZB 5JMRA 4MNGA 3QFJB 1IAIH 1QKZH 1OSPL 2VXQH 4PJGB 1LE5B 1A14L 1DQDH 4FQ2L 3U7YL 3JBG7 3MZTA 3QFDB 1AQDB 1NDMA 4Y16C 5I1IL 3VMPA 1RMFH 2UZXB 1F2QA 1T3FA 4ONOA 4NKOB 4QRRB 3QUMA 4GKOA 1E6JH 2DI7A 3QIWB 4P23D 3RGVB 4JM2B 5I16A 2AEIT 4D94A 3BYTA 5GZOC 3O4LD 1KXQE 3QWOA 2PO6A 2VB5A 1CGUA 4MJ6A 5KTEL 2IBGA 3QG7H 3L95B 1PGRB 5JPMB 4OI8A 2XN9D 2OSLB 2VDPH 1HHGB 1V05A 2XQYG 2Y5TB 3T8XB 4CDGC 3P30L 3V4UH 5J56B 4OM1H 3OHXA 3U7WL 3BQUD 4J3UA 5GS0C 4YXLL 1BVLA 4RMWA 3NH7L 3MV7D 1D5MA 4PGJA 1ZT1A 4PPTA 4QOKA 3OJ2C 3IVKA 4RFEA 4G7YL 4ZFOA 1IM3B 1I1FB 2CMRH 4OLEA 3QQ3B 4KDWA 1BP3B 4G6KH 4HHAA 2J3SA 2AS5M 4KI5E 4WWID 4EVNA 4ELMA 1VACB 4ONHA 4GXUM 4QT5B 5BVPH 5GGQL 5HPMA 1EXUA 1X5GA 3FFCE 1X5ZA 1IAMA 5FHBH 4G80A 4LSUH 1QNZL 4N0CC 5AYUH 2WWMC 3LRHA 3V6FA 4ZNEA 5JW4M 4OLUL 5BZDB 3FFDA 4PJBB 2WQ8A 5T33L 3TGXA 3TJEL 5C0FB 2VQ1B 3ESVF 4XHJD 1B4RA 4NKDA 1VGEH 4E9LA 4PB9H 5TDPB 4HS6B 4WW1B 3V52L 1S9WA 3G08B 2HLAA 4X5XA 3NIDE 5F9JB 1TVDA 3LPFA 4P5TB 4Q6IB 2PXYC 4RGOL 5IFHH 2Q76B 4HV8B 2G9HB 4O5LL 4TNVK 2EDDA 4KI5C 4OD2A 1FG9C 3P77A 3AMKA 3PWPB 1ES0B 4LLYB 1NGQL 2HRPL 1YY9D 3HUJF 1RIUH 2JB6B 3KPLB 4MZ3A 5EU3B 3OG6B 2BRRH 4M03A 1ZHBA 4M6OH 1FFPA 5ENWB 1I8KB 3MQIA 3JTSB 4UQ3B 2F5AH 4I3SL 5DFWH 3MXWH 4L9LC 3EJZD 2BHZA 4WY7H 4TYUA 5DWUH 1BFVH 1LGVA 3CFEB 3MA9L 3L1OL 4D0CA 3SDDA 1RZKL 4LK4A 2J6EA 4UQ2A 4XMKL 2A74A 5KAQF 4LLQA 1H3VA 2VDNL 3REVA 4G9FA 1A2YB 1NFDF 4HPYL 5BS0B 4KY1H 4QEGA 5B22A 3G5YB 4WRLA 4BA8A 4FQLH 2CXKA 3IDJB 4D9QD 4LDLB 3PE9A 3DOSA 3P40A 3B3IA 4M1GL 1GH7A 3MR9A 5DI8A 5KJRH 1Q9OA 3ZE2E 3FCTA 5D1ZB 3ZKXB 3B8SA 3STLA 5MHSE 1JN6B 4ODUB 4LMQE 3T0XA 3H7LA 2PYFA 4IIQA 3SDXA 3HC0A 5EA0H 3O2DL 5I66B 3LKQA 5KVFH 5EU6B 4HKZA 3BMWA 1P2CB 4DOHE 1EAPA 2ZCKH 4M6AA 3H9SD 5ESVA 3DJ9A 5IEHB 4P2OC 4EBQH 3HUJE 2P5ED 4LLUA 2IAMD 4WFEE 1SVZA 3U1SL 4YPGB 5ESQA 2YRZA 3X3GH 5B4MD 5C07A 32C2B 3MGTB 3MFFA 4QRTA 4V1DB 5A2LH 4I2XB 2OR9H 3S96A 1E0OB 2EDRA 4Y4HC 4PJCF 5C1MB 4DTGH 2LABA 3HMXA 5KSAD 3QAZB 3RVWC 1U3HD 4CDHA 4P57B 2IANA 1PKOA 5L2JB 2EE6A 4OGXL 4U1KA 3EHBD 1NCWH 2GQHA 3HG1E 1N7MH 3C5ZB 1NFDE 2FLBT 1PEWA 3QXDA 1QBML 1G0XA 3DUSA 4AH2A 2NMSA 1MCQA 4TVSa 3BPOC 1FNLA 3KPPB 1J10A 3BOVA 5GZND 3UBXB 4KWUA 3AAZA 1A64A 4UUJB 4WI9A 3NFSH 3EYUL 3HZYA 1DLHB 1RAMA 1RZIA 4WFFD 4JLRB 1XGPA 2JB5H 2QQNL 4EN3C 2G60L 3GIZL 4Z77A 3TO4C 1H3WM 3SCMC 1D5XA 2YEZA 3S3PA 2X6MA 1QFUH 5ITBH 2YZ8A 4XGZB 1OPGH 1G7MB 5A40E 1HI6B 1KB5B 1RJCA 3HAEG 3TT3L 1IC7L 2OS7A 2AJXL 4B53A 1A9BA 2YD4A 3QCTH 4FQXC 5C6WH 3FT2A 1RJZB 5EBWB 4NGHH 1TITA 1MJ8L 4WWKD 1FLTX 4OZFG 2K7PA 1NL0H 3KPRB 3ARFB 2A9MH 3S37H 3L3IB 3KXFE 4S10A 3W2DH 2XT1B 5DHYB 2NTSP 2VDML 4PJCE 1UACH 3CZJA 1JPGB 2CRYA 2V5RA 3F6LA 4NN7C 2BX5A 3VD3A 1T7YA 1P6AB 2APWA 3EOBB 5T1MB 5KS9B 4IOIB 1Z2KA 2FL5A 3OZ9H 3R06B 1CF8H 1U91A 5C7XH 1AH1A 5IHBA 4Y8AA 1MH5A 1EGJL 4Y16D 1TIUA 4UT9H 5FYKE 4OGZA 3VGFA 1QR1B 5F89A 4GG6F 3DRQA 1DL7H 1E4WL 5DJXB 4OIAA 4LPTA 5C08E 5GZOD 2XXMB 5JQ6L 3LPWA 2Y07L 3QHZH 3M07A 4KKLC 5J13C 2GAZA 3O6FB 4D8PB 2ZUTA 1EHAA 3QB7C 4CL7A 3L9RA 5CJOH 2CLVB 3UTSE 5CLWA 5GPRA 5E4EC 5DSCB 5FM4A 3WNPA 1LD9A 5BJTB 2H26A 4DN3H 3LQAH 5AZEH 4NPYA 5HHMD 4AQ1B 1P7KA 3T2PA 1BBJB 1OB1A 3QPXH 1A6UL 1MFCH 1R3IH 2VLJE 4KRNA 1Q0XL 5GS0D 3BP6A 4U1LB 4N0FB 1OVZA 3VXQA 1H0DA 2NNAA 4ZFZA 3QDMB 1KJ3H 3KPNA 4HMEA 4N1HB 4TSAL 2FX8L 1ZHLB 1KELL 2H1PL 4R4FL 3ARUA 5SWQB 4LPCA 1AC6A 4LRNL 2DWDB 4RWHA 4TQEL 4JQXA 3ZMRA 4N0CD 2WWMD 1FZMB 5HXMA 4XCCH 4A6YA 5CAYB 3IDXL 1CT8B 3DBXA 1GIGH 3VWKC 3WDHA 4IRJC 1ZE3C 3BVNB 1C7TA 5E2TH 3MA7B 4PRIA 2NTFB 1ZHNB 5EBLB 2ZJSL 1YEGL 3C6LC 5TDNB 2EZ0C 2PXYD 1OAKH 4J1UB 4POYA 2YUVA 5IT2H 5CD3B 4X4MA 1EBPA 3HB3C 4KI5D 3BESR 3MTRA 1N64L 4MXVE 3MBEA 3FRPA 5ERWB 5J9PA 3NN8B 1R3KA 1F8TL 3DX6A 3AU1A 2YK1L 2GJJA 1J5OL 5DO2C 3FFCD 1IGFH 3U6RA 5INCB 3LV3A 1FZOB 1OARH 4XNUH 3I6GA 4NOFA 5HHVL 4UDUB 4TVPH 4WCYH 1T20B 5J12C 1EMTL 1WQVT 5EWIL 1PSKL 5GRWA 1CQKA 3QWQB 1OP5H 1U92A 4BK5A 1RK1A 3TYGL 4KVNH 4QXTB 5D6DC 4R0LC 4RIRA 3I3DA 4XP9L 4C56B 5KOVC 5F7EH 3WFBL 2XZCL 4LLVB 4P4KA 1AC0A 4NRYB 2ZKHH 1LO5A 4Q97A 3F58L 5EOTA 4HJJL 4MJIE 4G43A 1S9VB 2VLRD 4FQHA 4DQOH 1Q9KB 1AGFA 4JDTH 4X6CF 2AK4B 5F3BA 1AO7B 3AS0A 3O45B 5L9DL 2KKQA 4L4VE 2VLLB 1IGTA 4LCUB 5JA9A 1J05B 2X70B 1DBKL 2EEDA 1J1XL 4Y4FB 5SWSA 3O9WC 1KNOA 1U8PB 3HNSH 2X44D 3ARBB 1FGVL 3QDHA 3RWJB 5CJ8A 2EDBA 2DF3A 2EDEA 4P2OD 1MHCA 3P0VH 2E7LC 4NWTH 4YBQC 2O93L 2P7TA 2W65A 4WDIA 2ICWI 2Z35A 3WEXA 2O61B 1OT2A 5EC2A 4CMHB 5SWZE 2I07B 2XWBB 3MRMA 5JDSB 5KG9B 4G6JH 4XNYL 4Y4HD 4FZEH 4P2RE 4MMXC 1RUKH 2FNBA 2PW1A 2RJMA 1MLBA 1GHFH 4R26H 3RVWD 1UEYA 4MJ2A 2ORBL 4FMKA 4UIMB 5B21A 2QSCH 1H3PH 4QRPE 4JPKH 5ISZD 4J3SA 1CL7L 2APTA 4FQ1H 1RUPH 5IBTL 2DQUH 2CUHA 1INQB 4TULH 2W9EH 1GCFA 5E08L 2WSKA 5I8KL 3LKSB 3HHRB 1NGYB 5GGTL 2IPKA 2R4SH 2J1KA 4HUWB 3IF1B 3G04A 5F1SA 1S9XB 3SQBA 2EDOA 4HUMB 1FVCB 1L6XA 3QDGD 4JRYB 4KKBC 3VI4F 1ZT7B 4WFED 2P5WB 2WBJA 3KPSE 2A6KA 4HK0A 3GHEL 5EORH 1AFVL 3D18B 4XPHH 5HHQA 4WVRA 5C09B 3WUWG 1PZ5B 4ZXBC 4N9GB 1N0XL 2O5ZL 5ANMA 4EN3D 3EZJB 1FNGA 3T65A 4FNLL 2W60B 3DIFA 3TO4D 3SCMD 4Y19A 2WNGA 4M62H 4AL8H 3V4PL 2AEWA 2FJHB 2F15A 1JZ7A 2PETA 5DQ9B 3A67L 2X5PA 2ADJB 5IQ7H 3HG1D 4FQXD 1P84J 3D3VB 3ZE1E 3MSPA 2UWEA 2ID5A 4JGUA 3UO1H 5ACLA 5AWNL 4JAMA 3KWWA 4MD0B 3D69A 3MLUH 1XCQB 3VGHA 2V2TB 3SDYL 4ZNCD 2FD6L 1SYVB 4LHUB 4M1CC 4FQJH 1L7IH 5JOFA 2A83A 4X7SL 3TM6A 4R4NC 3MNZA 3RI5F 1QBAA 2ZUXA 2GTWB 1A9EB 4LVNC 4M6ML 4XWGH 3SE8H 4OKVA 3LIZH 1EO8L 3TA3C 1CXIA 1J1PH 1UB5A 3OX8B 3ZDYF 1EJOL 3U83A 3QH3B 3VI4E 4XNMA 1IEHA 2NY4B 1ITCA 4L4TA 2D31A 2BOCA 4AIZB 1VB9A 4KKLD 2R23B 3QEQD 4PJGF 5CMAA 3D6GA 4RQQA 3AXLA 4GKNA 3KXFD 4M8QB 1KN2H 2Y06H 2DAVA 3V8CA 4NO0A 4UNTA 4WI8A 2JJTA 4H88H 4LBEB 4CN6A 2GJZA 3QO1A 4EI5A 2KZWA 3FO2B 4JM2F 4QRSA 5E94B 4CBPA 4PJAB 3MRRB 3QA3B 4LPYA 1QUNA 5DUML 1CWVA 1I8IA 4CW1B 1I7RA 1N59A 1UWGL 3L3HA 4ONGL 5I1HH 2EYRA 4F80A 4AG4H 1LDPL 1U8LB 3C60A 1RZFH 5C08D 5I74B 1JPTL 2K7QA 1H8SA 1U9KA 2E9JA 1CICC 4RGNB 1NLBH 2YBRB 4G6ML 1DBBL 4NQEE 4PLKC 1DQDL 1JWUA 1IJ9A 1NBVH 5HI4C 4LGPB 3ILPB 3WS3B 3MV9B 3VWKD 1MWAL 2XOTA 3GI9H 4FXGB 1ZWIB 4IRJD 5HDBE 5GGSY 1ZLSL 4XCFH 1KTDB 4ODXA 3ZDYE 3C2AL 2Y36H 3VFMB 4G8GE 3TO2A 5KSBA 4DGVL 1CGSH 1YMMA 5DEFA 2R2BA 3V2AR 3H9HA 4J8RA 3C6LD 3E3QE 2EZ0D 1CLOL 2ZG3A 5HBBA 4PJBF 1RURL 3HB3D 4TRPH 3OGCB 4H0IA 4PJIA 5E56A 5E8EA 3T08A 4HXAH 2YKLH 5C0NC 1SJVA 3OF6D 1CFSA 2R15A 4LSDA 4C55A 4F8TA 3MRLA 4OF5A 5J06A 2V2XB 5DO2D 1TQBB 3EYVB 4Z8FH 3G5XB 4HC1H 4HIHA 1TJGL 4K07A 1A3QA 3OB8A 2ZSWB 4O2FA 4ETQA 4GBXA 2EYTA 2VH5H 4G8EB 4APQB 1UA6L 4Z7WB 4I4WA 2ADFL 4X5LA 4ZOCA 3MLRL 5DZNA 3HE6B 3ZDXF 5T5NG 4YHMH 4PJ5B 3GK8H 5C0BB 2AGJL 1F3JB 3P0YH 4ZOAA 1J8HA 3N1QC 3U79A 5FO9B 1P9MC 4P59H 3E3QC 5IR1A 4LCYA 1VA9A 2F54D 4RAUB 1A6WH 3DROA 5T1KA 5BVJB 4JQIH 4U1MA 1BFTA 1MY5A 2IPUG 1QO3B 1H3GA 2C26A 4Z78B 4BSJA 4EUPB 5K9KB 4YHLH 4HBCL 2Q86A 3RI5K 4GG6A 3IDMA 3L3GA 5H94B 1CD8A 3M1BA 5JNYB 1S7SA 4L29B 1F58H 4PTTB 1HHKB 1JUFB 4HBQA 1WITA 2VZ1A 4XP4H 1OTTC 3O9WD 4LQFH 3KYAA 2BHUA 2YMXL 4CU6A 2CR3A 2H6PA 3F6IA 1P84K 2J5LB 2FGWL 3QEGL 4YBQD 5EZJA 4NZJA 3SKOA 2YXMA 3WN5A 2DD8H 5EO9B 5C0IB 1V7MH 3ZDXE 2B2XL 3EO9L 3CZFB 5FGCB 1FYHB 1SY6H 3MXWL 3PV7A 2NR6C 5E6IB 1A6TA 2A6JB 2ESVB 5FYLE 2MSPA 1I3RA 3G9AB 4WY7L 2JIXD 5DWUL 3ROLB 4F7PA 5L2KA 2FEEL 4NDMB 2X4OA 1NMBL 1J87A 3VRLE 3MYJA 3CX5J 4ZFGH 4Z0XB 5TPWL 1YJDL 3U46A 4L4VD 1HEZA 1BQHB 1G7HB 1MI5B 5DMIH 3LN5A 2VDRH 2ZOKA 12E8L 4D3CL 4KY1L 1M7DB 3UYRH 1XGQB 1EHLH 3IJHA 3MODL 5E99H 4KKBD 1Z5LA 5C3LD 2BNQA 1G7LB 4I18A 1W0WB 2ICWA 4TTGA 4BQ6A 4P5TC 5F70A 4PY8J 3BGMB 4C58B 1F11B 5SWZD 5BS0E 4ZXBD 4M5ZH 4ZDHA 4P2RD 4ZAKB 5C0AA 2BMKA 1OF2A 3KJ6H 1KT2B 3PWNB 1G6RL 4Q0XL 5EUOB 1DQML 4PLOB 4QRPD 3MRJA 3ZKQD 1CR9L 1XIWC 4QOKE 3GSQB 5TE4H 2VDOH 2OL3L 4XXCA 3RVVC 3GKWL 5IG7A 1ZOXA 3V6OA 1M7XA 1IM9A 1BPVA 3BN3B 4E42B 3P4OB 5EU6E 2FX7H 3BKCH 4OLWL 3PGCB 2AJUL 2IPTL 3VXMA 3MLTA 2AV7A 2ZCHL 1N6UA 1CXLA 4M1CD 3MUJA 3KPSD 1YNLH 2BSRB 2FBJH 5DJ8A 4LSVH 4R4ND 4JDZA 3N9GL 2DL2A 1LO4L 4PJEA 4V1DE 3HAEH 2VL5B 3KJ4C 5HGDA 5ICXB 4I2XE 3T04D 3DV6A 3S4SA 3TA3D 4OZFH 4YAQA 1PY4A 5TFSH 4PJ9C 2B1AL 4LKXB 3HRZA 4KKNA 4K94L 3PNWB 4P5MA 3MUZ1 3V5KB 5KS9F 3FB6B 1U8IB 5DJ2A 4FFVC 5B8CA 1KJ2L 4G9DA 3VXRB 4KJQD 4M8VA 4K3DH 3WFEH 1AHWC 1YDPB 3WLBA 3CLFL 1CVRA 4M9OA 3CFCH 1DR9A 4Y5VA 1YYMH 1U3YA 5C9KA 1E27A 4LARL 2NXZB 1IQDB 1JNLL 3GMRA 5HGHA 3N0PB 1A3LL 4G3YL 3OMZA 5MEPA 1L4IA 3UPAA 5IF0A 2OBGA 3PJSB 4Y5YB 5HDQH 1KLUB 5IK3B 1CICD 4S1SL 2OP4H 4ORGB 3INUL 1R3HA 5CP7A 3CDGA 3VJ6A 3RAJL 3UBXI 4PLKD 5C7XL 1JWSA 1GGIL 5HI4D 5I2IA 2ZUSA 2BCKA 4YFEA 1FNEB 3STBA 4QHKI 3VCLA 4AENA 1F5WA 3ARDA 1WGOA 2P4AB 3QULA 4HWZB 5CKGA 1MCEA 5KS9E 2IALB 3HZKA 3OKKA 1F4YL 3MYZA 2I26N 1C5DB 2GT9A 1T22A 4A2MA 2CK0L 1KC5H 2CKBA 3BH9B 5DXWA 1IKNA 1FFQA 1ULVA 4BH8B 4QTIL 3L6FA 2BRQA 1CFNA 4PLJC 2D0GA 1DQJA 1TZGH 5C0ND 1B0GA 4Z5RB 3CXHK 4M6NL 4K3GA 1CK0H 5DEZA 4NN5B 2H8PB 3FZUC 1ADQL 1IFHL 3BAEL 1Y18B 1SMAA 2BXYA 3SJVB 3FB5A 1D6EA 4Z7UF 1R3IL 1RZGA 3N1PC 1TZIA 2A1WH 3TFKC 1DBJL 4X9IA 4NQED 4JFPA 2AEPL 5ADPH 1IAKB 2LAAA 3Q6FB 3HZMB 3CX5K 3SY0A 1UWEH 3LKNA 1Q0YL 3RBSA 3OXSA 2HVKA 3TESA 4G8GD 3C8KA 5IB5B 3SPVB 1RVFL 5ICYB 4KKAC 4CVUA 4CNIA 3FRPG 2YRLA 4Y5XB 3QJHA 2NY7H 3CVHH 4NSKB 4OLXL 3OAYH 3L3JA 1YUHB 3GSOB 2J4WL 5FHAH 3IU4H 4DK3A 1GZQA 5JOPD 2HJKA 3JTTB 4P9HL 3GSNH 5HJ3A 2W0PA 4R8WL 4XB7A 5CJBA 1PVHA 4F58L 5IVXA 1FO0H 3C09C 1F00I 2AK1L 4L8SB 1MF2H 3QFJA 1LO3L 1OAKL 4N90D 1OTTD 4I1NB 5EU4B 2W0KA 1QSED 4PJGA 2L4OA 1OAYH 5IB2A 2I9LA 2IQAA 4ZPTA 3CC5B 3QFDA 4UOW0 1J86A 1AGEB 1WZLA 4JO1L 4LCIL 1OAXH 4QRRA 5JW5B 4Z7UE 1LK2B 1CYGA 4JM2A 3MV8D 4LGRB 1A7PH 4GRMB 5IROC 4TVPL 5T3XE 1KXTB 2NR6D 3L95A 3TVMB 4PGCB 3GMOA 2E8ZA 5DQJB 4E41B 1OT1A 3QQNA 2OSLA 3QUKA 1FYTB 2Y5TA 3T8XA 2Y9RT 2FZ3B 3ZDZF 4Y4KB 2QHRL 4WHTB 3QJFB 3QNYB 4HX1B 1DSFH 3LRGA 5F88A 1T1WB 1HH9B 1IM3A 3QQ3A 4ALAL 4U6YA 3PWJB 4MA7L 1NCAH 1KYOK 3ZKND 4CVWA 1VACA 3G5VB 2VAJA 3GMMB 5DJDB 3QZWB 5C6TL 4P5TD 2NZ9C 4U3XA 5E9DE 5KANI 4MNHB 3W9DB 2YPLB 1BVKB 5H8DA 2DQJL 3JV4B 5JHDA 1WT5A 3MRHA 4I8DA 1CFVL 5HI3C 4HDIB 3B9DA 4PJBA 5BZDA 1G7QA 2XPGA 1DDHA 5D1QA 5EO0B 3S36H 5D71H 2AK4E 2VQ1A 1XIWD 3V7AG 5E70A 2RAMA 3Q1SL 5D93B 5TDPA 5FYJH 3I2CL 25C8L 2GCYA 4HS6A 3RVVD 4QHNA 4TOYH 1GGCL 4JY4B 1VDGA 2R0LL 4PB0L 4Q6IA 2Q3AA 1ZSDA 3MOAH 3MMEA 2NZIA 5HTSA 3VD7A 3BUYB 3PWPA 4JFXA 1XGUB 1GOHA 1ES0A 1H3PL 4LLYA 3ZDZE 1NCTA 2C5DC 3RU8H 1A1MB 2LU7A 4JO4H 4MCYB 5EU3A 2JKXA 1HQRA 4KZDH 1KCRL 3JTSA 3K1KC 4UQ3A 3PWLA 1LP9B 2J7LA 1NCBH 2R69L 5ESAB 3VRIB 4PJ9D 4QOKD 3GSXB 3LKOA 1CCZA 2BNRB 4X4ME 3RPIB 2EIZA 5GGVL 4FFVD 4F7TA 5DEGA 1CDYA 2X4NB 4Y4FC 5KBNC 1DVFB 5A2KH 3AY4A 1ZHKA 3KYOB 4O2EB 5GJSH 4ETYA 1I1YA 5K33A 3G5YA 5SX5K 3PP4H 4NFCA 1P5UA 2WAHA 4M62L 2ADGB 2P5WE 5B3NA 3NMEA 1T5XA 5KAQG 4YHYC 3W9EB 4GAGL 5D1ZA 2M2DA 1A5FH 1S7RA 2RCSH 4V1DD 3NCEB 4G8IB 4NO5A 1IGYB 1I7UB 4NUJB 4JCMA 2R1YB 3PL6B 4XPFH 1FNSH 3MBEC 5DURB 5IEHA 2KBGA 4UILH 3X13A 1KACB 1T2XA 3MRBB 2YZ1A 3NZ8B 4YPGA 2EECA 2MKWA 3HKFA 3V4VH 3ZL4H 2DM7A 5FAAA 3PUCA 3DTXB 2HN7B 3L5IA 32C2A 3IDUA 2Z93B 5GRUH 2LTQB 3R8QA 4HSQA 1FAIH 4PYHA 3EZ8A 4LSTH 1RZJH 5DJAA 1KEMH 1NC2A 2GITA 4HFUL 2Q8AL 4R4BB 3K1DA 3BPLC 1OW0A 3N50A 5EIVA 2Z0BA 1IEAA 1CE1L 5LG1A 3BIAX 4ZG1A 1JZ2A 3SKUD 2ZSVB 4BZ1H 1PG7L 3QUYB 1LE9B 5ADOH 3C5ZA 4MSWB 4PLJD 3D87B 1R24B 5ICZA 4KTYA 4B0MM 2K1MA 3FZUD 4QKXB 3ALPA 1MCPL 1XMWA 4XPBL 5FM5M 4PJFA 4JJ5A 4WO4B 3TFKD 4HPOH 3MLWL 3KYKH 4MXWL 1T0MB 4UUJA 3VFUB 2HYMA 3LS5L 3D39A 2Q6WB 1HHJA 4JLRA 3TIDA 3DYOA 4X6DA 4UT7H 3MCG1 1W8OA 4DGYH 4RWYH 3P11H 4KH2A 4KKAD 4CN1A 5I6XB 3I3EA 4XGZA 3RZWA 1HI6A 5ABDE 1T1ZA 3TF7C 1HOCA 5BXFA 1IE5A 4Z7WF 5INDB 1CFBA 5EBWA 3QEHB 3EYFA 1NAMH 4KQ3H 3QT2A 3ARFA 4S0SD 4QRUB 1WBZA 3L3IA 5D70L 5E24E 5C07D 3A6CH 2H45A 3CPLB 3GGWB 4F9PA 3MJ9H 4UT6H 2W9LA 3MLYL 4GRWB 4JPIA 2EO9A 5JPNB 3KLAB 2DOCA 4XNXH 3EOBA 5T1MA 4H26B 1PKQB 4IOIA 1MHHA 3GFUA 4Y19E 3THMH 4YQXH 3J8F7 1MCFA 4LCCA 4ERSH 2FDBP 2VERN 1EEQA 3MV9E 4TRPL 5I1JL 3Q3GA 2J12B 1X44A 1A1NA 5GRYA 1FDLH 2GK0A 4KJPC 4WHCA 3K8LA 1HILB 3NZHL 3IGAB 5I18L 3BKJL 3GJFH 1UQSB 2WBJC 3HLAB 3O6FA 3G5ZB 5JO5A 4NQSA 2WUCH 2NY1C 5IW1A 1BQLH 3H3PL 1KBGH 3KHOA 5L7XH 3M17B 2QQLH 2CUIA 5BJTA 3QO0B 1WICA 4FZ8L 5I30L 5D7SH 1BBJA 1ZT4B 1CLZL 4M7LL 2GSIB 5I17A 3IDGA 1S7VA 5ID0B 5J11B 5F3HA 5HHPA 4NOBA 4HT1H 3WJJA 5DZOA 1A6WL 5M7QA 2DQIH 5J6GA 1BAFL 3T2NL 4GOSA 1P4LA 4KRPB 4JB9L 4PJ5E 3TBTB 3QDMA 1P1ZB 1YC7A 1ACYH 2H32B 3WHE0 3VXUA 2NZ9D 1F58L 4KK8C 4JG0L 1DBAH 3Q5TA 5T3XD 3H42L 3ARZA 4N8CH 3OWEA 4X4YB 5HI3D 1IL1B 3HMWL 1Q1JH 5MI0C 3AS3A 5LWYL 4KUCD 4KC3B 4K3JH 3BVNA 2DKMA 4JPWH 5D6CA 3TIEB 1L7TL 1LMKA 4OLYL 5F7NC 2ADIB 5L6YL 1ZHNA 4M7JL 1RK0B 2O5XL 4IHOA 5TDNA 5F9OL 4J1UA 1JHKH 1IC4H 1F02I 3LS4L 5IKCB 5CD3A 2OZ4L 1JGUH 1I9EA 3UP1A 1OWWA 1VEMA 3JWDC 2I9TB 5EUOF 4Q9QL 4PRNA 3MZGB 2FSEA 1YN7A 5F1NB 4NYLA 2Y23A 4P2QE 5E9DD 2ZUQC 1A21A 1D5IH 4U7KA 2NY3C 1OGAB 2ZUYA 2YUWA 5INCA 3BDYH 5FGCE 4GQ9H 3LRSA 4J4PC 1SBSH 3D2UA 4MAUL 4AK1A 3BGFC 5AD0B 1UH2A 3KS0J 3VGAB 1I8LA 3GRWL 4HLJA 4JY6B 5SV4A 4BQ8A 5I1CL 1WZ1L 3DLQR 1IC5L 4F7CB 2HJLA 1MI5E 1YPZF 1QLEL 1S7XB 4Y4FD 4M02A 4Z7VB 4C56A 5GSRB 2D0FA 4LLVA 4DKFH 2QKIA 5I9QB 4TUJB 3LAFA 4UZGA 5DJ0A 3V6ZB 1R0AL 4DFIA 4C54A 4L4JA 2ICWJ 3IRZA 5MP6H 5FA3B 2Z31B 4U6HB 3TNNA 1S9VA 5F1IB 3GBML 4XBGB 2XZAH 5TE4L 5IIEA 4DCQB 2P48B 2YPVH 1AO7A 2IFFH 2NW2A 2VLLA 2J2ZA 4LCUA 4IJ3B 3LEVH 1MJJB 1U58A 2MQ0A 5EUOE 3C9NB 1URLA 4K3EH 1UB6B 4HUNB 3ARBA 3LQMA 3GSUA 4PRHB 3QWRD 1Y0LB 3MBED 1QD0A 4WI2A 1MCRA 2A38A 1WISA 4EJ1C 4MAYB 5H2BB 4AEHH 4JKWA 2CDEB 4PD4J 4HJGB 3WSQH 2B0SH 2I07A 1VADB 4GBXC 5JDSA 4P46B 1ZGLP 3IKKA 3W39B 2FO4B 2H9GB 3EOYG 4PYGA 3LDBC 1MFDL 1YPZE 1ITBB 5KVGL 2UUDH 3HRPA 3TBWB 1IAIM 2A0LD 1SEQH 5E8PA 4JANB 4X5WA 2IG2L 4HUWA 4QNPF 3IF1A 1QA9A 4OCYL 1N2RA 2VXTL 3ARGB 2QADB 3BUTA 1VFOA 2DDQL 3Q5YA 4JRYA 1LO0H 3J7HA 1HE7A 1BOYA 1HIMH 4HGWA 2Z9TA 2O5YH 5JW4Q 5C0DA 4X99B 4KTEL 3CLEH 3K4DA 5C09A 1T2QH 5KVDH 3MRPB 5IVOA 2W60A 4XNZB 5GS2H 2PN5A 5J4MA 4U1JB 5SWSD 2X10A 1K6QH 2M8XA 3IETA 1VSCA 1U8NB 5I8EA 3D3VA 1GGBH 4I3GA 3WN5C 3MJGX 2FH8A 1ZGLB 1GPOH 5J1AB 2ERJC 3BWUC 2PW2B 5GSVB 5LGHH 4J6RH 4HWBA 4WV1C 3WIFB 3O81A 1QYGL 4WU5B 1IGJB 2R8SH 3VG9C 2YD5A 1CN4A 3FAXA 3U4BH 1T2JA 3OJMB 4HKJA 3U7AA 1MRCL 3RDTA 1J9CT 1XR8B 4QNPE 4HW6A 1RD6A 3RWIB 2CJUH 3V6OE 1AGCA 4KJPD 3CJJA 3D85D 4FFZH 2YN3A 3UJTL 1INEH 4AIZA 4I18C 2WBJD 4WW2C 4X9FA 5H35A 3I02A 2NY1D 4MDJB 2MCPL 5JA8B 4M8QA 5D7IB 3SJVE 1D7FA 3O3UN 4HUVB 2G75A 1AKJB 3FO2A 5BOZG 1WC7B 3IDIA 3QCUH 5E94A 4PJAA 4Y19D 3FOLB 5D1XB 3OL2A 1MJ7H 3CVHL 4M43L 1G7JA 4QYOA 3JUZA 4CW1A 4RMUA 4L3CA 3V6OC 3DXAE 2IJ0C 3AREB 2AJVL 2YXFA 4PJ7A 4ENEC 4LIQH 1NMAH 1FSKC 4HGKC 1KPVB 3PWUB 1CG9A 2YBRA 2V2WA 1IKFL 2QHLA 2EDKA 1ZANL 3PDOB 4HCRH 5HHXH 3DNKA 3ILPA 3WS3A 5IM7B 5EB9A 1ZWIA 3OAUL 5F7DB 2WUBL 3BSZL 1A6AB 1V8HA 1YMHA 2GYSA 1UEMA 2XV6B 4L8BA 1VFUA 2Z8RA 4ONFL 5HD8C 1DQLL 2YS4A 1SJHB 5HDOA 4RISL 3K2MC 1JGEB 15C8H 4JFFA 5E00B 4PJ5D 4JM4L 5I71B 4I3RL 4F7EA 2K3TA 3AB0C 2YA2A 4URTB 4Q6YA 4WENB 1S7WA 3BP7B 1CXEA 4ZFFB 1GZPA 1PZUB 4PD4K 4NO0D 2NY3D 4OTXH 1B2WH 4HLZG 5F7UA 5IMLB 4LL9A 3CFBB 3T4AB 3GBNH 5KVMC 3G5XA 1S9YB 3I84A 3LMJL 2APVA 3GUTB 4J4PD 2ZSWA 3OB0H 4ZTOH 5CSZA 4PJXA 4Z7WA 1V7NH 1NCUA 4NT6B 3B9KC 5JLZB 1RULH 4E41E 1E4KA 2WIIA 1TQCB 4XMLL 1AIFA 1JRHL 1NCAL 2LQRA 5C0BA 3E1F1 1YQ2A 2DJ4A 4WEUD 4JRXB 5FO9A 4CMMB 3UYOD 3O3AB 2RBLA 4O58L 1R5WB 4YDIL 3IXAB 4GLRI 1CGXA 4RAUA 5HHOE 3VFVB 5BVJA 4KMLB 1CDUA 2IMNA 2ZP0T 3F65A 3VG0L 4LEXL 4P2QD 3VW3H 4EUPA 5K9KA 5DRZA 3UTPE 4L3EA 1ERNA 2JELH 3SGEI 3MFGB 5FYJL 3PV6B 2YPLE 3MX0A 3B2UC 5D7JB 1QHPA 3QI9A 4PTTA 1HHKA 2CIKB 4EDXA 2NY5C 1YMMD 1T21B 5IB4B 4HULB 2B4CH 1QLFA 4MHHI 1B6DA 3T3MF 2ZUUA 2FO1A 3L3KA 5SX4I 3ARXA 4OFYA 2AABL 1W72L 1T6WA 5FCSH 4JO4L 4BYHA 5EO9A 3BPCA 5E5MB 5C0IA 5CWSA 3UJJH 3CZFA 4X0KB 3RHWF 3T4YB 4GBXD 3VH8A 5E6IA 2ESVA 5E8OB 1NCBL 1DLFL 1MWAB 4NDMA 4NJ9L 3NABL 4OFPA 5F1OB 4ZYKB 5D7LB 2JLLA 4Z0XA 4XAKD 5F6IC 3HZVB 3DV4A 1G7HA 2BC4B 5DS8B 3QIUB 1I7TB 3OKYA 5GJSL 4M48L 5BRZB 3P4NB 5AEAA 1M7DA 1BJMA 1XGQA 2D2OA 1AY1H 2BNRE 1E28A 3CGTA 1Q72H 1KEGH 1IAOB 1QPPA 4H8WC 5E2WL 1YY8B 3GMPB 3BPNC 5IJKA 3MRQA 1UJ3C 4ZD3L 4DN4H 3V5DA 3BGMA 2JJSC 2V17L 3DVGB 4NO2B 1U42A 4FXKB 4ZAKA 1JMXA 3GNMH 5I76B 5T5FL 2MMXA 3IAGC 2ATKB 1KT2A 3PWNA 3VFSB 1KLGB 3TN0B 2XI9A 2CGRH 3IFOB 1YNKL 2EKSB 4XPFL 3MRDB 2DYPD 2DQCL 2XA8L 4HIIB 5EPMA 3IDYB 4LLAA 1OGTB 1FZKB 5DJZA 3UBXG 2Z92B 5FYKH 3QUML 5GRUL 3P4OA 4YFLF 5F71A 3PGCA 5GS1B 1K2DB 4QXWA 2HG5A 3OKMB 4K8RH 2D7NA 3HE7B 1YEIH 5DLML 5JHLH 5GGUB 4JKLA 2IGFH 5EZOL 1ZEAH 5AG8A 2HFFA 1MEXL 2DQFA 3U0PB 5DHVB 2VDKH 1IGML 1MIEL 1UYWH 4GRWF 1BREA 3FO1A 4OF8A 4JPVH 1MIML 1SM3H 2AJSH 3S5LB 2HKFL 1A7NH 4WU7B 4ZFOL 1EV2E 2RFXB 3T77B 1A7RL 5IMMA 5CUSL 1J1OL 3VXRA 1HHHB 4P23B 3BHBA 4PGZA 3LD8B 2P8MA 5JIPA 4PJ8A 3O4LB 5DRWA 1RIVH 5GRJL 3O6LL 2KDGA 3DX7B 1YDPA 1WT5C 2V6HA 5C0AD 4DGYL 4NQXB 5AG9A 2FATH 4GG8A 1J0JA 4I0PA 1LO2L 2XN9B 2OR7A 4JZOA 5ALCL 1OP3K 1IQDA 1KFAH 5MEOB 3BQUB 3I75B 3SO3B 4N1CA 1WIOA 2WBWB 3GM8A 3JVGC 4Y5YA 1BVZA 4FA8A 1LEGA 3CSGA 5E5UB 5IK3A 1DE4A 1NAMB 4ENED 4HFWB 4OCXH 1AQKH 4H1LB 4TSBL 3VXMD 4ORGA 4XAWH 5D2NA 1YEEH 3MJ8B 5DK2A 3MPCA 4O02H 3TYFA 2X1PA 2EYSB 1NGPH 4FS0A 1XF2A 3ZT5A 1FIGL 4GSDH 3QQ9C 3S34L 2BFVH 4OLVH 1FNEA 1FGNH 1QFWL 4GRWE 1FDLL 2X4TB 1VPOL 3HI6H 4KK9C 1TDQA 5HD8D 1G6RB 1P4IL 4O51B 4YFLI 1PKQE 3OJVC 5IB3B 2IALA 5CP3A 2PTTA 4FABH 1U8HA 4H0HB 1C5DA 2BVQB 1NAKL 2HVJB 2OL3B 2R29H 4MQ7B 3T1FB 4E0RB 3FB8B 2XQBH 4WUUB 3V0WL 2CK2A 5IMOB 4P3CH 5CKAA 2FR4B 1XF5B 1D5ZB 1NBZB 3DXAD 4OFDA 1MCOL 5IV2B 4M1DL 3AY4C 4U7SA 3PABB 2J6EL 2V9QA 5GISL 2C7UB 1D6VL 1RZKC 3WYRA 3I9GL 3QDJA 3OQ3B 1CU4L 1BOGB 5E8NA 4CADA 4HS8H 2A6IA 5ALBH 1RUQH 2KZ1B 2OLDA 3QHFH 4HT1L 2EDYA 5C0RL 2E9WA 2Z91A 1K4DA 2DQIL 1CFQA 3B9KD 3O2VH 1OY3B 4LLMA 1WFNA 3BKMH 4XP5H 3V0AC 3QXAA 2NXYB 5DD0L 3TPKA 3UTQB 4L8DB 1JGVH 4MX7A 4DWHA 1MFEH 2NX5A 3FN0L 3RWFB 3Q48A 5ICYA 3BO8B 4C59B 4Y5XA 1W0YT 3HC4H 1NBYB 4PJFE 43C9A 5CEXB 2WW8A 3S88L 4FFYL 2F58L 2CIIB 4RRPA 2HLFC 5T1LD 3W0WE 5BV7H 4K9EL 3JTTA 4KPHH 4OT1L 1X5XA 2AJYL 2YPKB 1XF3A 2VABA 1M05A 1R3JA 3B2UD 5DMGC 4XH2B 1WAAE 1C16A 4Z7VF 3SGKC 3FO0H 4GS7B 1YEJH 4L8SA 4OD3H 4PJHB 4NUGL 4Y8DC 5EU4A 2QSQA 3HMXL 1C5BL 3TBYB 4HEPG 3CC5A 3UJIL 2BSTA 3BP5B 1GXEA 1JPSH 4Z0BH 2R1WB 3N85L 4KMTH 1EH9A 4CVZA 1MCKA 2VXUH 4K2UL 4KDTA 1LK2A 5HHOD 3LEYH 3BDYL 4KRPC 1NCCL 3H9SB 4GRMA 4JZJA 3F12B 3QXWA 2NLJA 3VXTB 2P5EB 3FQNA 4KV5F 3TVMA 5IESH 3TWCL 3UTPD 5DQJA 4F33B 2C3VA 3V79C 4X6BB 3CXDH 1FYTA 2VL4A 1MFNA 2FZ3A 2CXGA 1NGWA 3FRUB 4JFHD 4WHTA 4H5SB 3B2VL 4DKAA 5KVEL 1U3HB 4J7RA 1T1WA 2BSSB 3O6ML 3RY5A 5C0JB 4CJ1A 1ZA6B 5FF6B 4N0YH 1HH9A 4PS4H 2A2QT 1N5AA 3SE9L 3EGSB 2ITDB 3U0WH 1Q8MA 1C08A 3GMMA 3QZWA 4Z7VE 2FWOB 3VFNA 1T1XB 4F9PC 3ARRA 1BVKA 4Y2OA 5E6YA 1F6AB 4WI5A 1TFHA 5T3XL 2D9CA 1WIUA 4LCCC 4ZO7A 4OZHB 2OI9C 5CGTA 2R2HB 4WJ5A 3O8XA 4PGDB 1X6NA 2WIMA 2HKHH 4XPAL 1HNFA 2R4RH 2EICA 3K74B 4JY4A 5FDYA 3GMNB 4NQCA 3ZKMC 5DD1H 5GXBB 1AJ7L 1F4WH 3RUGB 2B8OT 4AMKL 2QTEA 4O4YH 4KGJA 4OFVA 5D7KD 3WD5H 5EZLB 5L0QB 4HZAA 4WWKB 2GJ6B 4PGEA 1JJUA 3BUYA 3WNNA 1D9KC 4KUZH 4YZFE 5IW6B 1XGUA 4QGYA 1GSMA 4K71B 4OZIB 3DUHA 2YR3A 1A1MA 2A9NH 5CBEA 1JK8B 5E7BA 3L3OA 1JTTA 4MD5B 1MFAL 3VGDA 2ITCB 1NEZB 1KCLA 2W91A 4PUBL 4PGBB 3LEXB 1SEQL 4BQ9A 3WJJC 1LP9A 5I73B 3FB7B 2PTUA 3VRIA 3GSXA 1XZ0A 3DX9A 1ZXQA 4Y16B 3RY4A 3TT1L 2X4NA 1DVFA 3AUVA 4FQQA 1T7WA 2GHWB 3CLEL 3KYOA 4LHUG 1FZJA 1NGZB 4O2EA 3SDAA 5GGSA 3E6HA 1X5JA 5DA4A 1TJIH 1B6UA 3L7EB 2VDLH 5DURD 1L9MA 2A77H 4CRPA 5JHDD 1MCDA 3C87A 3AS2A 4L5FL 4F9LA 5C92A 2VXSL 1G6VK 4XBPB 1YA5A 3UAJC 1NCDH 1I9RL 35C8H 5HYJA 3W9EA 3WJLA 4A6YL 4JFZH 1INDH 3EYSL 5K93A 4XCEB 2WBKA 3FQRB 5HHMB 2HH0H 4P46C 4QXGH 4G8IA 2Y25A 4MJ5B 5FUOL 1I7UA 5IFJA 5HYIA 3MRKB 4IDJH 3MRCB 1MAKA 3PL6A 1A6VH 3PHQB 4MA1B 3LZFL 3GHBL 3MRBA 4NNYB 4Q74A 4UNUA 5F97E 2HP4A 4XCYB 2NCMA 3VFRB 3QQ9D 5I8CB 2AEQH 5EOCH 1ONQB 2LE9A 1JV5A 2DJUA 2BY1A 2R0ZH 5JORB 4KK9D 4MA3B 1NANI 4ZS6C 3SKNA 1RZ7H 1M6OA 2E6JA 2IADB 4FFZL 4R4BA 5FA4B 3ILQC 1AGBB 1B90A 1PG7X 1X4XA 5HYQA 3PG2A 2DLFH 3QUYA 3MLZH 4I48B 3NCCB 1OCWL 1VENA 2C4FU 3GSRA 3SO5A 4NO3B 1GOFA 4PG2C 4OD1H 2PXYB 1UCBH 2AXGA 3E2HC 5K9QI 1TJHL 1R6VA 3WFCL 3BW9B 3MRNB 1CD9B 4WO4A 2QQQA 4LEOA 1PY9A 3S35H 3I50H 2I25N 2MPAL 4RDQF 3VFUA 1A7QH 4HUUA 1JF1A 3FFCB 1KTKE 4OV6F 3OG4B 2VRAA 3FOMA 4OZGF 3GMLA 4YR6B 5IFAH 1SYSA 3B83A 4L9LB 4LGSB 1NMAL 3AFLA 4JRWA 4HLZH 2PR4H 3BZFB 1CDIA 5INDA 1NH6A 5HHXL 1WFOA 3UMTA 1H9VA 1HSAA 5LGKA 1HDMB 2HLFD 2WP3T 2YD2A 4QRUA 2BHYA 1EFXB 2EH8H 5FKAB 3VGEA 1N3NB 5TH2A 1V3MA 3MACH 2FB4H 5HPOA 1S3KL 3BZDA 3FONA 5DMGD 1A47A 5JPNA 4DVBB 4JN1L 1P4BL 3ET9F 1NC2D 1LWRA 2VLRB 4OSUL 4MDIB 1CL7I 4TUOB 5J6HB 3CSBA 4CN4A 4DZBB 5FYLH 4ZSOB 4YBLC 5FECA 1MNUL 3K80A 4GW5B 3QNXA 3O2DA 2BP3A 2WP3O 3DMMC 5CJXC 1C12B 4WI6A 5GHWH 2KL6A 2FHFA 3H6JA 1FCGA 5B38B 4Y1AA 1HILA 3QCVH 1MHPH 3NFNA 3IGAA 4QRQB 4EXKA 4KRPD 4EUPG 5D72H 5E2UH 4ZTOL 3IFNL 4P2OB 4IS6B 3HLAA 1UQSA 1V7NL 4NWUH 3G5ZA 3NCYS 5GGRB 3B9AA 5LCVL 1FC1A 3AREC 3ECBB 3W0WD 4OZGE 4U1SB 2ARWA 1SBBA 5JOEA 1QEWB 3ARPA 1SHMA 1UWXH 3T3PE 4Y4HB 1ZT4A 2GSIA 5ID0A 3CFDB 1RFDH 1KIPB 4B7IA 3TZVA 1NDGB 3BP4A 5ISZB 2DM4A 4NFDA 4MNQA 4OZ4B 4XRCB 4XZUB 1S5HB 5BZWA 1LEKA 3ORJA 3TBTA 4JRXE 3ALWA 5T3ZH 3RL1B 4UV4L 4XVSH 1FE8L 2G2RB 4BQCA 3BPOB 4DOHB 4F2MA 4Q9RL 1I9JH 1ZV5A 3N1MC 1VFAA 1OAQH 4ELKB 5I71C 3QDGB 5CEYB 4AM0A 4MGXA 1HWGB 4OGYH 4X4YA 3EYOB 3VFGL 4KQ4H 2XXCB 3RY6A 1IL1A 1BQHG 1KJVB 2CLRB 3KLHC 1XGYH 1CD0A 4M3KB 2Q8BH 3ULUL 1R3LB 3SKJH 4EN3B 5DRNA 2ADIA 1G9MC 3TO4B 3NFPA 4LSSH 4NC0B 1S9KC 2MWCA 3ZKMD 5IKCA 5A2JH 3RA7L 2QR0B 1ZK9A 1QR4A 1IVLA 5KSUA 4FQXB 1WV7T 2UZYB 4PRAA 3LVEA 3BT2H 3KPMA 5BO1H 1JNNH 3EDKA 4JVUA 4HIXH 1D9KD 1U8MB 3PXHA 3JWDL 2ENYA 1SY6A 2X09A 4LLDB 4NHCL 5F7WC 4B50A 4EKXA 3PQYA 3NA9H 1OGAA 5KZCD 1QSFA 4M7KH 3TJHC 4X80H 4NN7B 1YEDA 2FJGA 5C3TA 3UDWA 1J11A 1ZTXH 1SJXA 2FYYA 4WEBH 1W0VB 4JY6A 3VFOB 5CSGA 1N6QL 4FMFA 5IGXL 5D7LE 2DTMH 2HTLC 2IH3B 4F7CA 1N8ZB 1FFOB 4OF0A 1D5BB 3KDMB 1PQZA 2F74B 3OJDB 5BRZE 1BLNA 3X3FL 1VFMA 1JYWA 5DZLA 3F5WA 3LKRB 4FOMA 3V6ZA 1MCBA 1U8JB 1ZLWK 4HZLA 3QEQB 3CVIH 1KB5H 3UAJD 5F1IA 4YJZL 3GJEA 3WFDL 4PJCB 1XR9B 2WM0A 1EEZB 4WEMB 5E4EB 4NZTH 3CCHA 4R97B 3NIFF 3X11B 3VFTB 4P46D 3TCLB 3FQWB 3O6KL 3BZEB 1SEBB 1MJJA 1IGCH 4LP4A 2IBBA 4U0QB 2DWEB 1T1YA 2VLKB 3S97C 5CEZH 5FOBB 1MVFA 3QIBA 4OQTH 3ROOA 2XACC 4PRHA 5FEBA 4L8CA 4ODVH 2CQVA 2WZPD 2R1XB 3U36B 4R90H 1P7HL 4OCMC 4XP6L 3WIIL 4ODHL 1ZEAL 4MAYA 5H2BA 5C08B 1VFBB 4ODSH 1EEYB 1A7OH 1LEIB 2JCCB 5D5MF 1MVUA 4JKPH 4N0UB 2VDKL 4GAFB 4XXDA 1EUUA 1U8KA 4ZS6D 3D2UD 2D0HA 4YX2H 4ZS7H 1C5CH 2CH8A 1BWWA 2PCPB 3RNQA 2ZNXA 1E4KC 3LQZA 2VC2H 3ILQD 4IRJB 4X6FA 1OHQA 1T80A 5FB8B 4PY7B 1Q94B 5GS3A 1UADC 2OJEA 1L0YA 4NRXB 1KIRB 3TBWA 4ISVB 1ETZB 1FFRA 5CD5C 4YUEL 3EFDL 4XPTH 2MQCA 1T0PB 4MQXC 3ARGA 3HS0A 2P1YA 1MCSA 4X7CC 3CSYB 5ACZB 5DRXB 1YC8A 3K46A 4X9GA 3IYLW 2ZPKL 4X99A 4AY0A 4LFHG 2IBZX 4YIQA 1VGKB 4S2SA 3O4LE 1UM4H 1TTGA 5DK0A 4LP5A 1WBXB 3MGOA 4YXKH 2CDGA 5J12B 4U1JA 1BEYH 4AEFA 3A6OA 3STZB 5BQ7B 1JHLL 1YEFL 2EE9A 4YHZL 5K59F 4JHAL 4K7FA 5IBUG 5CILH 3MOBL 1OAUL 5D5ME 1K85A 1FRGL 2BFVL 2F54B 3DSFL 8FABB 2ZUWA 4HF5H 5HVGB 1ZGLA 5J1AA 2ZZUT 3N1GC 2PW2A 4TSCL 5DQDL 4FABL 3CD4A 2VDQH 4CKVX 1T03L 2FEEI 1VHPA 1HK6A 2DRUA 4OV5A 1P7QD 1F4XH 3O3EA 4D0BB 2P43B 4YDVB 3RWHA 1ED3A 4MQTB 3TEUA 1XR8A 3DMMD 1XGTA 2EKJA 1PEZA 4IRZL 3CMOL 4RRPG 1M1SA 4BSWA 1P6FA 4HS8L 4WUUE 4LF3B 5JW3H 4OIIL 1KN4H 1NPUA 1YEHL 3O2VL 4MDJA 1ZAGA 3ARED 3UYPA 5F7LB 5EU5B 5D7IA 3U9PL 4I5BB 4NKIH 4UTAL 2OJZL 4HUXA 5D1XA 2DTSA 4MD4B 2JIXB 5JXEA 3X14A 5EN2B 3KYNB 4L4VB 1FFNB 2PYEE 4DJMA 3OXRA 5F9AC 4N8VB 1FPTL 1B3JA 5A16B 3IFPB 2DB8A 3ELAT 4U1HA 3C5JB 4JHWH 3WCYA 1KXVC 3MRIB 2OCFD 5GJTL 1FL5A 3GSNA 1MRFH 3TNMB 3WLWC 4NM4H 1FO0A 3PDOA 1FORL 4K3HA 4MA8H 3HI5H 3KLHD 1DJSA 5IM7A 2APBA 5SWZB 1E4XL 4KJYB 1JPSL 4ZXBB 2EDQA 2VXVL 5F7DA 1JWMB 4WHYG 4C57C 1T0NB 4P2RB 3WIHH 1I7ZB 5EBMB 1CZ8H 3ULSB 1HKLL 2E6QA 3TBVB 1H8NA 3LEYL 4QRPB 5KN5A 3P0GB 1JGEA 5E00A 2NXYC 2VISB 3QZWG 1J0IA 1JFQH 6FABH 5E8DL 1QBLH 4F15B 4XNQA 1QRNB 3RWEB 1M7IA 4JRXD 4OZHF 3BP7A 4K94C 4NN6C 1BQSA 1MAML 4ZFFA 3HCVA 4DVRL 4PJ8C 5L8JB 4N0RA 4HWEH 3CFBA 3TJHD 3H9SE 4GO6B 1S9YA 5IB1A 3KPSB 3U30B 3ABZA 3RUGF 4I0PC 2DBLL 4NNPL 5C2UB 1BIHA 1I3VA 1DEDA 4LVNB 1FLRL 5FCUH 2HTLD 1KCUL 1QLRB 3TA3B 1JE6A 4OZIF 5LAXA 4CMMA 2X4SB 2X4QB 4TUKL 1R5WA 3FT3B 3IXAA 2W9DH 1T89A 1BBDL 2JE8A 4Z95L 4GMSH 4HJ0C 5FUZL 3VFVA 3S36X 1HSBB 3GMQB 5I15L 1I9IL 3OKDB 5HDLA 3JZ7A 4YHPB 3OPZH 5F6HI 1KENL 1U6AH 4QXUL 5DD5H 1EO5A 1BM3L 5TGBB 3QQ4B 5DVNA 4KVCH 3EYQD 1UM5H 5D7JA 5DUPL 3VXPB 5MERB 2RQ8A 3G6AA 1BGXH 2CIKA 2X42A 4YDKL 2EIBA 2LAGB 3P9LA 2D03H 2CKNA 4LCWA 2NY5L 2Z8SA 4UB0H 4OZHE 2P24B 4GH7B 3WD5L 1KTLB 1ZKAA 1OL0A 2CKBL 3MNVB 4GW1B 4YDJB 1TNNA 1BZ9B 4KUZL 1F90L 5D4QA 1MCIA 3WUWA 4DKEL 4ZQKB 4ZUUB 1MRDH 4XB8A 2A9NL 1JZ6A 1CICB 4UIKH 2I27N 2DQDL 5FOJA 4WTZA 3RUGE 4TN9A 1OM3H 4PRPA 1MPAH 3LQAC 2GJ6E 4PR5A 1FVDA 5E8OA 3DX8B 1BX2A 1ZS8B 1MWAA 1DANU 5EOQL 4LLWB 2DQGH 4OZIE 3K81A 4EI6B 3O41B 1K9TA 5DTFB 3KR3H 3VA6A 4KHXL 2BC4A 3UX9B 4DZ8A 3O3BB 4HG4J 2G5BA 3PDDA 5CZVL 1I7TA 4D9LH 1FC2D 5DD3H 5CD5D 5C9JB 2QQKH 3UZVB 1WTLA 3MLSH 3X12B 4KTDH 3MCLH 4MQXD 3NAAL 3IAQA 3CSPA 1G0YR 1JI1A 2I5YH 2OTWB 4W70A 1QFWM 1J8KA 1IAOA 2W92A 2W0FA 3UEZA 1FBIL 4H8WL 4L3ED 2X41A 1GAFH 2HWZH 4RFOH 1FVEB 3NTCH 4TVPE 4OM0L 3T2QA 4HIEA 1G1CA 5EIQA 5I1GL 4NQVB 1NSNL 4ZTPL 2D9QB 1JGDA 1U8OB 2W1NA 3LSOA 5ILTH 5HYSA 4IDJL 3VU2A 5ETUA 2P8LB 3SBWC 4KI5F 2JF1A 4UTBH 4BKLA 3TN0A 2X4RB 1AP2B 5CJQL 4LRIC 2X4PB 3IFOA 3TV3H 3RWCB 1BFOB 3OSKA 5FDWB 4G8GB 5HHME 1XFPA 4HIIA 1LDSA 4BZ2L 5I1KH 2IQ9H 3WFHB 4P5KA 1AD9B 3G9VA 2AKRB 5I73C 4JCLA 3EAKA 3LOWA 2Z92A 4NJAH 3RZCA 2XNAA 5GS1A 1BJ1H 1NGXB 2GKIA 2CLZB 3OKMA 1X5HA 2Q7YA 1DQQB 2BOBA 4OCRH 1CD1B 3VWJB 5CS7A 4J12A 3EOTL 2DLIA 3C6SB 2R56H 4MZ2A 2VKWA 1CI5A 2WLYA 4G6AC 5C0CA 3E8UL 4I77L 1WVZA 3NIDF 1JGLH 1SVCP 1LILA 5IMKB 1G9NH 1A6ZB 3MXVL 2GSGB 1YEKH 1OAZH 4CU7A 2F53B 2VE6B 3ZYJA 1QSEB 5KW9L 3S6CA 4W68A 3FMGH 2F8VA 4BFGA 4UV7H 2RR3A 2DN7A 1W72B 3GM0A 3I50L 4WU7A 3HA0A 4WUKL 1T5WA 2FBOJ 2C4FT 1NLDH 3MV8B 3BH8B 3SGDI 1XF4A 4XPGL 4G5ZL 4MA1C 5JXAH 1DBMH 2HJFA 4NQXA 1NJ9B 2VZUA 4AEIH 2SEBB 4R7DA 4HKBB 1OP5K 2XN9A 3OR7B 4WNQB 3MV11 3O8XC 4ZUTA 4KKCC 4EUPH 1ODAA 3FQTA 1WSST 5AZ2L 4HKXA 3BQUA 1JMZA 3I6KA 2EH8L 1TETH 3R0MA 3MACL 4HMDA 1F97A 3MV7A 4X8XA 1BIIA 1NAMA 3BEVB 2K9UA 3F7YA 1MREL 4WUUD 3DGGB 1FH5L 4OBRA 1CDHA 3ZE2F 1RU9H 3MJ9A 3N06B 1SJEB 4YXHL 3TH4T 1S78C 4K23H 2H2SC 3EUUA 4PJDE 2B1HL 3WLWD 2XFXB 5HGBB 3WHXB 2MQ3A 3BD4A 4YNYB 3BZ4A 4OLZL 4LNRB 2UVFA 4F7MB 4YE4H 3U82B 4MNGB 4BUHA 2C1OA 1U2HA 5GHWL 4XMPL 2VLRE 1ORSA 3D1MC 5IB3A 5J1TC 5LBSL 2PKDA 1A4JA 1WEJH 2BVQA 2OL3A 3P73B 4FP8L 4NM8L 1XIWB 5IMOA 2NXYD 3KHQA 3UPRA 4ZSOE 2PYED 2DIAA 5DT1L 1D5ZA 1T3FB 4LASL 5MENE 3QUMB 1NBZA 5IV2A 3PABA 2DQEL 3GJFA 2E7MA 3SDAC 4U6XA 3U4EB 1QVOB 4OJFL 1UM6L 4PJ8D 3RIAF 1YECH 4N68A 4MJ6B 4OCWL 4F9LC 4I9WD 4EDWL 1PYWB 3OKOB 4JO3L 5LXGL 5TQ2L 4I0PD 1WF5A 3FHAA 4XHQA 3KJ4B 4PBVC 4ZUSB 3OHXB 4XVSL 3T0WA 3UC0H 4ODWB 1PLGL 1N26A 1QSZA 1NUFA 1UXWA 4PJ9B 4QOKB 4RFEB 4ZFOB 1NBYA 4Z76B 5ISZE 2R0KL 3O0RH 4HJ0D 3KG5A 4P48A 4OGYL 3DPBA 4HHAB 5CEXA 4BELD 1CDCA 5HHNB 5IHUL 4R3SA 43CAB 4ONHB 5JUEL 1P69B 1EXUB 3T1WA 4KAQL 4G80B 5EBGA 3M8OH 3R8BB 2YPKA 5I8OH 2GUOA 2HT2C 2AI0L 1AHWB 1BFSA 4IRSA 4XH2A 3QDGE 3V6FB 2GTZA 1F3DH 4PJHA 1CFTB 3L3DA 4GKSA 5CINH 4X9HA 3GB7B 4S1QH 4LSPL 2P44B 4U31A 4NKDB 3C8HA 2F5BH 4YWGH 2XIDA 4LMQI 5L88H 1PX3A 1U36A 1KUMA 3QEUA 4YHOH 1BD2E 1U3ZA 2R1WA 1S9WB 4P4RA 4X5XB 1C8PA 5JQHC 3IFLL 1FAKT 2R0WH 1A7BA 1E6OL 3P77B 2AXFA 3U48A 1RPQA 2P5EA 2IAMA 1HINL 2V7HA 2PTVA 7FABL 1LK3L 1PX4A 2XRAL 4LSRH 1HQ4A 4N1EA 3SE3C 2HFGH 1C1EH 5F44A 3QUXA 4KZEH 1FFPB 1NCNA 1IBGH 5B3JF 2I60H 4AQOA 4RZCA 5KSAA 3GBLA 2FIKA 2JCCF 4XBEH 1U3HA 3B5HA 5H37H 5AAWA 5EFIA 3JWOH 4D0CB 1H5BC 1S5IH 2EC8A 3SQOH 3SDDB 5HVFB 2F19H 1MFBL 3VXSE 2IFGA 3EGSA 4KHTH 2P46B 5I1AA 5T1DH 4KRLB 2RIKA 3EIFA 3RVTC 4R6UA 1DTUA 1CLYH 1T1XA 1H15B 4TPRH 3REVB 2OK0L 2BY0A 3D9AL 4GW4B 3HR5A 5IWLA 5FO8A 1F6AA 4QCIA 3CK0H 2GJ6D 3QEQE 1AXTH 3DVFA 3B3IB 5TE6H 3MR9B 1Q9OB 4K7PH 2X89D 3WKMH 3STLB 4ODVL 4NQUA 2EIDA 3T09A 3G6JF 3PGFL 2PYFB 1J0KA 3HC0B 4GXVH 5TQ0H 1IQWH 2DQHH 5D8JL 1MCCA 4DW2H 4JKPL 4HEME 1QZ1A 3RIAK 1Q9WB 1EAPB 2VLKE 5ESVB 3ZTNH 3R1GL 1T83A 5CP3H 2JK5A 4HH9B 5EZLA 1DFBL 1WCQA 2EDWA 3EJJX 5ESQB 5IW6A 1UZ6E 3GSVA 4TVPD 5C07B 3DECA 4G6AD 4QRTB 3VXNB 4C83A 5B3JE 1U95B 2JCCE 3C09B 2EH7L 4N0UE 4MD5A 3S96B 3Q6GH 1NEZA 3LEXA 1QACA 4FQIL 3SDCC 1A3RL 3ALXA 4MXVF 5I1DA 3OAZK 1UT9A 2W07A 4P49A 4R97C 4BJLA 4U1KB 2XWTB 4Y16A 5K9QG 3BKYL 4W6WB 3AVEA 3UTTA 3G6DL 1AR1C 5DHXB 2W59A 4F57L 3DUSB 1YYLH 4NBXB 1NGZA 3PQYE 1U8QB 1AI1H 3L7EA 3TH3T 5DD6B 4XX1E 4MWFB 3AAZB 4XBPA 4CJ0A 3HZYB 1MJUH 1ZVSB 3CH1A 3G6JE 5IP4A 2EE3A 5BMFH 3UTZA 1RZIB 3TH2T 4JR9H 4XCEA 4W6XB 3FQRA 3O8XD 1EIBA 3WXVH 2VMFA 4KKCD 3V95A 3K2UH 5DMYA 4Z77B 1WK0A 3ULVH 2YEZB 1JTOA 5E6ZA 5A43C 5CCKH 3MRKA 4NQCD 1KIQA 3I6LD 5FGBA 3DO3A 4Q9BA 4C4KT 3DWTA 3PHQA 4YEEA 4U6VH 1FNAA 3SOBL 1S78D 4Z7UB 3HNTH 2H2SD 2F54E 3RWGA 2ZOLA 1ORQB 1RIHH 1MQKL 1EUTA 5DC9B 5I8CA 4LSQL 4GLRH 4S1RL 3UDWC 3QRGL 4HQQL 4C4KO 5FA4A 1LQSR 3MC0A 3REWB 2WMPA 2J8UF 1MH5B 5F7MC 2Y7QA 4OCSH 1GC1H 3SGEH 3HR6A 4K7PY 4AIOA 3DSNA 3DRQB 5JIHA 2J88L 4PRBA 2PXYA 3SDAD 1N5YL 1N4XL 3BW9A 5HVHC 4P9ML 4WHYH 1AD0A 3MUGA 1XGRA 5SX4H 3VMNA 3L5XL 1EFXD 5E9DB 3JV6A 4JY5L 5J57B 3FFCA 3BMVA 2BVUA 1HKFA 1LD9B 2NY0C 1RUML 4NPYB 4NZUH 1KCSL 1B4JH 2UZIL 4FG6C 3C08H 1K8IB 1O0VA 1OB1B 3L5JA 4QY8A 4YR6A 4XC1H 4L9LA 2OTUB 2FLRT 1H0DB 2NNAB 3QIBC 4YHKL 3BZFA 4ZFZB 3F62A 4JFEA 5MEND 4BM7A 1HDMA 5FKPA 3GO1L 2QLVB 1GGYA 5FKAA 3RX7A 2E5EA 2YN5A 4QHUB 4JG1H 3HC3L 4HCRA 2NY6D 2RGSA 2HT2D 4B7LA 4A6YB 2J8UE 4AT6A 4YHYB 3ARQA 3DBXB 1EERB 3LHPL 3ZE1F 4TUOA 3MLXH 1X4YA 3LH2L 1QBLL 5I19L 2M1KA 4DZBA 4PRIB 2AQ1A 3NACH 4NC1E 4LVEA 4YHNA 5D2LE 5TE7H 1C12A 3MNWA 3P9WB 4X8JB 4JFDE 2OXHA 2D7TL 1OSPH 5B38A 2V7NA 2VZOA 1RZ8A 1A14H 4FQ2H 3U7YH 5J9PB 4LPVA 3MBEB 5M95B 1QRNE 2XWJA 1R3KB 3DX6B 3FQUA 3RWDA 3RIFK 4U1SA 3U6RB 2FX9L 1UH4A 5HY9B 3WUZA 5KTEH 2JJVA 4MLSA 2ATPA 3T0VA 1KIPA 1YNTB 2BVPB 3BPLB 1U92B 5IHZA 1NDGA 2VR5A 2DKUA 4IMKA 4OZ4A 2XKNA 1A0QL 4NC1C 1S5HA 1BD2D 1I1AC 4OCNC 3P30H 4RIRB 4WTZG 1U6AL 4FHBD 3U7WH 3RVTD 1NC4D 4YXLH 2G2RA 1UM5L 1NKRA 3WXWL 3NH7H 2C3GA 3TPUB 1L9NA 4ELKA 4GKZB 1LO5B 4F15C 4EQ2A 4G7YH 5CEYA 3HUJA 4G8FB 5EOTB 4G43B 3EYOA 2XTJE 4MXQC 4FQHB 4Q58C 1AGFB 2CLRA 4HWBL 5F3BB 1ZMYA 3HNVL 2BJML 2B5IC 2V9TA 5GGQH 3P9MA 4H25A 4EN3A 1QNZH 4JFQB 3U30C 3TO4A 3SCMA 5SWSB 1KNOB 4OLUH 3KNBA 1G9ML 3VDCA 5T33H 4Y1AD 5EUKB 3KYMB 3BI9X 5AYQA 2R2CA 1FCCA 2J8OA 1IEBB 3HG1A 1YQVH 4FQXA 3N1FC 4EOWH 3VXSD 1NFDA 2YUXA 3DVIA 3SKMA 3HFML 4H20L 2EDXA 2N7BA 1DUZA 4LU5L 2YSSB 5HDBF 3D5OF 3HPJB 1FN4B 4WDIB 3V52H 4LLDA 3WEXB 1T4KA 4U49A 4RGOH 5HYSG 4HUKB 3DHMA 3O2WL 1K8DB 3MRMB 4O5LH 3A6BL 2XTJC 4IMLB 4KJQC 2PW1B 1MLBB 1R5IA 5JXEC 1KCKA 3MCLL 3SDCD 1W0VA 4RNRA 2ZCLL 2DLHA 1NGQH 2HRPH 3DRTB 3ZSSA 4MNQD 2IH3A 4PTUA 4JQVC 3MBXL 4X7TA 1EPFA 1AR1D 1D5BA 2ICEA 4RFOL 1BJ8A 1AXSA 5C2BL 4I3SH 2F74A 4WTXA 5FUCE 4GMTL 2IPKB 3D85B 4YDLB 3G04B 2VLKD 3IU3A 5CZXC 4O9HH 3F7VB 3MA9H 1U8JA 3L1OH 4PREB 5F9DC 2WBJB 3FT4B 2ICCA 3WKNA 2NY1B 4NQTA 1HXMA 3T0EE 3KXFA 3HN3A 4XMKH 1HWHB 2H3NA 4PJCA 5HHQB 1XR9A 1OD7A 4YHIA 1IAIL 2YD8A 1QKZL 2VDNH 5CJ5A 2BK8A 5ANMB 4HPYH 2VXQL 4X83A 3T65B 3X11A 1OLLA 4Y19B 1AE6H 3BWAB 3MRGA 4GRWH 3FQWA 4JHBA 5LJYH 1WBYA 4M1GH 5KOMC 2DWEA 5EC1A 1RMFL 1H3TA 5FOBA 3OAYK 3T2OA 4WTWA 1E6JL 1QFHA 4JFYA 5FUCC 3RPKA 5IJVA 5C08A 3PQYD 4QWWC 1EEYA 3O2DH 3D69B 3OGOE 1QSFD 2XG5A 3QG7L 1YEKL 5MEQB 3T0EC 3RTQC 5JOFB 3UTSA 2VDPL 4P2YA 5FYJE 5MI0B 3U1SH 3VGBA 3MNZB 4FTVE 5JOPE 1TCRB 4UV7L 3V4UL 3VWKA 1JRHI 4IRJA 4OM1L 5HGAA 4OKVB 1EHXA 3EO1B 2VLJA 3VXOB 2F8XC 1UB5B 1II4E 4ISVA 2OYPA 4H1LG 4N90E 2F53E 3C6LA 1MCWW 4XNMB 1QSEE 2CMRL 1T89C 4BFIA 5C0GA 1WWCA 4G6KL 2E7HA 2D31B 2JJWA 4OGXH 5CMAB 1MLCA 5BVPL 3VRLF 3CSYA 5ACZA 5DRXA 1MQ8A 3O4OC 3OF6A 4YBHA 1CGTA 1RJYA 5FHBL 2ZUQB 4LSUL 1HZHH 1QBMH 2NY3B 4MJ4A 4NO0B 3MV8E 1G0DA 5AYUL 2Y72A 2NY0D 1UH3A 4EI5B 2H32H 4FG6D 4NKMA 3VWJC 3BGFB 1EA9C 1CDJA 5F7HA 2X9XA 1DUYB 1VGEL 4GRLC 5ID1A 4PB9L 2X4UB 3EYUH 1I8IB 3QIBD 1I7RB 1N59B 3L3HB 2EYRB 2QQNH 4R0LA 5IFHL 1FV1A 5DUBA 3GIZH 2GK2A 3CAFA 4W81A 5LGJB 1Y6MR 3F7PC 5BCAA 3TT3H 1IZKA 2AJXH 4F37K 1X7QB 4P2QB 1MJ8H 1RIUL 4Y2DC 4G6FD 2BRRL 4CGTA 2UVEA 4M6OL 4ODXB 2LV4A 2VDMH 4YDVA 3T0AA 2F5AL 1CXKA 3EDEA 1FNHA 3ZO0A 5KSBB 4MNGE 1T04B 1YMMB 4LVOB 2R2BB 3H9HB 4HH8A 4J8RB 1EBAA 1BFVL 3O9WA 3QUZA 1TVHB 2BVYA 4G42B 3O3DA 4PJIB 2EDFA 5E8EB 5J3HC 4Q9CA 1EGJH 2FJFB 1CFSB 4MCZA 4UINH 5EDXA 1E4WH 4QHMA 4FQLL 5DGRA 5EU5A 1UZ8A 1MOEA 4HIHB 5E2VH 5JQ6H 2Y07H 4O2FB 4ETQB 4GBXB 3ZKNC 4W4OC 5C0EB 5KJRL 4MJIA 4PP2B 3BJLA 4I4WB 4FQCH 5JTWA 1A02N 2JIXA 4D9RD 1K4CA 3D25A 3O0RL 3LDBB 3UCRA 3KYNA 4L4VA 1GGUA 1J8HB 5EA0L 1I1AD 3WNOA 5KVFL 4RCAA 1W8NA 4JFDD 5IR1B 1A6UH 1Q0XH 2ZCKL 4QTHA 3RZCC 3IFPA 5DVMA 4F3FB 5KSVA 5T1KB 4EBQL 5I0DA 2VSCA 3X3GL 1QRND 4ELME 4MXQD 4TSAH 1RZJC 2FX8H 1KELH 2H1PH 3K8KA 3M1BB 4R4FH 1S7SB 2OR9L 2PO6C 3M45A 4ZXBA 4LRNH 4DTGL 1BZ7B 1JWMA 1CDBA 4ZNEE 4TQEH 4NQDA 3RNKA 3ULSA 3SE4A 2BVOA 1I8MA 1KJMB 3TBVA 3NPSB 1CGVA 1BHGA 1YPZB 3IDXH 1NCWL 2H6PB 1N7ML 2DYPB 4U1IB 5ITFB 1HXYA 3RWEA 2P42B 4QGTA 5EZJB 2ZJSH 1YEGH 1AGDA 3WN5B 1MUJB 4KZEL 3SDXF 2CO7B 2ERJB 4X6CA 4E5XB 3NFSL 4UDTA 2XTJD 4WV1B 3KPSA 3RL2B 1OOAA 1N64H 4YGVA 4F7PB 5JXED 3VG9B 1F8TH 2X4OB 2YK1H 4RX4A 2JB5L 3MYJB 1JIBA 1M4KA 1J5OH 3U46B 5E03A 1HEZB 3DO7B 1QFUL 5FO7A 1L6ZA 5ITBL 4JO2H 1OPGL 1RHHB 5HHVH 1NANH 2HA1A 3WMSA 3VI3F 1EMTH 4XTRC 3FT3A 3QCTL 3V5HB 5EWIH 1PSKH 5D9SA 2BVTA 4NGHL 3IJHB 5CZXD 1X5YA 1NL0L 3TYGH 2A9ML 3KGRA 3OKDA 4I18B 4WW2B 1YN6B 3S37L 2ICWB 3W2DL 1UACL 1KCVH 1NEZG 5GIRB 2XG4A 4UBDC 4XP9H 1QFWI 4KGLA 3QQ4A 3WFBH 2XZCH 4G9FE 4X6EA 3VXPA 2QSTA 4NBZB 5I1EH 5C0AB 3OZ9L 2DQHL 1CF8L 1UCTA 1OF2B 3F58H 4HJJH 4U1NB 4HK3J 3ZTNL 3MRJB 3P2TA 5IQ9A 1G7IB 4PP1C 4UT9L 1FL3B 1DL7L 3DVNB 3MNVA 4GW1A 1BZ9A 3MJ7A 4YDJA 5L9DH 4V2BA 2CDFA 5IG7B 3SDXE 2LVCA 2VSDA 4X4XA 5IOPA 1DBKH 3IXTA 3QHZL 1J1XH 4QWWD 3DUUB 1K3ZA 1CICA 3IJSA 1FSKB 3SDDC 3VXMB 1CQYA 2VQUA 2AV7B 4PY8I 1FGVH 2X1OA 4YFDB 5CJOL 4U3CA 2WANA 4R96A 3T0ED 4RAVA 3DX8A 3RTQD 1NFIA 2R2EA 1J0HA 4DN3L 4PV8B 3OKLA 3LQAL 4JDZB 4LLWA 5C07E 5DMKB 5AZEL 4PJEB 3U2SA 3QPXL 4EI6A 1MFCL 5TJWK 3ZT7A 3KPTA 3O41A 3VI3E 5DTFA 3DV6B 3S4SB 2BNUB 2IPUK 2AQ2A 3PP3H 3HI1A 3VD5A 4YAQB 5L8KB 5C9JA 2WINA 1JPFA 2IANE 3HRZB 4P5MB 2ORBH 1JVKA 1KJ3L 2ARJQ 3CMGA 5DJ2B 4ESKA 1Z9LA 5J89A 5B8CB 1CL7H 4X98B 4IIQC 3GJFK 4G9DB 5IBTH 3DXAB 3AB0B 4KUCF 4GAJH 1CTNA 2EDHA 5E08H 5TDOB 4JR9L 4OI9A 2A73A 5I8KH 1FVEA 3K2UL 1H3UA 4LNVA 5GGTH 4IRSC 3ULVL 4XCCL 1UVQA 3WLBB 1U8OA 4NQEA 4K9EC 3VWJD 2HT4C 1GIGL 5FYJD 4LAJH 4FTVD 4Y5VB 3B9KB 4LCWD 4GRLD 3GHEH 3MROA 5E2TL 1E27B 2X4RA 1AFVH 3GMRB 1K5NA 4UU9A 5HGHB 3S9DB 5FDWA 4G8GA 2P45B 3RX5A 2IEPA 2F53D 1P9MA 1AD9A 4FNLH 5IT2L 1RIHL 1LE5A 4ZO8A 3V4PH 3EDFA 1AQDA 3A67H 1NGXA 5CP7B 3VJ6B 4ACPA 4PRPD 4KMQA 4NKOA 4P0DA 5T1LB 1WFTA 3QIWA 1JWSB 2VZ3A 3RGVA 1IGFL 4U0RC 3C6SA 4Y2DD 1OARL 4XNUL 5AWNH 4AENB 1J12A 4WCYL 1A6ZA 3QULB 3SDYH 2FD6H 3QR2A 5EZIH 2EO1A 5JPMA 2GT9B 2PUQT 1T22B 2CKBB 4KVNL 3S35X 4X7SH 1S8DB 1HHGA 2NYYC 5A2FA 4RSVA 5J3HD 4M6MH 1CFNB 1DQJB 2QL1A 5F7EL 1KGCE 1EO8H 2ZKHL 5CFHA 3CFKB 5HHOB 1EJOH 3DI3B 1I1FA 1V3JA 5IWLC 1TZIB 1ZLWH 1BF2A 4JFPB 4DQOL 4JDTL 5IEKB 4QT5A 4WHDA 4HKBA 3LKNB 4WNQA 5F6IB 3C8KB 5B38G 3QHTC 4MVBC 1A6PA 3HNSL 2VLME 1A4KB 5C0FA 2VR4A 3RZCD 3BEVA 3V0VB 3SGJA 5DUMH 1T83C 3DGGA 3P0VL 4NWTL 1SJEA 4WW1A 4JHZA 3GZKA 5JIKA 4IM8A 3G08A 3VD4A 1UWGH 3BPNB 4ONGH 2XFXA 5F9JA 4P5TA 2HJKB 1UJ3B 5HGBA 2Q76A 4HV8A 5HJ3B 2G9HA 4YNYA 5C0CD 1JPTH 1V5JA 1WUNT 2PO6D 4G6JL 4R2GC 5DK3A 4FZEL 5IVXB 1RUKL 4Z6AT 1ZLUH 1LHZA 1GHFL 4R26L 3SN6N 4U2YA 4G6MH 1DBBH 2QSCL 4JPKL 3NOIA 4CUCA 3S8WA 4FQ1L 1RUPL 1CXHA 3KPLA 2JB6A 2I9LB 2IQAB 1XIWA 3P73A 4ZPTB 5IB2B 2DQUL 4TULL 2W9EL 1MWAH 1ZLSH 1G9EA 4PRIE 3BISA 1I8KA 5ENWA 3C2AH 5E5RB 1CE6B 2R4SL 4DGVH 3U4EA 1QVOA 3CFEA 1CLOH 1RURH 3BE1H 2W0LA 5EORL 1B9ZA 1PYWA 3GMOB 3OKOA 4XPHL 4RMVA 3NCFB 2VN4A 4NCC1 4MYWB 3QUKB 1A2YA 3ZYIA 5BS0A 4Z7OF 4JQXC 2UUDK 4ZUSA 4MB5A 3W81A 4AL8L 1UENA 1TJGH 3IDJA 1WIPA 4ODWA 5F88B 1UA6H 4NZRH 2ADFH 4PJ9A 4XTRD 5FGBC 3MLRH 5IQ7L 1JN6A 4Z76A 4ODUA 3MGAA 1OP9A 4U6YB 5HHNA 3UO1L 2AGJH 43CAA 5I66A 3MLUL 4QLRA 4UBDD 5EU6A 1IRAY 1TVBB 3RKPA 5FK9B 1P2CA 3ARTA 4FQJL 1AHWA 1QPXA 8CGTA 1L7IL 5JHDB 3MRHB 4ZUVB 1G7QB 2XPGB 1DDHB 5D1QB 1CFTA 3WS6A 4GJTB 1X3DA 4XWGL 3GB7A 3MGTA 3SE8L 4HBCH 4V1DA 1YQVL 3LIZL 4PP1D 1J7VR 4EOWL 1J1PL 1Y6KR 3QISA 4I2XA 2GCYB 4JFEE 4LIQE 4QHNB 5SWSE 3PGDB 4P57A 2VQTA 1ZSDB 5DHVH 5L2JA 3CX2A 3SDDD 2YD1A 2YMXH 1Z0MA 3MMEB 2A0LC 1KN2L 1Y6NR 2Y06L 4JFXB 2FGWH 3QEGH 4Z7OE 3ZT6A 4P4KC 1PG7W 1Z9MA 4H88L 4G9FD 3KPPA 2UWEF 3UBXA 1HQRB 2B2XH 3EO9H 3PWLB 1F42A 2VUOA 1VEPA 1DLHA 4O9HL 4YK4C 3LKOB 4IDLA 5I1HL 1NMBH 2EIZB 4AG4L 4F7TB 5TPWH 1YJDH 1DCLA 1RZFL 5DEGB 3ULUF 1MCHA 5HSFA 4GT7A 5HYEA 3V7AE 1ZHKB 4I0KA 1G7MA 1NLBL 3P4LA 1H15A 12E8H 1I1YB 1KB5A 4D3CH 4GW4A 4IRSD 4LHJB 3LN4B 1RJZA 1AE6L 4U2ZA 1NBVL 3FO9B 3MODH 4RA0C 5IUSA 3KPRA 1T5XB 2HT4D 4H1LH 3GI9L 3S7GA 2FH6A 4BFBD 4XCFL 5DHYA 1G84A 2Y36L 1S7RB 1JPGA 4HAFA 1TENA 3ZHKA 1CGSL 5ANME 2ED9A 4NO5B 5KS9A 4OQTA 2R9HC 3R06A 4XX1G 2OQJB 2IAND 2VZTA 1G6RH 4Q0XH 1Q9WA 1DQMH 4HXAL 1CR9H 2YKLL 4NIKB 3H9ZA 2V5TA 4HH9A 1QR1A 3X13B 2OL3H 2UWEE 3DURB 2ICES 3GKWH 1XEDA 5DJXA 4YDLC 4Z8FL 4HC1L 3VXNA 3QUXD 1U95A 4OLWH 2VH5L 2AJUH 2IPTH 4D8PA 5DJAB 4BQBA 2ZCHH 4YO0B 1NC2B 2GITB 2LVEA 5C70A 4YHML 2CLVA 2Y1VA 2ED7A 5HGGS 3GK8L 4J3XA 5DSCA 5K9OB 3ULUE 4IMKC 3P0YL 1IEAB 2NYYD 3N9GH 4YC2C 1LO4H 2XWTA 4P59L 3CUPB 5ICZB 4LDOB 1HZHL 4U1LA 4N0FA 4JQIL 1U8QA 2DS4A 5KSBF 4L4TE 1EZVX 5IROA 2B1AH 4JJ5B 4PJFB 4UOW1 4POUB 5DD6A 2X05A 4K94H 3H0TB 4BSVB 4MWFA 3OB0K 4YHLL 4HS3B 3ARVA 1ZHLA 1KJ2H 3W0WB 3D39B 5EG6C 1ZVSA 3GSWB 5SWQA 4PJIF 3TLRA 2DWDA 2B4CC 1HHJB 3TBSB 3TIDB 4X6DB 1Z3GH 4XP4L 5CGYC 1FZMA 1U41A