2CSPA

Solution structure of the fniii domain of human rim-binding protein 2
Total Genus 15
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
15
sequence length
130
structure length
130
Chain Sequence
GSSGSSGVEFSTLPAGPPAPPQDVTVQAGVTPATIRVSWRPPVLTPTGLSNGANVTGYGVYAKGQRVAEVIFPTADSTAVELVRLRSLEAKGVTVRTLSAQGESVDSAVAAVPPELLVPPTPHPSGPSSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Endocytosis/exocytosis
molecule keywords RIM binding protein 2
publication title Solution structure of the FNIII domain of human RIM-binding protein 2
rcsb
source organism Homo sapiens
total genus 15
structure length 130
sequence length 130
ec nomenclature
pdb deposition date 2005-05-22
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2cspA01
4G8GD 5FK9A 3KLSA 1DBBL 1NBVH 2W92A 3O4LD 3QDGA 5F7WC 3BGFC 3RIAK 4M3JA 1FRGL 4NQCA 5EZIL 3IF1B 3VI3F 5ISZA 2H9GA 5MENE 2AXGA 1TNNA 2C7UA 2CDFA 3L9RA 5E8OB 3O9WD 5I1JL 4P46A 3ZKNC 1EX0A 2I24N 4OZGB 3SJVB 1ONQA 4U6YA 5F3BB 2DF3A 1AE6L 3K8MA 3FRPG 5KANG 4ZPTA 1CGUA 3G5YA 2NY4D 5SX5H 1ZVSA 3C9NA 3KS0J 4JEGB 4U1HA 1C5BH 3MLZH 3ARED 3UTPD 2EO1A 3MBXH 3P73B 4EUPA 3KVQA 4F57L 5JNYB 4K71C 1C5CH 2ADIA 4YDKL 3CFEB 1ZA3B 4MNQD 3DI2B 4GXVL 1U95A 3K4DA 5GSRB 1S78D 1KB9K 3CUPA 4XPFL 5EB9A 3AREA 4RNRB 2JJSA 2XWBB 3NIFF 5D2NA 4LASH 3QJHB 4J3UA 1RU9H 4HF5H 4PJEF 4K7FA 5IVZA 3ZE1E 1INEL 7CGTA 3EHBC 1U2CA 4MNQA 4KHXL 1TJGH 2A77H 3PWUA 4MJ2A 1U6AL 1JZ5A 3T09A 2B5IB 4PJAB 2AJ3A 2EXYC 5H35A 1OAUL 2HRPH 3V4UL 4HIEB 3QUXA 4NC0B 5AAMA 1HI6A 4P46C 1OAQL 3RUGA 3UTTD 5ID0B 3ARTA 5I16A 2AJXH 4LBEB 4HT1H 4XWGL 3IDGA 5IFAL 2DQJH 4P4RA 5AZEL 4KKCD 1VEOA 3EYFB 4H25B 1KTLA 4JLRB 1NCNA 5JHDE 5EZJA 3TN0B 3MA9L 3ZKMD 4NZUH 5KSUB 2F53B 3OG4B 2PTTA 2VLLA 3UROR 1MHCB 1MRFL 4MS8D 3G6JF 4QRTA 4OM1H 4QRPB 1FFPA 4XCFH 4YXHH 3RY4A 4WNQB 1XCTA 3EOTH 5D7IA 5K9JL 2IH1B 2FR4A 2HA1A 5D7LA 1KN4H 4UT7H 3GSNA 4MD0B 5DT1H 4O2CB 2J8UA 4JFEB 5D70H 4LARH 4QHKI 2HN7B 5IEHA 4FQIH 4PGJA 5CIPA 4DFHA 2V17H 1F90H 3QXVA 5TE4L 1CLCA 4WHYG 4GMTH 5DJ6B 2YBRB 4ELKB 2VLKA 5F7NC 1F4YH 3QUXC 1NBVL 5I2IB 3MODL 1KCRL 2WINA 2ZUQB 3V8CA 4NYLA 1I8IA 5BVJB 4F9PA 1D5ZB 4FQXB 1BVKA 3GNMH 3MFFB 5DJXB 3MCG1 4KTYA 5C0BD 3G5ZA 1NKOA 5SX4I 3KPNA 3H8NA 1P53A 3BH8B 3A67L 1OD7A 1SEBB 1WK0A 2DIAA 3QDHA 5FO9B 4M7LL 1DBJH 5DYOA 1UWXH 4N68A 1IGML 4Z18A 1W72B 3QDJE 1LWRA 5F7EH 1FSKB 3IKCB 4RWYL 3GUTB 5C0BA 2W65B 2C1PA 1GZQA 1HH6A 1CZ8H 1QFWH 3GI9H 5K9QI 1S3KH 1WF5A 4MNGB 4X99A 2UZYB 3KJ6L 4Z95H 1KELH 3F7YB 4HXAL 3PV6B 1EAJA 2OJEA 4FQ1H 1BJ1H 3SO3B 4PJXA 1MJ7H 3DI3B 3F7VB 4EQ3A 3MFGB 5ID1A 1RULH 3H6JA 4CW1B 4MD4B 1ZXQA 1CD1A 5GRUL 4HF5L 4XI5D 5HYJE 3FQNA 4RAUB 3ULVL 3T8XB 2WWKO 2JB5H 1NCWL 1OGAE 4MJIE 2AAVA 1NGWA 5IW1A 4RISH 2DJUA 4WO4C 1QHPA 3HE6C 1BF2A 3V95A 5J12B 4JDZA 4P2OD 4S1DC 4WHTB 4KI1A 4E0RA 4LPWA 1M7DA 1JIBA 5ESQB 2HRPL 2W38A 2X4OA 3MV9E 5J1SC 3ILQC 3IFNH 2YSSB 1R3JA 4QT5B 4K8RH 2NZ9C 2F54D 3BKMH 2V2WA 1DQQA 1I7TB 1A3LH 2NXZB 4APQD 2IADB 4D0BB 1P84K 1ETZB 3VXPA 1MI5E 3B5GA 1QFUL 2YXMA 3SKMB 4BZ2H 1I8LC 3DURA 5TPWL 4X9GA 2F54A 4P9ML 3HZVA 4LSUH 5F9WC 1H8NA 2WIIB 1FYTD 2CPCA 5AWNL 1WZKA 4OM1L 5KSAD 3V5HA 4HEPG 3ZLQC 1P2CA 2DTMH 4JR9L 1BP3B 4X83A 3DMMC 3H2WA 2IF7A 5CBAB 4OM0L 3TBWB 3VXTA 2G2RA 4KMLB 4KAQH 3T0EE 1KN4L 3IU4L 3LKPB 4LARL 1MY7A 3D48R 3F58L 4LCWB 2OLDA 4FQIL 1CXKA 3RVWC 4L9DA 5DJAB 5E6ZA 2R1XA 1AD0A 1MFBL 4ZFOL 1UKSA 4NQEE 1F4YL 2EIDA 3NACL 1AGDA 3KG5A 1GGIH 4RAVB 3BQUB 1U2HA 1T1ZB 3PGFH 2ZCLH 4R8WH 3KPOA 5KVFL 1NGPH 1TETH 4WFEE 3QCTL 3V4VL 4AG4H 1SBBA 1SJEA 2D7NA 1WAAF 4QWWD 1G9MC 3ARFB 4XT1C 5C6PB 3X13B 5T1LA 2RCSL 4OV5B 3WNKA 3RWJB 3GKWL 3N1MC 2N7BA 4OT1H 2DMKA 2F19H 3EO9H 5D9SA 1EDQA 5EU7C 1ZEAH 5E2JA 5C7XL 2YD7A 2P5EE 3DIFA 4PIRF 3UXFA 1Q9KB 3ULSB 5HGGS 5LGKA 1CLZH 2ADJA 2KUTA 4NM8H 2DIBA 4JFHD 1QFWL 4OLZH 2GW5A 2P8LA 5B8CC 2I27N 4KKBD 3SDDA 2GJJA 3DX8B 1NEZB 5KOMC 2ITCB 4W68A 3LB6D 4OGXH 3FO1A 1D6EA 1RULL 1UCTA 3MLWH 4MJ4A 4PY7B 3OWEA 4WWKC 4O2EA 3VFVB 3RWHB 3WFCL 4MVBD 5GS0L 5E99H 4PD4J 1OHQA 4AZ8A 1HINH 3BFOA 4K2UH 5ACLA 4FXGA 1OSPH 1Q94B 4ZFGH 4IRJD 5F7HA 4JY4A 1BX2B 2B4CL 2VXVH 3CDCA 3RWGA 5IM7B 4PBWD 1V3JA 4LKCB 2DQEH 1IT9H 3MJ7A 4Q9CA 5HYJB 5MERA 3V8OA 2A9NH 5IEKB 1PKOA 1OGAB 2EE6A 1BD2E 4PV9B 3NTCH 3ARGB 2EYTA 3RKPA 1A3LL 4Y5VA 3N85L 4KK9D 1OGTA 5C0GA 4I77H 3ROOA 1L0XA 1CFNA 1JL8A 1T66C 3ECBA 1R5WA 1S7XA 4YK4B 3T77A 5HBBA 3DV6A 1EAPB 3D6GA 3TVMD 2EDJA 4OJFL 1D5BA 2WWKT 4O02H 2DL2A 1T6VN 3ET9F 4CU6A 2XQYG 4G9DB 5EUOE 2QADD 4GAGL 3CDYA 5DUML 1A02N 5ICZA 1BBDH 5FYLH 1YMHA 3LKSA 1ZK9A 4BELD 1T2QH 3D2UB 2XNAB 1G7LB 5I76A 4CMMA 3NCCB 3V4PH 1CS6A 1IGJA 4P2QD 3LQAC 5A40E 1SMOA 4H26B 3GHBL 3L1OH 3UTZB 4LSVL 3EO0B 1CFSB 2NY2C 1HH9A 3O11B 4UIKL 4UBDC 1RMFL 5F44A 3BZ4A 1XIWC 3EGSA 5TQ0L 1N7MH 1HHKB 3KJ4C 1IGIL 4GBXA 4K3JL 3VD3A 4I2XA 5E4EC 1JBJA 3TCLA 4K7PX 4YDLB 2JLLA 1JV5B 3OAUH 3VXRB 2H2SC 3QFDA 4L8BB 4DKAA 4HHAA 3U4BL 5DHXB 3BUYB 3QWRA 2ZUUA 3TO4B 2F19L 1YEIL 3JWOC 2ZJSL 1RZKC 1LP9B 1T0MA 1J0IA 2UYLA 5D5MF 4NC1C 3QUYD 5ICXA 1L7IH 1DLHB 4QXGL 4OZFA 4XP9H 5E8PA 5E5RB 3QXTA 1A6ZA 4XCNA 4AQOA 1CLZL 4PJ5A 4C54A 2CKNA 1VFAA 4TSAH 4MAYB 1AKJD 5BZWA 3RWCB 3IJYA 1WFTA 1PW3A 2PN5A 2DS4A 2H26A 4E9LA 3QDMD 1Z5LA 2HMIC 2PXYB 4OCWL 4TNWK 4EQ2A 5HDBE 2P5EB 1H3PL 3H9SA 3KPRB 4X7SL 4LDEB 1N5AB 3QIUA 1UEYA 5DR5L 3IJHA 4AENB 5F9JB 3ULUF 4K2UL 5CEXA 4X7EC 4X4MA 1YUHA 4KROC 3SPVA 2XOTA 2D31A 2DQEL 2FBJH 4HV8B 4F8TA 4C83B 4OFPA 1EBAA 2H2PD 2JB6A 1RK1A 3S98A 2K3TA 4HUUA 1OB1B 4JVUA 1LE5B 1IVLA 2HVKB 4KI5F 1CDUA 3AS3A 4DFIA 1MHEB 1YMMD 4NKDA 5FA3A 2COQA 1EJOH 2GHWB 4XCYB 5LWYL 4FQCH 1CK0H 3SCMB 4Y8DC 1U8PB 3MC0A 5IB2A 1VFUA 5EU4A 2JTDA 3QO0A 4IHOB 4QHMB 4R26L 5JOEA 1MJ8L 4O9HL 2FO4B 1YMMA 2FX9L 5C0NC 3S36X 1VCAA 1NAMH 1EHXA 3PQYD 3FO2A 1MCFA 3U48A 4Z7WF 3L6FB 2VISB 4LLYB 1CXHA 1I3VA 5F72S 3QR2A 3LVEA 5ILTL 5DJ2A 2HTKC 3KR3L 5T3XL 1TQBC 4LLWB 3MLPA 5EO0A 4Z76A 3W82A 1MFNA 4YC2C 2VYRE 4JKMA 5IOPB 4KGLA 1A21A 1EVTC 1M7IA 3MCKB 2MMXA 4ZNEE 1R3IH 1JMZA 5CZXC 2WUCH 5ENWA 4YUEL 1EV2E 1U8HB 3RIFK 4U6TA 2BHYA 1T22B 1QFOA 4XZUA 2D03L 1Y0LA 2IPTL 3V0WH 1X5IA 4P5KB 5LQBL 1A3RL 3DUSA 4AH2B 4YJZL 1N5YH 3PHQB 3E3QC 3FQXB 3G6AB 4XMPH 1BFOA 1MCNA 3BYTA 1WLHA 4P23B 1EMTH 1JNHB 1DANU 1G6RH 4YR6B 5I17B 5EFIA 5FA4B 4YDIH 2R0LH 5I19H 4MB4A 4TSAL 3WV0A 2O5ZH 1INQA 2R0WH 4X6FA 2Z8VC 3CFBB 3PHOB 3AAZA 4QYOA 4LEXL 2ZG3A 2QQKL 3ALXA 3IRZA 4DZBB 3VD4A 1JFQL 3O41A 1TPXC 1F6FB 4YBLC 5BJTB 1LK3L 4AM0B 4PJFA 2Z31A 1SYVA 3BWAA 5JXAH 1HSAB 1QKZL 4BZYA 3BPOB 5E5MB 4PJ8B 5C07D 4RBPK 1FP5A 5HHXH 5CKAA 3WNLA 1B90A 3DV4B 3NFPA 4J1UA 2CDEA 5T3ZE 3DVGB 2J1KA 2QR0A 2PO6B 4MXQD 2FD6L 4HD9A 4MDJB 1IM9B 2RR3A 2X9YA 1IGYB 5I8KH 1HXYB 4I18B 1E27A 3U0PA 1BQLL 3FN0L 4HS3A 4U6XA 4NDMA 1KN2H 1LEKB 2E6PA 2IANA 5C07A 5CSZB 4URTB 4NNPH 1AGCA 1RZFH 3SEPA 4OCLC 3WDIA 5CBEB 1DBAL 1EJOL 1PVHA 5H94B 4G8EA 4I48B 3TIEB 3VWJB 3ZHKA 2FX8L 1EEZB 5EWIH 2BY2A 3P11H 1T1YB 1YJDH 4K55A 1HXMA 4FTVB 4EIGB 4OQTA 2NNAA 1KLGB 4JGMA 1FV1B 3RX5A 5C1MB 1MRCH 1YEDA 1ZS8A 2FJGB 1AD9A 3FB5B 4RMRA 2E5EA 1JHKH 2AEQL 3MRDA 4DWHA 1MCPH 4FG6D 3QUZB 4S2SA 1RVFH 4P57A 3V9FA 4I0PB 3DXAA 1PKQA 2AQ2A 3O6ML 1F2XK 2X4TB 1FPTL 1A6UL 2ENSA 3K3QA 1YN6A 2IAMD 3SDCB 2UVEA 1FNGA 4WFHD 5FB8B 3IJSA 5FXCH 2VQ1A 5TGBA 1N2RB 1X5HA 4PJDF 4FABH 4C57C 2NX5D 3BKYH 5JW4R 1LO2H 1XR8B 5EU3A 3W2DL 1RQ5A 1G9MH 4Y7MA 2IAMA 4ZMAT 4QF1A 1HHHA 4LNRB 4M9OA 4OI7A 4UILL 3H42H 2J4WH 5JOPE 2OX5A 1JMXA 2BSRA 4X98A 3VRJA 3EAKA 3G6JE 4P5TD 2CGRL 1MHPH 1R5IB 4K07A 4XMPL 2NX5A 2EICA 1G7IB 1OAYH 5CP3A 1V3KA 1CICB 3IVKA 4K7PH 2I07B 3ZHLA 1I4FB 3GSNL 3MRIA 4MCZA 3VE0B 1ITBB 1NMAL 4G6FD 5I73C 1RUPL 1IC7H 2Q86A 2BNUA 1I9RH 4U6VL 1H8OA 5H37H 3NPSB 2IEPA 2AQ3A 5C08A 5F6HJ 3FOLB 1J8HD 4KY1L 2XKSA 4LSQL 5F7KC 1TTFA 2P1YA 1KOAA 3HC0B 1NUFA 1JGLL 1H15B 5DJZB 4HFWA 2FGWH 2AXJA 3WKMH 2GEEA 3GIVB 3PP3H 2P24A 4HCRH 2MNUA 2FL5B 5FHAH 2JJTC 3O8XC 1U58B 1QBML 3CCHA 2L7JA 1F97A 3QEGL 1X5XA 4UI2A 4V1DA 1JNLL 1PG7X 3OKLB 1KIRB 2CLVB 4LQFL 5I8KL 3QBTB 4R90H 1XGQA 4L29A 5IF0A 1J86A 4JQIL 4LPVA 1ADQA 4K8RD 3IFPB 2DYPD 4LVHC 5EO9B 1DDHB 2OR7A 5KANI 3BP6B 3UTQB 1RZFL 3QEHA 3PWNA 3MLTA 4NJAL 4X6BB 4YIQB 4KVNL 1T5WB 1JGDB 4MQXD 4DUXA 2AV7A 3P11L 2BZDA 3RWDB 5GS2H 3V6FB 2I5YH 2LABA 4POZD 1FVCB 5DHVH 5A16A 2EDDA 4Y4KB 3BPNB 4G7YL 4UT6L 1ZVHA 3HLAA 3FQWB 4JZNA 12E8L 2B0SH 5C9JB 4JFFA 5F7UA 3KPMA 4YHYC 3LQAH 4XPHH 1MF2L 1DUYB 3S9DB 4RX4D 4PJEB 3MYJA 4Q9QH 3U7WL 1VEMA 5I1KH 5E1HB 4K3GA 5F89B 5C0EA 1XCQA 4KQ4L 3S36H 3O0RH 5I0DA 1UZ8B 5K33A 4ENEC 4EOWH 5IESL 4M5ZH 4UUJA 1U42A 2AJSH 4JDVB 1ZGLB 1Z3GL 4UQ3B 3TJHC 3IDJB 4YHKL 3UCRA 1JYVA 1CGVA 1DVFD 2AABH 2EIZB 3EDKA 5BS0E 2X42A 4G8IB 3FMGL 1Z0MA 1KEGL 4JRYA 2CDGB 2V9TA 4L5FH 4ZUVB 1Z6JT 4NP4L 4PRAB 3JWOH 2ZCHL 1BQUA 2IG2H 4UTBH 5ADOL 4XWOC 4FXLA 3PWPE 4WU7B 4YBQD 5K9OB 1MCWW 2A38A 4YDVB 1AGBB 1GJIA 2Y36L 3G6JB 1CGYA 4FP8L 3L7EA 3A6BH 1AC6A 1IC7L 4XNQB 3RZCB 1NCDH 3QUKB 2E27L 3B6SB 5DSCA 2X70A 2DQGH 3VGGA 5K59F 5GGUA 1S9VA 5FUCE 1KCSH 5FKPB 1KJMA 2BY3A 4X6DA 2UWEE 4M7KH 3MUY1 4NRYA 4U1JA 4TNVF 3GB7B 5F96L 1WAAE 3WUWB 3ARDA 3OPZH 5HVHC 5L8JB 4MLIA 3O6FB 5IMLA 3DO7A 1TVBB 3ZHDA 2NYYC 4LDLB 1FL6A 1S7WB 4OF6A 5DK3A 4MZ3A 5EC2A 4MDIB 4BZ1L 2JIXA 2D9QB 3R06B 4TOYH 2B1AH 4OFDA 2EYRA 1RIVL 3BEVA 4NN7C 1R0AH 2VLRE 3QUMB 2AJUH 2NY6B 2YKLH 1T04B 1BBJB 1BHGA 1D9KD 4JY6B 3C2SA 1UYWL 2ATPA 1QRNA 3EIFA 3N06B 2AGJL 3B43A 2ZOKA 3MRQB 3D0VA 4IRSD 4DEPB 3NBNA 1UXSA 1GIGL 5CILH 2VUOA 1CGSH 1S9YA 2EKSA 2NY1B 3NA9H 1VSCA 3OKEA 4OLVL 1N0LA 1F6AB 2NLJA 2WUBL 4X4XA 3UO1L 3RUGF 4KMTH 1ZANH 3BSZH 3MTRA 4LPUA 1QFWM 3G08B 3C8DA 5EU6D 1D9KA 4IOSD 4O2FB 3L5XH 1QQDB 5FYLD 1LO4L 5FOBB 5DJYB 4XRCA 3RWEA 3OR7B 5GZNC 3RNKB 1NLBH 3PWLA 1B4JH 4RBPH 3EO1B 5IROA 3S3SA 4PTUA 5J1TC 4FXKA 5D96B 4XNZC 3ARDC 3IRPX 5HI5C 1K8IA 3B8YA 5I1KL 4DJMA 4JHAL 3S36L 2A74B 5DK2A 1FE8L 1P4LA 1DQDL 4XX1G 5DC4B 4EOWL 5D2LE 1BAFH 4M5ZL 5GGRA 1A7QL 4M4PA 4CGTA 3KS0H 1RZGB 1WT5A 2GSGA 4NQDE 3MV7E 1YEKH 3TBTB 3WFZA 5SWZD 4BFIB 3QIBD 2VDPH 4HIIA 5DWUH 4A2LA 4I3GA 3GMNB 4ZFFA 3CSBA 3SGEI 3HI6H 1RZKL 3UTSD 3MLVL 1PX4A 5I15H 3P0GB 5J06A 3BDYL 3NCYP 4K3DL 5DJ8B 3CH1A 5DJCB 3U7AA 3K1KC 1MWAB 5HJ3B 5BS0B 1Q8MA 3V6OC 1JWUB 5SWZA 3L3IB 3QIBA 1NBYB 5CGTA 4BSWB 3VH8A 5D6CA 2Q8AH 4WUUD 3L3GB 4FFZL 4L3CA 3A6BL 5C0JA 4XC3L 2YXFA 3WSQH 1J0ZA 2BNRD 2BVOA 1F6LL 4HZLA 3FT2B 3EOAA 4GAJH 3F65A 3KXFE 4G43A 5E8EA 3SDAC 4LCIH 1N26A 4JQVC 5I1GH 1FN4A 2OCFD 2Q7YB 4Y4HA 4M62L 3MUZ1 4X6CA 5JXED 1ZT7A 1FZMB 3TLRA 4EXPX 2BNRA 5HYSB 5DHYA 1WT5C 3RDTD 1HKLL 3RTQA 3L3OB 4ZFZB 2HFEB 2LV4A 4Y5XB 3OPZL 1HWHB 4M6OL 4NHUA 1KGCD 4XCCH 2QHLA 3QCVL 2GQHA 3T3PE 4PJXF 4YHOH 5EU5B 3UBXB 5GGQL 5KAQF 3RDTA 1VB9A 3P30H 3L95B 5TF1L 5IW3A 1PG7H 4QCIA 2IPUK 4M1CC 5FDWB 5E8OA 3QZWG 4ZTPH 3OAYH 3WE6B 5CEZE 2VLRB 2DWEB 2R2EB 1S9XB 1QA9B 5F3BA 3H7BB 3A0OA 1UH2A 4JFZL 4KMTL 4X7FC 2OJZH 3KNBB 1KNOB 1ZTXL 1R6VA 2VAAB 3V0VA 4GKSB 3ULUE 1J5OL 1T80A 1UH3A 4P59H 1CDJA 3P77A 4Y4HC 5JNYA 3PJSB 4M43L 4M9PA 4U05A 4HMDA 3CFEA 5ITFB 1AJ7H 1ZA3A 5T5FL 3QCUH 3ZKXC 4JRXB 4XPAH 4PP1D 5I66B 3GSXB 3NCMA 4RNRA 3K8KA 1H5BC 2XWBA 2NY5L 3QJHA 4FZEH 4ODWA 3BE1H 3GIZL 3V79C 1OL0A 2A2QT 4KI5E 1I7RB 3CSPA 1MCKA 4BUHA 1QO3A 4KJQD 1KJ2B 1VERA 3TFKC 5JORB 1UA6L 4X6EB 2VDPL 5DWUL 4FFWD 4PJAA 2HT2C 3Q6GH 3GMOB 3EKCA 1L7TH 4ZOCA 1V7MH 1YN7B 3FO0L 3RKDC 1EFQA 4P5MB 5ID0A 5EA0H 4LBEA 2PCPB 1BZQK 4P3WA 2XY1A 4EVNA 1CXEA 5CFHA 5DUPL 3P4NB 2DMBA 5AG8A 5JIHA 2XN9D 1PLGH 4Z7WE 2BNQB 4E5XB 3DYPA 4P4KB 1ZOXA 3BKCL 1EZVX 1U91B 2BX5A 3D69A 1PY4A 3DGGB 1WTGT 2D4DA 2G5BA 2YMXH 4L1HA 3TN0A 2D7PA 2F53A 5L7XH 4GAJL 2C4XA 3MLSL 4YAQB 4QTIH 5C0CD 3OF6D 4LLQA 2CMRH 2XN9A 2VDLH 5E2UH 3D3VA 2IH1A 4L9LB 4KHTH 2DQTH 3MV8E 4MA3B 3WXWH 1G6RA 4MD0A 4O2CA 1VFBA 2FEEL 4JFEA 1BOGB 2HN7A 2XWJB 5DC9B 1IGFH 3KXFB 5JW5B 2J88L 3GBMH 1K3ZA 4WO4D 5E6IB 4HS8L 1U0QA 1I85C 5C0CA 3RHWF 5DD6B 3SOBH 3HAEB 3W9DA 1TZGL 1XF4B 3N1QC 5DJ6A 2YBRA 4ELKA 4ZUWB 4HPYH 4U4BA 2FEDC 2KL6A 3RVUD 5I2IA 2DQHH 3TPUA 1NAKH 3LQZB 3PG2A 5MEND 4X4ZA 3VWKD 1UACH 1PG7L 5BRZE 3DSFL 1RJZB 2BC4A 4F7EB 3RAJH 3C5ZB 1UJ3B 1DFBH 4IMLB 3MFFA 5DJXA 5D5MB 3QPXH 1OPGH 1H3WM 3BH8A 3TN0C 2P48B 4PRHD 2GTZB 1SEBA 3OX8B 1N3NB 5MENA 1RY7B 3BDXA 1UADC 3CIQA 3VWKA 2HLAA 1F00I 5IHLB 1FLRH 3TNMA 2BXYA 1UM5L 4JE4B 1XMWA 2Y4SA 3CVIH 4WIQA 4JHBA 3IKCA 4F7CB 3GUTA 5F21B 2W65A 4Z7OF 1AJ7L 3VDCA 5E2WH 3RVWD 3QJFB 4HWBH 1MCWM 1M6OA 3T2OA 25C8L 3PV6A 1QYGH 2W9EH 3KYKH 4OD1H 3DVNB 4NQXB 4CW1A 2HTLD 4MD4A 3MJ9A 5TE7L 4FZEL 4DVRH 3G5XA 3HC3H 4F58H 1QUNA 3T8XA 2C3VA 1WICA 4JAMB 4NOBA 1S7VB 1EXUA 2ATKB 3I84A 2YZ8A 3W5NA 4GKNB 3HKFA 4J8RB 4NBXB 4WHTA 4FQXC 5I1LB 4A6YH 1L7TL 4TRPL 3T0XA 1CR9L 4KXZH 4OQTL 3KYMA 1FBIH 5T1DL 2YSSA 5DQDL 4QT5A 1JWMA 3MRRB 3CD4A 1OWWA 1I7TA 5IBUB 4U7KA 1L0QA 1ETZA 5F1IB 5C6TL 4GKZB 4CN4A 1GGCL 5DZOA 2ARJB 3Q48A 5TFSH 3IDXL 1DSFL 5GRYA 1KTDB 5JHDD 3CDGA 1IAMA 4O00A 4MZ2A 1I3GL 5DVNA 2BJMH 2OR9H 1SHMA 3JVGA 5DURD 1JGUL 5L7XL 3QPQD 1BQHG 2WIIA 3EJYD 4Z7WB 5C9KA 2VDLL 3BJ91 1BEYH 4PJDE 3SO3C 3DUHA 4WI9A 5CBAA 1PQZB 1I1AD 1S7QB 4PG2A 5JHDA 1MOEA 3WUZA 2G9HB 4TSCH 2OR8A 5T1KD 3LKPA 3RPKA 3A6CH 4LSPL 2R2CA 3LKNB 2VH5H 4LCWA 2ED7A 5L9DL 2OL3B 5DJAA 4YFEA 4D0CA 4G6KL 5J12C 4HUNB 3MV8B 3NH7L 5L88L 2JE8A 1P7HL 2YPKB 3BZEB 1SEQH 2Q7NA 4HPYL 1FVDB 2W0FB 3TBYB 4O51B 4NC2B 4JCLA 5HDOA 3BQUA 3BW9B 4PLJC 1CF8H 4F9LC 2NXZC 4HCRA 4UNTA 5GGSB 3CJJA 3UEZA 5HHQA 3KLHD 3MRPA 4OF3A 2O93L 4YHIB 1HILB 3P3YA 2OSLB 2Y5TB 3EZJB 4HKBB 1HKFA 3ARFA 1TMCB 4CVZA 1X5ZA 1BOYA 3X13A 4PRIE 2PTUA 4OV5A 1MCCA 3JVGC 3RWJA 4N8VA 5C09E 4NO2A 5BRZB 4PV8B 1LO3L 5GS2D 4LPCA 1QEWB 3DROB 3QDJD 3FZUD 3MLYL 1S7TB 4E41E 1NGQL 2BVPB 1Q9KA 3ULSA 5BVPL 3SE3A 3ZDYF 4C55A 3O45B 5BV7L 1R3KB 4ZS6C 3TYGH 4BK5A 1MQKL 5L0QB 3DX8A 3QXWA 4F2MA 4OUOA 4M7ZC 4LFHD 2ITCA 2MTPA 3IT8D 3NZ8B 3GI8H 5SX4H 3VXOB 4NO5A 4PB0L 4GW5B 2ZSVB 4MJID 2NY2D 4PY7A 1ADQL 4X8JB 5CJ8A 5C0FB 3VFVA 4WTZG 1FFRA 1G7JB 1XIWD 1K8DB 3BQUC 4EI5D 3CDFA 5DLMH 1BZ9B 4OGYH 4YHPB 1I1FB 1DQLH 2AW2A 1BX2A 3BXNB 4OBSA 5KJRH 1LO5B 3VXUB 3MV9D 2AJVL 4QOKE 2JELL 1SMAA 2LU3A 1NKRA 2VITB 5HYJA 4CNIB 5HXMA 1EH9A 1HOCB 1OGAA 3ARFC 1DN2A 2H2SD 4ONGH 3GMPB 3QEUB 3ARGA 1MI5D 4OD3H 43C9B 4EI5A 4Y88A 4JZJB 3N9GH 2D9CA 4UV4L 5TFSL 4M6ML 2A1WL 4DN3L 5CGYC 3M8OH 3PIQA 3CXHJ 3U0TB 2ARJQ 1EAPA 2VB5A 5H37G 3SE3C 1G7PA 3FKUS 4HJJH 1GGYA 4KK6C 3TA3B 3DO3A 4BKLB 3IGAB 1MFAH 2OTWB 1BECA 3VFWB 1MI5A 2MKWA 4ZSOE 1IC1A 3C60D 3O2WH 3QI9A 3T2NH 4G9DA 4X7TB 3T0ED 2H41A 2ILLA 4TQEH 5GRJL 4G7VL 3SN6N 5CINH 4QHKJ 1G7LA 2EYSB 1E4XH 4PJDB 3C60A 3U0WH 2VLJE 1YDPB 1JPST 3GSVB 4H26A 1I9JH 2K7QA 3U46A 4ERSH 3O4OB 5B38G 2Z91B 2NW2B 4TULH 4R7NB 5FYKU 2X10A 2VXTL 1FAIH 3OAZK 1CE6A 2XZQH 2V5MA 4XMKL 4MXVF 1JHTB 1MHHB 2DD8H 4NQEA 4DN4H 5BQ7B 5KS9E 5IGXH 4HG4J 4YK4C 4OFKA 4UINL 4G8GE 4LGRB 3O4LE 3VD7A 1TZHB 1XGTB 2ID5A 5K59E 3NGBB 4S1SL 2BOBB 3BUYA 1WTLA 4PG9B 5E94A 1INDH 3IB4A 2XKUA 3GO1L 4MWFB 4OB5H 3IDYB 3UZQA 2AJZB 3OHXB 4FNLL 4H1LH 2ZOLB 1DLHA 3GBNH 1FNAA 3LRSB 3B5HA 1ITCA 3GHEH 3BDBA 1U8NA 4LFHG 4X5LA 3V6ZB 5L2JB 1Q9OA 1A0QH 4L8SB 5DJDA 4KDTA 3JZ7A 3RWCA 3WN5A 3EW3B 3LHPL 4XNXL 4DTGH 3BPCA 5SWSB 2PXYA 4QKXB 2X44D 1KC5L 1QLFA 2P5EA 4E41B 1WITA 4GRWE 3BAEL 1F45A 4ZYKB 1CYGA 2P7TB 1N5AA 3PNWB 4OD2A 1KG0B 2A6DA 5EDXA 4ODUA 5CZXD 4U1GB 3UJJH 3I2CL 4AENA 4ZOEA 3Q5YA 3V7MA 4I1NB 4F37K 1IEHA 1DQLL 1P7QB 5KJRL 5AYQA 1A9BB 3EYUL 5I71B 1BD2D 2WBJD 3U6RA 4G9FB 4H88L 4ONGL 2EXWC 1NC2D 1OSZB 2UZXB 3S35L 2DLEA 4C83A 3MRNA 3QRFM 4PUBH 4XVUC 3ZT5A 3TO4C 3LD8B 2VNCA 4JFPB 1OB1A 4QOKB 5C0DA 3N9GL 3BH9B 3CFJA 3DTXB 2J3SA 2YRPA 1BD2A 2IFFL 2WBJA 3F6IA 4RZCB 1A5FL 3U7YL 5EIIB 4C56D 4XCYA 3RWFA 3CLFH 1FORL 1MCOL 4MAYC 1U8PA 2EZ0C 3UTTE 3VMOA 3AS2A 4KDTC 1B2WH 4K23L 1KPVA 2PXYC 3CVHH 2X1OA 3QSKB 1CFVH 1H3VA 2VERN 4QHMA 4WCYH 3OKDB 1T1WB 4O4YL 1A4JB 3VFOA 3MUHL 3WXVL 2WSKA 2FO4A 2CIKB 1Q0YL 4WEBH 3MRBB 3G6DH 2CSPA 1CE1L 5T1MB 4ZSOB 3ELAT 4LLYA 2VISA 3C6SB 3KAAA 5EUOA 1DL7H 3U0WL 5INCB 4LLWA 1Q0XH 3PDGA 4JY5L 5E7FA 3VFNB 2CKBB 2XI9A 1A7NH 5HHVH 5IOPA 2CO6B 3IDIB 2R69H 5MHSE 3MCKA 3MO1B 5DMKB 3ARSA 5CJQL 4D94A 3F7QA 4LLVB 4JO4L 1DQML 2YOCA 4YWGL 1OOAA 1FAIL 2VLJB 1U8HA 1F11B 3TIDB 5DA4A 2M1KA 4LAJH 1T22A 1IEBA 2BVQB 2DD8L 5FK9B 3DYOA 4OI9A 5KBNC 3L5HA 3D85B 1MCQA 4P5KA 1CLOL 5DMGD 2CUMA 3Q5OA 1RI8A 2PW2A 3SCMC 5IBTH 4AH2A 4LSSL 1PZ5B 2QQNL 3PHQA 5FCUH 4NQCB 1QFWI 2H9GB 5KZCB 4GH7B 1INDL 4TTDC 4P23A 2AXGB 4OB5L 5FYJU 2C7UB 1OP9A 2G60L 1JNHA 3QG6A 4YR6A 4G8GB 5FA4A 1SM3L 3O4LB 3GBNL 1OLLA 4J3XA 1HK6A 4ZPTB 3C9NB 2RAMA 4N1CA 3ZDZF 3PHOA 4ZS7H 1OP3H 2BHUA 3IFOA 5GISL 4EUPB 1JZ8A 4DZBA 4HQQL 3O9WB 1E6OH 3ARWA 1WSST 1A7OL 4KRPB 1U95B 5BJTA 1F3DH 1BWMA 3UJJL 4BQCA 2NY4B 3CUPB 3K1DA 1HSAA 2VDOL 3AREB 1T7ZA 4FQLH 4PJ8A 3B8SA 4N0YH 4G5ZL 2JF1A 5IVZB 3QNXB 3DVGA 3K80A 2V6HA 1BQSA 4MNQB 4MDJA 1IM9A 3TBVA 3KPSE 4I18A 2DM3A 3MACH 2NY7L 5AZ2H 1TQCB 1F3RB 2AJ3B 4JZOB 2BVEA 1MFCL 1W72H 4P23C 1JYNA 2XFXB 3C08H 4BQ6A 3RUGB 5CBEA 3ZT7A 3GJEB 5I16B 1HYSC 3MCLH 5H94A 4I48A 3TIEA 3WLBB 1EEZA 4P4RB 4GS7B 1KSRA 1T1YA 4WW1A 1KACB 1B2WL 1KLGA 3MLXH 4P3CH 3HRZA 2FJGA 3FB5A 4XBPB 1KTLB 2F5AH 1ZHLB 5LG1A 3UTTB 5DJ0B 4M6NL 4M7JL 4NHCH 1A6WL 2FYYB 3QUZA 4ZUUA 1MPAH 2VLLB 2H32A 4PLNC 2PNDA 2VSDA 4JPVL 1UM4H 3HPLA 4QY8B 3STLA 1FYTE 3SGJA 3BPOC 1XCTB 2X4TA 3JXAA 2FLBT 4PJ8C 1Q0XL 2FIKB 3I75B 4G42B 5D7LB 3VXSD 4Z7UE 4U1LA 4L4VD 5IEHB 2PO6C 3MRMB 1N2RA 3RWIA 3HMWH 2LTQB 1HSBB 4X6DF 4OAWB 1RZJC 5D1ZC 2I25N 3ZDXE 4U33A 5DMJB 1PD6A 1GPOH 3MLRH 4ZNEA 2HT3D 2WINB 3BHBB 5GHWL 3VWJC 5I8OH 1I8IB 2UZIL 1DN0B 4BM7A 1AFVL 5FO8B 1ERNA 1FNSH 1CICA 4I3RL 1BVKB 4LHUD 2DDQL 4WTXA 5LGHL 1I4FA 1NL0H 3RIAF 5ICYA 3G5ZB 4YE4H 2V9QA 4NT6B 5IFHH 1JPTH 4OFVA 4ELMF 3AM8A 3VI4E 2QQLL 4I0PC 3WJJA 3O2DA 3FOLA 3OXRA 4XNMB 3IAPA 1RJCA 3GM8A 4FQ2H 1X5GA 5D72H 5I1EH 3SDCC 5C0BB 1T83A 3HC0A 1CGTA 2GAZB 1H15A 5ELIA 3S6CA 4NO0D 4UOJA 4U6HA 3GIVA 4X99B 4JFHE 3OAZH 5C0RH 1B0RB 2Y06L 5F6IB 2VDML 2FL5A 2O5XH 3ARUA 5CGMA 4M1DL 3PDOA 4N0YL 1A22B 3FQNB 2R2BA 1UWGH 1WIUA 3VRLF 5DD0L 1GC1H 3GK8H 1NGWB 5IW1B 2LU7A 1UWEH 3S96A 1KIRA 4J4PC 2CLVA 2XWTB 4KUZH 3KYAA 4R0LA 1FFNB 5IT2H 3BPLB 1CICC 3IETA 2EE2A 1M7DB 3QO1B 1TITA 2X4OB 3HB3C 1GZPB 2OQJB 3UTQA 4Z7OE 3F6LA 3OGCB 4LRIA 4F33A 4YIQA 1GHFH 1DQQB 2QSCL 1E4JA 1T5WA 5IBLC 2XACC 3NABH 2LAAA 3RWDA 2AERT 4HPOH 5L2KD 1OTTD 3WJJC 4P2OB 2CUIA 1ZHKA 3L5JA 3MJ9L 5FYKH 4Y4KA 1QSEE 2R0KL 5IB1A 2DQIH 2P5WD 2F54B 5C9JA 4APQB 3TV3H 3FCTB 4K3HA 2CRYA 3BT2H 1JI1A 3DNKA 3VGFA 4XNUL 1Y6MR 3WS6A 4D3CH 2C3GA 5F89A 2Y6SC 2NYYD 4ODTH 4L4TD 4Z7VF 1IZKA 4L8CB 1VACB 4UV7H 4JDVA 2VKXA 1FYTB 1ZGLA 2R1XB 3IAQA 3IDJA 5KSAB 4CBPA 4X6CF 3VD9A 4P2QE 3LS4H 1QR1A 4CL7A 4Y5YC 1GPOL 3MLRL 4G8IA 5JOPD 3GSWB 1NEUA 1NCUA 4LRIC 2CDGA 4NKOB 4LHUG 1LMKA 4PRAA 4LVOB 4OCYH 1UKTA 3P0VH 2VZUA 3ARBD 4WU7A 1NL0L 5D7SL 5K9OA 4YDVA 4JFOB 3BPNC 3QHTC 4Y4KC 4XMLL 4NKMA 4RQQA 4LQ1A 5FGSA 1FIGL 5FM4A 5K9KA 3G6JA 4LPXA 4PRPD 1A7RH 5A2KH 4U1NA 2JJUA 1N0XL 1QOKA 3QUKA 5D9SB 2EDFA 4ESKA 1W8NA 3CH8A 5C2BH 1U3JA 2X4NA 4MA8H 2Q8BH 1BFTA 3LEYL 5F9OH 1U9KA 3MBED 1S7UB 4NCC1 4R4FH 1RUKH 1FGVL 3B4NA 2P8LB 3MXVL 2BK8A 1MY5A 4J7RA 2XY2A 4X5WA 3LPGA 2ICWB 4JG0L 3GB7A 3QDME 4LSTL 3WIFA 2W0KA 3KLDA 4RDQG 4FQHA 1N6VA 4J3VA 3WUWA 4H0GA 5ACMA 1BM3L 3NFNA 3TH4T 1RFDL 4HK3N 1BJMA 4FA8A 2OP4H 1UWGL 1HCFX 5J9PA 4EN3D 1JZ6A 5IQ9A 4HC1H 3OKMA 3R06A 4XXDA 4KUZL 3LRHA 5DD3L 4QXWA 1MIMH 2O5YH 2YD2A 5F1NB 4M93B 4CU8A 2O26U 1EFXD 4JY6A 4MQSB 1K4CB 4POYA 3HI5H 3LEXB 1FCGA 4MQ7A 4Y5VB 4PJAF 2VDRL 4KJPD 1RIHH 4F7PA 3NABL 2EDTA 3RZCC 3UJTL 1CFNB 1EGJH 1F6AA 3KPQB 2E7LA 1R5WB 1MIEH 3T77B 3HNVL 3DV6B 4X7CC 1WEJL 1JGVH 3G08A 4FQPA 2DQIL 4CMHB 5CHNB 1IGCH 1D5BB 4J3SA 5FOBA 5DJYA 2X1QA 3BO8A 3UP1A 4KK8D 2R29H 3EO1A 4FFYH 2NTSP 3LKSB 3O6KH 3D39D 4ZAKD 4B0MM 4CVXA 1A6TB 4RFEB 3TVMB 3O6FC 1CLYL 4OTXH 2FATL 1JK8B 3I50H 2BDNH 5FYJH 1FO0H 4UV7L 3PQYE 5DQJB 1IGJB 1RZGA 5AG9A 4OKDA 1RUMH 3PUCA 4JANB 2XRAL 3TBTA 1B88A 4ZAKA 1PSKH 1YEJH 2NY6C 3FT4A 5F97E 1YEFL 4BFIA 3CXHK 4JN1L 1FIEA 4H0HB 4YGVB 1HH9B 1UQSB 4WI8A 4M1CD 1PBYA 2R39A 3QULA 2ZNXA 4DEPC 1NUDA 3PWPD 4OCYL 3D25A 4P2QB 3P0VL 2NY1C 5INDB 2CJUL 2HG5A 5BS0A 5LGJB 5LAXA 5IJKA 3SKJL 1KYOJ 2D0GA 3L3IA 3QA3B 3CK0L 1NBYA 3QFDB 4BSWA 3LKOA 5KSBF 4RGOL 4HXBH 3L3GA 5HGHA 1WBXB 5C3TA 3HRPA 2YPVH 3PWPA 4BSJA 2SEBB 4QRUA 3FT2A 1JRHL 2Y07H 1FJ1B 4MA8L 5D96C 4OZFB 5E8PB 2HT4C 3U9PL 4X80L 5DUBA 5F9OL 4QRQB 1VADA 5DRZA 3BYYA 5TH2B 4NSKB 2Q7YA 4B41A 2N1KA 2H26B 1JF1B 2J6EH 2K7PA 1Z5LB 5KVEH 3CFKB 3QFJD 3CGTA 4Y2DD 5HYSA 3U4AA 2IPUG 1H3TA 1B6DA 3QUYB 3ZE2E 1II4E 4Y5XA 1KB5H 3BOVA 2OP4L 3WKNA 2VIRB 1AKJB 2DB8A 4NPYB 4NZRL 3RKDD 4XAWH 1WZ1H 3QDMB 5EU5A 5D8JH 1YUHB 3UBXA 1FZOB 3SJVD 1WAAA 1WJ3A 1MIML 2EDOA 3W0WD 5HHOE 3ULVE 5E9DD 1WISA 3NVQA 3F7PC 3WLWD 3WD5L 4Z5RB 2PW1B 3HI5L 4TVPH 4F15C 5FDWA 1KCUH 2VDNH 2VLRA 2DWEA 2R2EA 3WO4B 3T0AA 5AYUL 1YEEH 2IFGA 3H7BA 1UKQA 2RQ8A 5F9DC 3AS1A 2J2ZA 3KNBA 4NKDB 1KNOA 2VAAA 2A83A 1MAKA 2VZOA 4I3SL 5J1AA 1P5VA 5HYFA 5I18H 4ISVB 4Y89A 3FN3A 5E1AA 2X4RB 3PJSA 1ES0A 2PETA 5ITFA 3QO0B 1IZJA 2X41A 1CVRA 4OCSL 1LDPH 1RZ8B 4LP4A 5I66A 1YMMB 3BIBX 2XIDA 5GRZA 3M45A 2FEDD 3BP7B 5FYJL 5F1SA 4KRNA 3MV7D 1RZJH 1IKNA 5EO0B 3CLEL 1L4IA 1A9EB 1I7RA 3U36B 5ALBH 1KJ2A 4OKVA 3ZL4L 5JORA 4X6EA 1T4KB 5D2LA 3U2SA 1R3HB 3GMOA 1DUZB 4JO3H 4WFHE 3PQYB 5ERWB 2XICA 5ENWB 1YN7A 4NQDA 3INUL 3MV7A 4JKPH 5E4IA 5IB5B 4H1LG 4PR5B 1HZHH 5JUEH 2YUVA 4P4KA 2V5SA 3REVB 5HHPA 4RA3A 4RMSA 5L6YL 4NZTL 5EFIB 4MNHA 1MRDH 2IGFH 2QJDA 1KFAH 1KPRB 4NNXB 3VXQA 4KKLC 3OG6B 1T1XB 3RA7L 4Y16C 4LAQH 4MA3A 4XP4L 4XXCA 4M5YH 5JIKA 4WI3A 3AAZB 2GK0A 4QYOB 1FFQA 1IKNC 2XWJA 5DRNB 3KXFA 5JW5A 1D3CA 2MPAH 1J8HE 2VWEC 3QRGL 3LKQA 5HI3D 4ETYA 5DD6A 1KJ3H 2ADFH 4XHQA 7FABH 1XF4A 1P4BL 2Z31B 3BWAB 4ZUWA 5E0QA 4TNWF 5CP7B 1WZ1L 1GAFH 2R23B 3TNNB 3LIZH 1I1CA 4YHLL 1CDHA 3LQZA 3FO9B 3NFPB 4Y1AD 2QHRH 1RUAL 2QR0B 3ARPA 5DVLA 1FG2B 3MQIA 5JHLH 3DOSA 4EBQH 1RJZA 2DQFB 3ZTNL 3C5ZA 3OB0K 1UJ3A 4TVPL 4YX2H 3ZDZE 1E27B 1CVSC 5TQ2L 4DQOH 4XAKE 5F9AC 1A1OA 5C07B 2GTZA 1AGCB 4OI8A 3WFEL 3OX8A 1IAIL 1N3NA 1YNKL 4KZEL 2BSSA 5CZKA 3EJJX 3ISWA 4WRLA 2MJWA 3CMOL 1PX3A 3ZYZA 4L9LC 2FWOB 4YQXL 4WEUD 4F7CA 2QSQA 4Y19D 1YEDB 5EOTB 2P47B 3GBLA 1T89A 3QJFA 1HQRB 4OCNC 5E6IC 1LDPL 3QQ9D 3RI5F 5F7YC 5C0IA 4P57B 3DVNA 2LFGA 1UT9A 5HDQL 4G3YH 4RMUA 4JO1L 2ICCA 4JAMA 3HNSL 2FJFA 3CXDH 4PB9L 4WV1A 1S7VA 1YN6B 4MJ5B 4IDJL 2ATKA 4P2YA 1FNGB 1NSNL 1YYLL 2DWDB 1JHLL 5I1LA 1UXWB 2FB4L 5TGBB 4ONFL 3C5ZC 1UJ3C 3VRIB 3EBAA 2XT1B 2YD5A 2R0ZH 5TDNA 4HZAA 5EBWB 1QRKA 2W59A 4XX1E 4XVTL 4FZ8H 2IAMB 4ODSL 2ICES 5DK0A 3ESUF 2VSCA 2ADGB 1GL4B 4NNYA 1Q72H 3VRJB 3I02B 4TUKL 2NX5B 1MCEA 5DVMA 5DD5H 3KGRA 2YPLE 4BJLA 1V7NH 2XG5A 5CLTA 4Z0BH 5IQ7H 4Q2ZB 4XP5H 4Z7WA 4YHNA 2YD1A 3MGOB 5GJSH 2BNUB 4XTRC 3ZTJH 4ODHL 4P5TB 1PQZA 1S7QA 2ESVE 4HWEH 3DETD 2G9HA 4BQBA 4TUOB 1QLEL 5I30H 1IC4H 4RRPA 4QHNA 3LKNA 5EPMB 1CL7L 1EA9C 2OL3A 4HFWB 1RUQL 1X4ZA 4WY7L 1KJ3L 2ADFL 4G6FB 3MV8A 4HKJB 4K94L 5LCVH 1TJHL 4MQTB 1QNZH 2YPKA 3BZEA 1XH3A 1FVDA 4P2RD 1RHFA 3PE9A 2W0FA 1JNNL 4O51A 5FM5M 1GAFL 1J8HB 3T0DA 3LIZL 4N9GA 3BW9A 1F4XL 4GG6E 4W6YB 4QXTB 3Q1SL 5GGSA 4V1DB 4PBVC 1YECL 1QBLH 1YC8A 3UYPA 4YHIA 3IYLW 1HILA 3K0WA 3GJFA 4IRZL 1CBVL 2OSLA 3BEWB 2Y5TA 4HKBA 2C26A 1BIHA 1QSFD 1XGQB 4L29B 2DQDH 1X5LA 3QH3A 1M4KA 3LY6A 1U8LB 1EO8L 2HJFB 3QEHB 3PWNB 5BRZA 3OR6B 4PV8A 3MLTB 4KVCL 1E0OB 1QEWA 3DROA 4JO2L 4GW4A 3Q0HA 5IVNA 4R9HA 1S7TA 2R56H 2BVPA 4KJYA 1YQVH 4KKNA 2DYPB 4R97B 4IIQA 5DQ9B 2NZIA 1R3KA 3HLAB 4JZNB 4Q7DA 4KQ3H 4JFFB 4JJ5A 1H0DB 5EU6E 2V5YA 3NZ8A 3WHXB 1V8HA 3KPMB 4GW5A 4XVSH 1YQ2A 3G04A 3R8BB 2ZSVA 2CRIA 5EIQA 1KTKE 1ZT1B 3IDMB 5C0FA 4X8JA 3QUMH 4PJCE 1G7JA 3DARA 1AY1L 1K8DA 5T3ZL 4L3AA 5C0EB 1XCQB 3HC4L 1BZ9A 4DGVL 1KXQE 2IPKA 3BXNA 1LO5A 4IOIB 4UUJB 2X5PA 5EUOF 3B5TA 4BH7B 2W60A 4NGHH 5LBSL 2G5RA 4CNIA 1HOCA 1A14H 3B9KD 5ADPL 4XP6L 4DGIL 3GMPA 1A47A 1H3UA 2EC9U 4FQJH 5GS0C 1K6QH 43C9A 4BQ9A 4RWHA 3RL1B 1CIUA 2ITDA 3FB7B 5KW9H 4PGDA 2FRGP 2FH6A 3S5LG 3P4MB 2WLYA 5IMOB 3S4SG 1G1YA 1W0VB 2R8SH 3AFLA 4KTDL 2IQ9L 4OLUH 3D2UD 1BVLA 4Z0BL 1IARB 2MHAB 4LU5H 3TA3A 4BKLA 1DVFB 3IGAA 3GRWA 5HY9B 3E6FB 3VFWA 1QP1A 3D9AL 4Z7VE 4XP5L 5L0QC 5GJSL 1CDGA 1K9TA 3RP1A 5D6DC 5ALCH 1IQWL 2OMBA 4IMKC 4WUUE 4Z0XA 4MCYB 1XGYL 1OAKL 4P99A 4AEEA 4MXWH 4Z6AT 4OGAC 1IC4L 5F7FA 5JLZB 2EYSA 4ODVH 4PJDA 4PLOB 1EK3A 1BPVA 4ZO7A 1A7PL 4XNYH 4ZOBA 4ZTOH 1P5UA 1NH6A 4X6DB 5J8OA 1OARL 2EXWD 4PS4H 3WFHB 1MWAH 2Z91A 1C12B 1S5IH 2Y23A 1KBGH 2ICWJ 3OJVC 1XFPA 2NY0C 2DM4A 1WIOA 5IMLB 4Q9RL 1QBLL 1FL6B 2NY3D 3QEQE 4JZJC 3VW3L 1MHHA 1KGCE 2HRLA 5HDBF 4RFOL 3X3GH 1DBBH 1SJVA 1XEDA 5BQ7A 4HH9B 3H0TB 4XP1L 4PRID 4PRNB 2P42B 1NEZG 1XGTA 3QHFL 4HW6A 5HGBA 5C09D 2EZ0D 5EOQL 1FRGH 4OIIL 2BOBA 3TP4A 3ROLB 2ZG1A 5EZIH 5EOCL 1LO0L 4KU1A 4PG9A 4ELMB 3RGVD 4HBCL 2ATPB 1NUGA 4MWFA 1FC2D 2AJZA 1DBKH 2WQRA 3OHXA 2OZ4A 2EDQA 3KPRD 1AHWB 3W81A 5I1JH 2ZOLA 5IMMB 1S9YB 4S0SD 3LRSA 1AE6H 1YQVL 3IU3A 3DBXB 4X4XB 2HWZL 3CX2A 3V6ZA 1QSVA 5C09A 2HLFC 3UAJC 4QGYA 4ZUTB 5CKGA 5DMYA 2Q76A 1D9KB 4KQ3L 4LPTA 2B20A 5E08H 3MMEB 4E41A 4F57H 4IRSB 4YXKH 4ZYKA 4ZOAA 4YDKH 2P7TA 3O4OC 3PNWA 4CUCA 5D93B 1KG0A 2W0PA 5I1IL 4GXVH 3AXLB 4PTUB 3QUML 4FXKB 3QZWB 4MAUL 4XPFH 3R1GL 5DK2B 1P4LB 4UDUA 1U8JB 2DJ4A 2EDXA 5EU6B 2V2XB 2GJZB 3K8LA 4LIQL 5BMFL 5GGRB 3FRPA 3OB0H 2VDKL 4XHJC 1A9BA 2HFGL 2F74A 4WHDA 4FFVD 3K2UL 3SCMD 1OSZA 4KHXH 3NGBC 2JCCF 4NQVA 1MREL 1U6AH 5FGBA 3RU8L 1FO0A 4HIIB 4S1RL 4JFPA 1K4DA 4QOKA 2DKUA 1OAUH 3BH9A 3V4UH 4ZFFB 3H3KA 1U8IA 4LDOB 2X7LB 4PJ7F 3DTXA 3BGFB 1OAQH 5DI8B 2HAZA 5EIIA 3P0YL 5IFAH 1LGVA 5AZEH 2R4RL 2XZAL 4L8SC 3I3BA 5SWZB 3RY6A 3FQUA 3QIBB 1GGTA 4HFUL 5DTFB 3U1SH 1NLDL 1T1WA 1A4JA 2BVOB 4M48L 3UTSB 3MA9H 2HP4A 2Q87A 3S37L 3H3BC 3MRBA 4HZLB 1I9IL 3EOAB 5T1MA 4U1GC 4ZSOA 4BA8A 3N0PB 4GFTB 2KBGA 4Z7VB 3C6SA 1MRFH 3MX0A 2CK0L 4G43B 5E8EB 3IXTB 4QTHA 5K9JH 2C4FT 3O3BB 5INCA 2MSPA 4WUUB 1FN4B 2X1PA 3VFNA 1MJJA 2CKBA 4X6CB 3DUUA 5GRVK 5I71C 1ZT7B 2BNRB 1I8KB 3IDIA 5DHYB 5DMKA 1D5XA 4NFCA 4EEEA 1MWAL 4LLVA 2CRZA 4HUWA 3UPRB 2L0DA 1NGZA 3F7RA 2VLJA 3HPJB 5FGBC 5TE4H 1F11A 3TIDA 5KSBE 3LD8C 1KYOK 5CUSL 4JFXB 2BVQA 2IQAA 3X3GL 4HIJB 5FF6A 3MODH 1VHPA 4LPYA 5BO1L 5A2IH 1KCRH 3D85A 3O6LL 5JZ7C 3MJ6A 1HYSD 3U4EA 3RDTB 1P9MC 1PZ5A 2PTVA 2E6QA 2BFVL 2D7TL 1JWSB 4QCIB 2EC8A 4YZFE 5KS9A 1S7RB 5C2UB 1DBKL 5GZOC 5DD1L 3RVXC 4G8GA 1JZ7A 5B3NA 3O4LA 3A67H 3FFCE 3IFLL 2B1HL 4HDIB 3O81A 2R9HD 2QSTA 2C5DC 4M7LH 4PRHE 2OK0L 3V0VB 4RDQF 3HAEH 5CMAA 1IGMH 1AR1D 5E8DL 4MX7B 3V7AG 1U8QB 5E08L 3P77B 4RWYH 4TVSa 3O9WA 1UZ6F 4YXKL 4OLYL 1J8KA 4KXZI 1E4WL 1Q1JL 3I6GB 4KV5E 3LH2L 5EH1A 3KJ6H 5F70A 2VABA 3L3DB 4HXAH 2GUOB 2W9DH 5GS1B 4HSQA 4YFDB 5DGQA 5D1ZD 5DO2C 1EVUA 5GRUH 4ODWB 3QNXA 1WGOA 1AQKL 4ONHB 3ULVH 1NCWH 1HEZB 1NAMB 4QRRD 1TTUA 3OKKB 1QO3B 3WIHA 4QRSB 4RMVA 4JZOA 1AGEA 4KKAC 3B9DA 1DEDA 2XFXA 1WVZA 1ACYL 4UAOC 5BCAA 5SWQA 2ZZUT 4O58L 1ORSA 3HZYA 3GJEA 3F5WB 3WLBA 1JPFA 2EEDA 3X14B 4NM4L 4EVNB 3OZ9L 1QFUH 3GSUB 5JIPA 4DK6A 3WDHA 2QV2A 4GT7A 1BFVL 1X44A 3U1SL 1KPUA 4XBPA 3SDCD 3D69B 3O9WC 5TPWH 2G5BB 1CQKA 1ZHLA 4KRPC 3HUJF 4P9MH 3ZSSA 5FHBH 3UTTA 5DJ0A 2F15A 2LVCA 2FYYA 5F7LB 3UJIL 5JDJA 3X11B 5AWNH 1KJ2L 4LLQB 2NY4C 2XN9B 2H6PA 3HMXA 4QY8A 4JR9H 3AREC 2GCYB 3D3VB 4OM0H 2WLZA 3MLUL 2FIKA 2JJSC 3I75A 4G42A 1G6RB 5D2NC 5MHSD 3IU4H 4GQPH 3G5VA 2DKMA 4JKWA 4DKDC 1VFBB 4W4OA 1N6QL 3F58H 4UNUA 3MRMA 4J4PD 3V5DB 2UUDH 1EUUA 3LZFL 5C0CB 5IMKA 3CZFA 1MFBH 1HSBA 1S78C 1W0WB 1TQCC 3W9DB 4OAWA 3WIIL 3HB3D 1NPUA 1BQHB 4ZDHB 5CJOL 3NACH 4R2GC 3GDBA 3BHBA 3TPUB 4YXLL 1MSPA 3W11D 4HWZA 4GS7C 4WDIA 4WO4B 5KVFH 5KSBB 1DN0A 4JFDE 5FO8A 4Y4FD 4NN5C 4OLWL 3QCTH 2BC4B 5GGTA 3V4VH 4JGUA 3V5KB 5BOPA 4K9EC 1YZZA 1Q9WA 3MOQA 4LCYB 4NT6A 2RCSH 4P9HC 3GKWH 3MROB 2YK1L 5IUSA 5MENB 3VWKB 2HLAB 1J1OL 4CDHA 4AEHL 1IFHL 1XF5A 1VDGA 3TNMB 4Y4FA 4XNMA 4TNVK 3QXAB 5C7XH 3TH3T 3NIDE 3H9HA 2GAZA 3GSQB 4W4OC 1B6UA 3ZKMC 2DIJA 3GZKA 2E8YA 3C5SB 3UDWA 1B0RA 1M6OB 2W9DL 2LTQC 4MS8C 3LPWA 1X9QA 4YLQT 4Z78B 1PDKA 2PR4L 2D7MA 3G5XB 1WV7T 3FFDB 1MAJA 4RFNB 3WFCH 2C3VB 3KPSD 3T1FB 2A6KA 5GS0H 3K7UA 2E9BA 3MXWH 5FKAB 2EEBA 1EXUB 4EI6A 2XWTA 1CCZA 4WVRA 1FFNA 2B4CH 4F9PC 5F7MC 4CVWA 5JR1L 2ED9A 3QO1A 2Z9TA 4S0TD 4P3DB 5CEZL 1ORQB 3KYMB 1GZPA 2OQJA 1GVIA 3OGCA 1JWMB 4IM8A 3LN5B 1CG9B 1J1PL 3AMLA 3KPSA 4GQ9L 3N85H 2ZWLT 1SBSL 5EBLB 4ORGB 3FB8B 3ULUL 3PHSA 3H3PL 4P2OA 3TEUA 5FFLA 1E4XI 3C87A 4NC1E 3CDGB 4RCAA 1I3UA 4TYUA 1G7QB 4YFLF 3HZMA 4ALAH 5KG9B 3WO3B 4XBGB 4OJFH 4N90D 3TJEL 2IMNA 5GGSY 5FHBL 4YFLI 3R0NA 4APQA 3FCTA 4GAGH 1V05A 5DUMH 1CXLA 2GJ6D 5MI0B 1XF2B 4S1QL 1REIA 3WCYA 3REWA 3HZKB 5JHDB 2E3VA 3T3ME 5MP6L 4L8CA 1VACA 2Q20A 3BZFA 5DURB 1ZHNB 5EZOL 1BZ7B 1FYTA 2YEZA 4D0CB 5KSAA 1SYSA 5CJ5A 2VC2L 3CFDB 4Z7UA 3M1BB 4UTAL 2W91A 1BJ8A 3GHBH 4OFYD 1I1AB 3WHE1 5I8CB 1Y18B 3GSWA 1NCAL 4LSVH 4XI5C 4UIKH 5T1KB 3TM6A 1RMFH 2WK2A 4NKOA 1Q9LB 5TQ0H 5TE6L 3WJLA 4K3JH 1IGIH 1OF2B 5HHQB 4HAFA 3MRPB 2UWEF 4P2OC 5F8QC 2EDBA 4OLEA 3GMMB 3RVVC 1SY6A 4JFOA 4CVZB 1BJ1J 2CRMA 5JW4Q 5EZLA 2DBLH 3SDYL 1IC5L 5D1QD 3U4BH 4N8VB 2OL3L 2L4OA 5I1HL 3T04D 4NO2B 3PABA 5B38B 1YEIH 1HIML 2D3VA 2ZJSH 4K3EL 3QAZB 4PGEA 2ZUVA 4I0KA 2NXYD 1NFDE 4QXGH 4M4RA 3QIWD 1BWWA 3IXAB 1S7UA 3FOMB 4R7DA 4UQ2A 5D1QA 5FGCE 1BGXL 5KVMC 4OCWH 4F2MB 2PKDA 1J0JA 2FX7L 2ICWA 3EYQD 3QDJB 3PL6D 1H3PH 3MRJA 5JW4N 5KSAC 1NFKA 4CRPA 1X5YA 4X7SH 1U3ZA 4NO5B 5DHVB 3ZT6A 3I85A 4JM2D 1FDLL 4N8PA 1LDSA 5DR5H 5IVXF 3MXWL 4BH8A 4QNPF 3L5WA 3WJLC 4LVOC 4GRLD 2H1PL 1U3HD 3MA7A 1ACZA 5F1NA 4CADA 4QXUL 5TF0A 4MJIB 4B53A 1K4CA 1SVZA 3MOAL 5C0AE 3EDJA 3LEXA 3AU1B 5D2LF 4EI5B 5E2TH 4KGJA 3ORJA 1SJXA 2HH0L 2N4IA 2ZPKL 2YUZA 4PJIF 4YO0A 4IRJA 1FCCA 4GRLA 3MV9B 1QSED 3PIQB 3KPQA 4G6ML 1L9NA 2HT4D 3ZTJG 4BFGA 4ALAL 2VKWA 5LWYH 1G7PB 2D7QA 2CLRA 2PYFB 1JUFB 4XGZB 4L3EE 5CHNA 3UYOD 4C56E 1MI5B 3CU7A 3WDJA 4NWTL 3QI9B 3SDDC 3HE7D 2J5LC 4OQ1A 4R26H 1MJ8H 1JZ3A 2VXQL 4O9HH 2E9JA 1MFEL 2E7MA 2FX9H 3U30B 1A6TA 4JPWH 4F7TB 4RFEA 3TVMA 1JK8A 4XPTH 4YHZL 1ZKAA 2V7NB 2X4SB 5ILTH 5DQJA 1T7XA 2XXCB 1HQ4B 3C60B 3KR3H 5T3XH 3HE7A 3T0EB 4JANA 5ANME 3U46B 3GSRA 4M93C 2XQYK 2LAGB 4V2BA 3SE9L 1JP5A 4YGVA 2WIMA 1UQSA 4JPIB 3TBSB 3GRWL 4YUEH 4Y5VC 3SY0B 1CE6B 4CVUA 5EORL 4P2QA 2D03H 4X0KB 1YY9D 4OIAA 5HYEA 4NQEB 3DHMA 2IPTH 2MOVA 5INDA 3S34L 4J2XA 5LGJA 2CR3A 4AT6A 4CJ0A 5LQBH 5FIEA 1A3RH 3QA3A 4OZHF 1KEML 2EIBA 2X1WL 4HS6B 1WBZB 2DBLL 1KLFA 4CMHC 1M05B 3MYZA 5E94B 1F2QA 3T3PF 1WBXA 4KK9C 2F58L 2SEBA 1TENA 3NAAL 5GRVL 1FJ1A 1C1EL 3P9MB 1RIUL 4PTTA 5LKNA 3JWDC 2RHEA 2X4PA 4HIXL 4F7MB 2EH8L 1CWVA 4QRQA 1U8NB 3RHWK 1Q9OB 5DJDB 1UEMA 3GSOA 5TH2A 3WN5B 4NSKA 1JF1A 2B8OT 4PJFE 3BPCB 3CFKA 4LEXH 32C2B 2QQKH 2VJXA 1QLFB 1JFQH 3QUYA 3WFBL 3E1F1 3PWVA 1N6UA 4MHHG 5DA0B 4OD2B 1I75A 2A6DB 4ODUB 1LK3H 3LS5H 5FGCB 2VIRA 1AKJA 4NPYA 4HKZB 1QKZH 3GM0A 3QDMA 4GBXC 1FZOA 1JPGB 4MD5B 2OZ4L 1EBPA 4YC2B 2P43B 3U6RB 1NDGB 2VN4A 1RZIB 4X8XA 4IS6B 2FD6H 5FV2A 4Z5RA 1VKXA 3MRNB 2PW1A 1P4IL 1OTUD 1BQLH 3FN0H 1YNTB 4YH6A 5E2TL 2DKSA 1EEYB 2FJHA 5C0DB 4EUPH 2YD8A 2XKNA 1Y6NR 3CFJB 2XTJC 1OTSD 1BD2B 2WBJB 1VGKA 1DBAH 5HD8D 3RWFB 4KKLD 2FX8H 4Y16D 1QBAA 3ILPA 4ISVA 3FB6A 1NMCC 1Z0NA 2X4RA 1KPVB 3TZVD 3C6LD 2BP3A 1D5MB 5AUMA 2AEQH 2D2OA 1MUJB 2GITB 3QUYC 3VFOB 3M17B 5E5UB 3QIUC 1RZ8A 4JPWL 2HJKB 3BP4A 2JCCE 5D7JD 4C56B 5F7DB 3OTTA 4OBRA 3B3IB 2MQ3A 3DX6B 4XPTL 2E7CA 3BP7A 4UT9L 5EUOB 3KYNA 3ES6A 4LVEA 3BRFA 3O6MH 1IJ9A 4ZQKA 4PJ7E 1FPTH 1A6UH 1A9EA 3U36A 1WFNA 4RGND 2EDYA 5CCKL 3NFSL 3VXSE 1D6VL 5FM8A 3VFTA 1T4KA 3QWQB 1R3HA 1DUZA 4L4VE 3PQYA 5ERWA 5HI4D 5KVDL 1WIPA 2DM7A 3B2VH 2NY5C 5FDYA 3W2DH 1T20B 3WO4C 1IEBB 3SKNA 2FGZA 1N8ZB 1AI1L 4JJHA 5IB5A 2JK5B 5GRXG 3TT3L 2OI9B 3VXMD 4PR5A 4H8WC 4NRZB 4UILH 4P9HH 4IOFD 5KTEL 1I8MA 5H2BA 2PW2B 3X3FL 1FZJA 1MNUL 5TDPA 5DGRA 3D5OF 2CGRH 1XGRB 4JFYA 3REVA 1UCBL 2DICA 5IHUL 3QG6B 5HYQA 2CKBL 3GSNH 2F8XC 2D4FA 1NMAH 3FN9A 5GJTL 1KPRA 1RUPH 2I9LB 4NNXA 1E4KA 3NCJL 1T1XA 4U6VH 3MV01 5CIPH 5E56A 5ITBH 3OXSA 2YD3A 2AXFB 2NR6D 3OKOB 3IFOB 4MSWA 5DRNA 4RAHA 4KY1H 4LSQH 2X40A 3AY4A 4X9HA 1JGLH 1WCBB 1XGUA 3LS5L 3BRDA 5CP7A 4XBEL 3TYFA 3VFGL 2PF6A 1ZLWK 2R23A 5HHOD 3ULVD 3TNNA 1H3XA 3MNVB 1QBMH 4S10A 4PJBE 3FO9A 3QEGH 5IG7B 5JOFA 1AO7E 4NJ9L 3PXJA 4AIXA 4LVNB 4Q6YA 1JNLH 1FG2A 1YEHL 3N50A 2GI7A 2DQFA 3TBVB 2AK1L 4LQFH 3TWCL 1KIUA 5BW7A 1W2KT 4JQIH 8CGTA 2ED8A 5IB3A 1LQSR 1KENL 1UZ6E 2OXGA 4XPBL 1G9NC 2R4SL 4U2YA 4NJAH 4KVNH 2ZP0T 1E4KC 4WW1B 2FWOA 2R2HA 1DTUA 3DWTA 4R6UA 3ZE0E 5L2KE 3HRZB 5EOTA 2VTFA 1P84J 3BD3A 4G7YH 4UT6H 5GGVL 2GFBB 2E7HA 3V52L 12E8H 1HQRA 3AY4C 1XF1A 4DGYL 4PGZA 4ZUUB 2P5WE 5DMIL 5I1CL 2H32B 2Z31C 3L7FB 4ZD3L 3BVNB 3WIHL 1MF2H 3MV11 2BXZA 3HPLB 5JMOC 3STLB 4JKKA 3T4AB 4JPKH 4L8DB 1HHGB 5ECJE 3U7WH 4MJ5A 3NOIA 4KQ4H 2YD6A 1EHLL 4U1LB 5TDOB 2JCCB 1G84A 5B4MC 5IESH 2DWDA 1FVEA 1UXWA 4JRYE 4L4TE 3RWIB 2YC1B 4W4NA 3VRIA 1Z3GH 3B2VL 1R24B 5BZDA 4YHKH 4PJ7B 2WBWB 5EBWA 1GGUA 4MA7H 4K9EL 3V6BR 4HUXB 3O3DB 2GYSA 3VXSB 3FMGH 3HUJE 4YHML 3OBAA 1FQ9C 1KEGH 1IGTA 4P9HL 2ADGA 4M02A 4MXQC 1OM3L 1OW0A 4D9QE 2OS7A 4NP4H 3I02A 2ZCHH 3JV6A 1MFDL 3HMXL 5ADOH 5MEQA 1YNLH 3HAEG 2DJSA 4GRMB 4LLAA 5ICYB 4Q2ZA 5EC1A 1MEXL 3MGOA 1A7BA 2Y36H 1C7TA 4FP8H 2DRUA 4X7DC 5LXGL 3AVEA 4P5TA 4PRPE 5ITBL 4OCRL 1MAML 2E27H 5E03A 3HI1B 3OXRB 4TUOA 4LHUB 2VQTA 5EPMA 3EOYG 1A2YB 3ABZA 2NCMA 3LEVL 4N0UE 4HKJA 4U6HB 4DKFH 4RGMB 3OGOE 1URLA 1NCTA 3MNWB 4UOW0 5F96H 1CTNA 2A9ML 3JTTB 5GGTL 1WC7B 1J8HA 1A6PA 3PDOB 1D5IL 4Z7QF 5GS0D 1LK2A 2YA1A 4LF3B 3GEWB 4QXTA 2IAMC 2IMMA 2R2BB 3EFFB 1VPOH 4NO0B 3S96B 4BZ1H 1ODAA 3MJ8B 1U8OA 4MGXA 3LV3A 3BEWA 4XAKD 4R0LB 2G75B 5FUOL 2KZWA 5KN5B 1RIVH 3I6KB 4XB7A 3IETB 5L8KB 4OCXL 4XVJL 5I1DB 3B9AA 2D0HA 3EYSL 1U8LA 4WI2A 5E6YA 2HJFA 4PGBB 2FBOJ 2GT9A 4F33B 3V6OE 1UYWH 3OR6A 4W6XB 3MGAA 2AGJH 1E6JL 1RV6X 5CJXA 1OLZA 2MCPL 4A6YB 4XC1L 2X6MA 1GIGH 3HG1D 4P5TC 4OLVH 2IC2A 4N0CD 1ZA6A 2VXUL 4OGAD 1ZHKB 2H3NB 4ZXBD 2WUBH 3SHSA 3UO1H 4Z7NF 2DYPA 2H45A 3BN9C 4B50A 5JA9A 1ZE3C 5DQ9A 5IK3A 5IB1B 3JV0A 3MRGB 3VXUD 3RX8A 1H0DA 4PY8J 1LO4H 3WHXA 5T5NG 4HULB 2LU4A 2AI0L 5L2KB 5FECB 4CU7A 1ZT1A 3IDMA 4KPHL 1M1SA 4JPKL 2WWMD 4EXKA 4U1MA 5BV7C 3BWUC 2HVJB 2NY0D 4JHAH 3ARXA 3D39E 1FE8H 1DQDH 4IOIA 2P5WB 3UYRH 4NCDA 4WU5B 3IS1X 1A7QH 4BH7A 2BMKB 1FAKT 1IL1A 1KIPB 3HS0B 4RX4A 2PYEE 4FQQA 2DL9A 4HEME 2XZCL 4OLXL 3O3EB 4MA7L 1QR1B 3DRTB 4WFFD 1EPFA 2WV3A 3RL1A 4GKOA 4N5ED 1IAOB 2BHZA 3FB7A 2F5BH 4L4TB 4Z8FL 5ESAA 5CJXC 3P4MA 5J13B 5D1XD 2YPLD 4FOMA 1RZKH 2AK4D 3MLVH 4LGSB 5IMOA 5BXFB 3BDYH 4K3DH 1W0VA 1YNLL 1YY8B 3Q2CA 3HUJB 4HJGB 2MHAA 3JWDH 3VMNA 1DVFA 3R4DA 5HY9A 3E6FA 4XPGL 1J0HA 4NKMB 4RQQB 1I1YA 4D9RD 5K9KB 4FFZH 2ESVD 4PLKC 3JUZA 1N59B 4XC3H 4U1NB 1Z2KA 2XZZA 2YPLA 4MCYA 5KS9F 4JGJA 3NCBB 1U92B 4NWUL 5FUZL 4LCCB 2X4NB 4POZC 1IM3B 3ARBB 5CD5C 5JLZA 2AEPL 1HE7A 4PJ9D 1E28B 4UU9A 1EHAA 3VG0L 4XHJD 1QFPA 4PRPB 4DKFL 2N7AA 2ESVA 3DLQR 4M62H 4BK4A 4X5WB 1LEIA 1HKLH 3WIFB 3WFHA 3QFJE 4FQHB 2BRRL 1C12A 5GIRA 3SGKA 15C8L 3NFNB 1ZMYA 4M6OH 5ESVA 4N0UB 1SY6L 5JA8B 1YYML 1MVUB 3K4ZA 3MBEB 3QCVH 4NKIL 2OYPA 3BGMB 5J9PB 1VPOL 5IQ9B 1LE9B 3OKMB 4PJGF 4O5LL 1JJUA 4HH9A 4XXDB 3H0TA 4GRWF 1WFOA 4PRNA 5GGQH 2CLZA 3ZZ1A 1L6ZA 4NRXA 4ZUSB 4GG6A 3VU2A 4OZGE 2J8OA 3SJVE 3ROLA 3WEXA 1N64L 1WWWX 1K5NB 4OZFH 5TF1H 3W0WE 4ELMA 5E9DE 4ETQA 4MQ7B 4X5XB 2ZUTA 4EN3B 1QBBA 1AHWA 4F7PB 2DQUL 5IMMA 2XG4A 4NN6C 3QNZA 4JFZH 5C70A 3DBXA 1ZTXH 1JCKA 3GMLB 1IBGH 4POUB 4YBQC 4KJWD 4ZUTA 2XQBL 2UY6A 1EFXB 4YNYA 5IVXE 1J5OH 4QNPE 3MMEA 1R3LB 3QNYA 2B2XL 4IRSA 4M43H 4PD4K 4EDWL 3BO8B 1TVDA 3KPLA 2I26N 1AXTH 4W6WB 4WUKH 2Z8WC 5T5FH 1YC7A 3AXLA 2VXSL 5KOVC 3QZWA 4CVXB 3SGKC 5EO1A 1RJYA 3AC0A 1U8JA 1NGXA 5EU6A 2V2XA 2GJZA 1T3FB 5T3XD 6FABL 3E6HB 5MEOB 3UYRL 2IJ0C 1RURL 4PJIE 2NY5H 5JZ7D 3GIZH 1ZHBA 4PJCA 2AEWA 1OAZL 2X1XR 1KV3A 4GG8A 3D39B 4ZAKB 1TIUA 3FT4B 1UA6H 1NC4D 3ETBF 2F5BL 1AGFB 3RNQB 3RVXD 4UB0L 3QULB 3ZKND 2ZKHL 2X7LA 3FO0H 3W9EB 2CQVA 2QLVB 5DI8A 3D25B 1FYHB 4HAGA 2BSED 2HG5B 5LAXB 4HGMA 1J18A 3JWDL 5DUPH 3FRUB 1NC4A 1L0YA 5HGAB 3LKOB 1I7UB 1D9KC 1J88A 1OP5K 4QRPE 5DTFA 5C8JB 3BKCH 5HGHB 4AEFA 4MA1B 4GO6B 5B3JE 4PBXA 3PWPB 3UTSA 5D93C 1MCDA 2UV3A 4QRUB 3MREB 5IROC 3MLSH 4KFZC 4Z7VA 1DBML 1MJUL 1VFMA 3OSKA 5DUBB 3IXTA 1A6VL 3VG9B 2AJYL 1VADB 3O3BA 3BIAX 5DRZB 4WUUA 1IEAB 3QDGD 4H1LB 5HVGB 1I8KA 1X4YA 3EHBD 2P4AB 2J88H 4HKXA 4Q0XL 3QISA 4L4JA 3B9EA 4HS8H 2A6JB 4OZHE 3UPRA 3QEQD 5ISZD 2EXYD 3DX7B 1B0WA 3HPJA 1AXSB 4JFXA 1TZGH 1H5BB 2UWEB 4HIJA 4P46D 2DLFL 4XCEB 3SE8L 5JXEA 3QFJB 4Y2DB 3Q6FB 3I3DA 1G9NH 2HKHL 2YRZA 3SE4A 4AL8L 5DZNA 3X12B 3IDUA 1JWSA 3QEQA 4Y1AE 3DSFH 3QIBC 5D71L 1S7RA 4FN0A 3KPPB 1ZLSL 2M8XA 2IBZY 4KRPD 5IR1A 4HDIA 4OUUA 4IDLA 3SQOH 3VFPA 3W0WB 5IW6B 3SGDH 2NTFB 5E9DB 3E8UL 1F4WL 2A83B 1A1MB 1IBGL 4MNGE 5J1AB 2APWA 1DCLA 1UM5H 3JTSB 4MX7A 1U8QA 1I3RA 3KYOB 5E1AB 3QXUA 1ES0B 1DQJA 1UM6L 2Q3ZA 4Y19E 3I6GA 1AXTL 3RTQC 4WUKL 5DS8A 3L3DA 5ETUA 5IVXB 2GUOA 3MRFA 25C8H 3HNTL 3TCXA 5GS1A 4M6AA 1QACA 3CVHB 3QUXD 1QG3A 5TE7H 4QLRA 4R2GD 1L9MA 3NIGE 5JXEC 4ONHA 2X9WA 3MRKB 1HEZA 4I4WB 2V7HB 1NAMA 3RDTC 4YEFA 1S9WA 4P48A 4KWUA 3S35X 3OKKA 3SE4C 4H8WL 2FECL 4OKVB 1OVZA 3THML 2A6IA 5D2LB 4QRSA 3U2SB 3DRQB 4PJIB 4TRPH 3T4YA 1CR9H 3AROA 1PYWB 3H9ZA 4OQTH 3AB0B 5T1DH 4NQDB 4Z7UF 3MV7B 5DQDH 4PJHF 4OFIA 1NGYB 1OAXL 2QSVA 3F5WA 3X14A 1CGXA 5B39G 5C6TH 3U79A 1GGCH 4ZODA 3GSUA 1FH5H 3IDXH 1DSFH 2ZNWA 5D7LD 1TZIB 3ZDXF 1I3GH 5HHPB 2P8MB 4RMWA 3GMRB 1JGUH 4MNHB 3OJDB 4LCWE 3X11A 3S88L 1QHOA 1PAMA 5GS1C 3CU1A 1RSFA 3FAWA 3VXQB 2GCYA 3PWJA 1F58H 4AEIL 4JG1L 2VLKD 2YD4A 4JB9L 1MELA 4AIZB 1P1ZB 2GK0B 3X17A 1MQ8A 4LSPH 6CGTA 2P44B 3M07A 5L9DH 3V5DA 1J9CT 2QKIA 3HE6D 1T0NA 3LKQB 4DKEL 4S1DD 1VEPA 3OF6A 4G6KH 3T2PA 3VI4F 2XA8L 4PP1C 1W0WA 2B5IC 3NH7H 5L88H 4U1SA 3LMJH 3ILQD 4ZDHA 1BQHA 4AIOA 5CP3H 3KHQA 2NZ9D 5FAAA 1NBQA 4P2RE 3LOWA 4EUPG 4M03A 2DM2A 4OZHB 1G9NL 4BYHA 4WO4A 5KSBA 3HE6A 2NW3B 4KJQC 4FFWC 4G80B 3V5KA 3FFCD 1KIQB 4LLUA 3HR6A 4R4BA 5JPMB 3LCYA 3IDNA 1A1OB 4LCYA 4PYGA 1QSFE 4JM2F 4NZJA 3SQOL 2EH7H 4PP2B 3MROA 4Y1AB 1X6NA 1LO3H 3MOBH 2BSSB 1C5BL 3MLZL 1KLUB 1OY3B 3DMMD 3MBXL 4JFQB 1I8LA 3QXAA 3MLYH 1NGQH 3FFCA 5BVPH 1C5CL 3BUTA 4MHHI 3GSQA 5FYKE 2WMPA 3S8WA 5BV7H 4PRHA 1MQKH 3C5SA 4QGTA 1AXIB 3DMMA 5C0IB 4IJ3B 4PB0H 4Z78A 4LASL 3LSOA 1RU9L 1ADQH 3FFDA 4Y19B 2ZUQC 2FJFB 3T1FA 4WV1B 5FKAA 1TJGL 2A77L 3VFUA 2CO7B 5D4QA 3HCVA 3OKNB 1BIIB 2AJVH 4ODXB 1JN6A 2JELH 3GFUA 1P6FA 2GTWA 5D7KD 4P3DA 3RVVD 1ORQA 4TUJA 4WI7A 4OIBA 5TDNB 3RVUC 4WTWA 4M1GH 1CG9A 3LN5A 3SDXF 2AJXL 1ZT4A 4HT1L 4DUVA 1UB5B 2DQJL 1V3MA 5F3HA 5DK0B 4GW1A 3PF2A 1KJVB 5EBLA 3VWKC 4ORGA 4UV4H 3FB8A 1FH5L 2DBJA 2A1WH 2FZ3B 4M6MH 4NNYB 4UDTB 4WTZA 4DN3H 3CFIC 1Q38A 4M8QB 1G7QA 1FSKC 5KG9A 4XBGA 4OZIF 1O0VA 1OT1A 4NZUL 5F88B 4GXUN 2HKFH 5MEPB 4YHNB 1YJDC 3S7GA 1DE4B 2VLMD 4XCFL 1UENA 4YXHL 3O3UN 3CSYB 3V0AC 1F58L 5GRJH 2R1YA 3EOTL 3O3AA 1XF2A 4EDXB 2FHBA 1CN4A 3HZKA 4NOFA 4UT7L 4WWKD 5DT1L 4G7VH 3OJ2C 2GK2A 5D70L 3NN8B 5DFVC 4RFNC 3S5LB 4QHNB 4U0RB 5B8CA 1ZHNA 3R0MA 1BZ7A 2Z92B 3LN4A 3S4SB 3WS3B 4M7ZB 2V17L 1F90L 1JGEB 1GGBH 3CFDA 4HLZH 4GMTL 5J11B 3LMJL 1XH3B 3M1BA 1CFTB 4H0IA 1I1AA 2HTLC 5I8CA 1Y18A 4LMQI 1NBZB 4WWKA 5T1LD 1OWRM 5T1KA 4N9GB 43CAB 4JFDD 2VXTH 3VXRE 5A43C 1Q9LA 1OF2A 4XMKH 1OP5H 3GJFB 1T66D 5CD3B 4NBZB 1LP9E 3GNML 3U82B 4UINH 3GMMA 4P2RB 3QH3B 4S1SH 2KH2B 1FL5B 4KDWA 3UBXI 2IALB 2CIIB 4JFDA 2EH7L 1F13A 5KAQG 2IBGA 5B38A 3SDDD 3MOBL 3GO1H 1DBJL 4FNLH 5EBMA 4GW4B 2YA2A 5MI0C 5F7EL 3KPRE 2IBBA 1UVQB 4PG2C 1QSFB 4Z7QE 4KJYB 3IXAA 4NQUA 3FOMA 5EN2B 4J3TA 1CZ8L 4IIQB 3GI9L 1X5FA 1S3KL 3LHPH 4XNXH 3QPQC 4Z95L 1KELL 2KZ1B 1KC5H 3EJYC 4HK0B 4JJ5B 4FQ1L 3QDJA 5TJWK 4F3FA 2HFFB 5KSVA 1MJ7L 3BAEH 5DHVA 3G04B 2VR4A 3ZSTA 1GYAA 3D18A 1I1AC 2ICEB 4HJ0C 4UBDD 2JB5L 2VN7A 5IJVA 3I2CH 3V7AE 1H9VA 4RISL 5CZVH 2IPKB 1F8TH 1N4XH 5FYJE 1XAUA 2CXKA 4HLJA 4D8PB 2W60B 3EYUH 2KQNA 2EDHA 2WM0A 4H88H 3IFNL 4Z7NE 4MJIA 5F1OB 2Q3AA 4K8RL 1ZVYA 3S35H 3BKML 4M1GL 2I9TA 3AU1A 1MCRA 1XIWA 3FHAA 1JTOA 2ITDB 3EJZC 3SKOA 4PGDB 5C3LD 1DANT 3KDMB 3KLHC 3QAZC 3MV9A 4BZ2L 1TNMA 1A1NA 2F9BT 1BLNB 1NMBH 2IFFH 1Z9MA 1A5FH 2C1OB 1RJLB 3U7YH 1FORH 2PYFA 1MCOH 1BVLB 3B9KB 1JUFA 4XGZA 3J7HA 4LSUL 2Y25A 1QD0A 4K23H 2HMID 2HKFL 2YR3A 4N9OB 2DTML 4Z0XB 3FZUC 4O4YH 2LQRA 4KAQL 3FQRA 3WXVH 1GXEA 4WW2F 4F7TA 2E7BA 1Q0YH 3E2HB 1CE1H 4B7IA 1PG7W 2V7NA 3T65B 2X4SA 4GBXD 5SV4A 1HQ4A 4KROD 1UH4A 4WI4A 3RPIB 4R96B 4JY5H 2CUHA 1C16B 5EOCJ 1GGBL 3T0EA 4Q9BA 3WL9B 5CJQH 2Z35B 1GGIL 2X09A 4JO4H 4JPIA 3TBSA 3QWRD 1DQMH 3ARGC 3PGFL 3PP3K 4YWGH 3ALPA 4EI5C 2ZCLL 4R8WL 1X3DA 3AMKA 3SY0A 3P9LB 3FTGA 4X0KA 1NGPL 1TETL 4BQ8A 2XTJD 2RB8A 2B39A 4AG4L 2Z4QB 4ZO9A 4YBHA 1J0YA 3ZE2F 1CLOH 3P9WB 5J57B 1EEQA 4PJ5D 1DZBA 2EKJA 1SVCP 1VENA 5HGBB 4HS6A 4KK5C 1WBZA 4LSSH 5GSVA 1G7MB 2QQNH 1M05A 2AKRB </