2D8KA

Solution structure of the first c2 domain of synaptotagmin vii
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
141
structure length
141
Chain Sequence
GSSGSSGSRENLGRIQFSVGYNFQESTLTVKIMKAQELPAKDFSGTSDPFVKIYLLPDKKHKLETKVKRKNLNPHWNETFLFEGFPYEKVVQRILYLQVLDYDRFSRNDPIGEVSIPLNKVDLTQMQTFWKDLKPSGPSSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Endocytosis/exocytosis
molecule keywords synaptotagmin VII
publication title Solution structure of the first C2 domain of synaptotagmin VII
rcsb
source organism Homo sapiens
total genus 14
structure length 141
sequence length 141
ec nomenclature
pdb deposition date 2005-12-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00168 C2 C2 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.150 Mainly Beta Sandwich Immunoglobulin-like C2 domain 2d8kA00
4Y1SA 3PS6A 3CSTA 4F91B 2A5UA 2CHXA 1DJIA 4EZLA 1A25A 2WXGA 2NSQA 3PFQA 2V4LA 2CJSA 4Y1TA 3FDWA 1DJGA 3GPEA 4GB9A 4URKA 4LDCA 1RLWA 4GNKB 4XX5A 4AOFA 1BYNA 1HE8A 3APFA 3F01A 3N5AA 3NZUA 4MJJA 4FA6A 2LHAA 2YRBA 4DNLA 1QASA 1W15A 4L1BA 4XZ4A 4BFRA 3F05A 3ENEA 4DK5A 1E8YA 1E8WA 2NQ3A 4F93B 5JHBA 5JHAA 2K8MA 3OAWA 3KWUA 4EZKA 3ML9A 3FBKA 3CSFA 3LJ3A 3QK0A 4PS7A 2ZKMX 3QARA 2ISDA 2WXFA 2Z0UA 4FHKA 4NPKA 3ZIMA 4WWNA 3IBEA 3L13A 5H4YA 4ANXA 4F1SA 2NCEA 2UZPA 4FJYA 3SD5A 1W16A 3PREA 2WXKA 5CCGE 4FLHA 4ANVA 3PRZA 3S2AA 1YRKA 2DMHA 3P2BA 5G2NA 3RDJA 3R7QA 4WEEA 4J6IA 1E8ZA 4QAMB 3NSJA 2ENQA 2WXHA 5CCJA 1DJWA 1V27A 1DJYA 2JQZA 1RSYA 2CHZA 4HVBA 1UGKA 3W56A 1K5WA 5G55A 2WXNA 2Y3AA 3ZVVA 1DJHA 1E7UA 1QATA 3F04A 3TL5A 4OVUA 3NZSA 3OHMB 3L16A 2R83A 4AJWA 3W57A 2B3RA 4TS6A 5EDSA 4FULA 2N1TE 3QJZA 4OVVA 1DJXA 3PYCA 4L2YA 2D8KA 5KJ7E 2Q3XA 2QZQA 2Q0ZX 4IQHA 3QR0A 4PS8A 3KWTA 4NS0A 3QR1A 1RH8A 4TV3A 2K4AA 4QJ3B 4ANUA 3QAQA 4IHBA 4NPJA 4LCVA 3M7FB 5H4ZA 1GMIA 3L17A 3T8MA 4NP9A 3HN8A 3APCA 4WWOA 1E90A 2WXMA 4JPSA 3L08A 2X38A 1DJZA 3MJWA 2FJUB 4QJ5B 4G11A 3TJPA 2FK9A 4KITB 4WAFA 4QJ4B 5CCHE 2CHDA 2WXIA 3TWYA 4HLEA 2EP6A 3L4CA 3ML8A 1BCIA 2WXQA 2K45A 2YOAA 4BGDA 1UOWA 2CJTA 4PS3A 3APDA 2WXOA 2RD0A 1UOVA 2CM6A 4ICWA 4EZJA 4KZ0A 4XE0A 1WFMA 3R7RA 3IM1A 4ANWA 2CM5A 3DPDA 3JZYA 3L54A 4LT7A 2ENJA 2WXRA 1TJXA 2ENPA 2BWQA 3HIZA 3DBSA 2KI6A 1DQVA 2WXPA 3HHMA 1DSYA 1TJMA 4ICXA 3L9BA 4A55A 2A4ZA 3B7YA 1CJYA 4FHJA 1E7VA 4L1LA 4WWPA 4TUUA 2WXLA 4L23A 2QZ5A 4V11A 2CHWA 4FADA 3F00A 2DMGA 4KZCA 4F92B 3ZW3A 3RPBA 4FJZA 1E8XA 2K3HA 5T8IA 2WXJA 1BDYA 1WFJA
chains in the Genus database with same CATH superfamily
3OLGA 3IWUA 1S5HB 3MQIA 3BDXA 4MNHA 4MNGE 4HPYH 2PYFB 1CXHA 5EF3A 3DO7A 4QRAA 1RV6X 5IFHL 4ODWA 5LJYH 4DPAX 1ULVA 3RAJH 4F9LA 1A1OB 5FYJH 2NLJB 4AYBA 3R19A 1CI3M 1B3IA 2CJUH 3E3QC 3KYKH 4RRPA 5A2KH 1FNGA 5CLXA 1PIFA 1A7OL 3L7EB 4JY6A 3BPCA 2V2XA 1FGVL 4P23D 2OMYA 4JFQA 4PRPE 1JK8B 3DX6A 1PJ9A 1P6AB 2FQEA 2O5YL 3HE7C 4LVOC 3T5WA 2FLBT 3CHSA 4HS8L 5E24E 4ZOCA 3H9SE 2A0LC 3WY2A 1QQDB 3PWVB 4GRWE 1TLMA 2YMXH 4N0UB 2R15A 4F27A 1EXHA 3JV4B 1E8ZA 5E08L 3LD8C 2NY1D 4BQ8A 5B8CA 3BESR 5T3ZL 2BERA 1PLCA 2OJEA 2WWNA 4HS6A 1EGJL 2UYLA 3B5HA 2DEYX 1YAZA 1RUAL 4KKNA 5ICYA 4YIQA 1ZT4B 3QJHA 1IEAB 1CF1A 4LIQH 3V0VB 1G9ML 2P5WD 2F58L 4M7JL 3VFMB 3H85A 4GUQA 3MRRB 3RTQA 4FJ6A 4CVWA 2FHCA 3CTTA 4XB7A 5DYFA 1N6QL 1BLIA 2ZCKL 4OFIA 3LN9A 3L1GA 2YQBA 1S7VA 4QYOA 3VXSE 3V4VH 4JG0H 2AV7B 3AG3B 3O0RH 2C3HA 4C54A 5DJZB 2FEEI 2R1XA 1MWAA 1XO8A 3H7BB 2C8NA 2IQ9H 3O6FD 1QSFE 3TA3A 3MRBA 3MV01 2N56A 5HTSA 2KDYA 1U8LB 1WCBA 1SQMA 3QZWG 4UT7H 1ONQA 5IQLA 3VMOA 2FBOJ 4YWGL 1EEZA 4EUPH 1OCCB 3KEDA 2BW4A 4PJGB 3RFZB 2P9RA 1IKNC 2XVBA 4YHPB 3ARBB 1YNKL 3T3MF 2GITA 1M57B 2MEJB 1TVHA 2EICA 2OZ4A 4FNRA 1RJLB 4E9XA 4U0RC 4AKQA 1FZKA 5GS0H 5D7LB 1P1ZB 3KWVA 1CYXA 4ABVA 4F33B 1SM3H 5JZ7D 2QLYA 3P0YH 3B7UX 3J07A 2G4GA 2J8UA 1R3KA 1XH0A 2N59A 3S34L 1CQYA 3VNYA 1KPRA 4PVLA 4PS4L 2WOYA 2BVOA 3LS5L 3G6DH 4G42B 4M03A 4ZUTB 2C4FT 2R2HA 3IFNH 2ZWYA 3CK0H 3FFCA 2PWGA 1F1AA 2FLMA 2V17L 1QYGH 1D3CA 2AXGB 2YOCA 1Y18B 3H9HA 3KHOA 4HJJL 4LGPB 3ZE2B 4Z78B 5DZVA 3QUHA 3L9RB 4YHNA 4PGBB 1F13A 1QKZL 1DUYB 2R29L 1LEIA 4TQEL 1FP5A 4OJYA 2YEZA 4M7ZB 3T0WA 4ES9A 3SDDA 3B3IA 3NCMA 2JKIS 2QR0A 1U4FA 5B3NA 3FPYA 4M5SA 2IAND 2VTFA 1V3LA 3RP1A 3SDXF 1U8PA 4P06A 1KWKA 1OEZW 3ZQXA 1DANT 1WFOA 3E38A 5AFAA 2VITA 3O3DA 1U91A 4X4MA 4BRVA 4QKXB 3QA3A 4BINA 4ZMOA 4UAHA 1A02N 3IDNA 4TVPE 1UZ8A 4PRBA 1VADA 3G08A 5SWQA 5I1LB 1SXSA 3IGUA 4IIQB 1USQA 5EU3A 2X4PB 3SO5A 4H13C 4HWZA 1C8QA 1CCZA 3VDBA 5HHNB 3FRUA 2NY2D 3P1VA 3TO4B 4Q6KA 4DGYL 5FGSA 5I1HL 4HK0A 4LVNC 1VFUA 2VDRL 1XBDA 3TBSB 4A39A 4JFUA 5ADPL 2B0SL 4GRMA 4XNMA 1YNTF 1AJ7L 1I82A 5DUMH 2LT9A 3D4YA 1OGSA 5HHMD 3WKPA 5CBAB 1RFDL 1N18A 1ZXQA 1C08B 3LRLA 4HC1A 2OMVB 4X4KA 5AW5B 2FIKB 3OKDA 5ADOL 2DPKA 4X98B 3SDAC 3CUPA 3QIUB 2GJ6D 3HR5A 1NCWL 2IV8A 4YE4H 3IDXL 4OZIF 2R0ZH 4KTEL 5L4JA 2J6WA 3HRZC 1WAAE 3MRIB 5DA0B 3Q9PA 4ESKA 3ZYOA 4KJWC 2DYSB 4QI3A 4QF1B 4XN7A 4W4OA 3TIDB 8CGTA 3LB6D 1OZUA 1TQVA 4LOUC 4A6YH 1HS6A 1P9MC 1QLRA 1BVZA 1GY2A 3MV7A 4U6HB 3ZBMA 4Q14A 1R3JB 5F7DB 3HB3B 3SGKA 4LL4A 3RZCB 2L0DA 3CVHB 4JGMA 4FFYL 4LSTL 4CN4A 3BHBA 1WISA 5LWYH 1AGEA 2OZ4H 3MA9L 5A6LA 2Y0SA 1UD2A 3KPQB 4KI5C 5JXEC 4L3CB 4YHZH 5F21B 1AMXA 3JZYA 4JDZA 1SBSH 1E42A 2VQ4A 1UQSA 1VF5C 1YQVL 3WIIH 5HVFB 1V7ML 3SKMB 4PYGA 3G6JA 1ASQA 3OMNB 2RFXB 3MR9B 4JCWA 1YEFH 4BCYA 1X5AA 5ECGA 2VZUA 1R6VA 1RJZB 4ENED 1HQ4A 1W0WA 1MCBA 1KCKA 3U6RB 4FERA 2V2WB 2CBTA 4H0HB 2VT0A 2VH5L 2X1OA 5EHFA 5DC0A 4AENB 2HN7A 4NUQA 1MRCH 4NJAL 1F4AA 3UJTH 1SF5A 1JV2B 2MOGA 5A2FA 4HJGB 4ELKB 1KZYA 3K72A 1T2XA 2IH8A 1HZKA 4KJQC 4PJHA 2DWTA 2F74A 1WICA 2VISA 2WKLA 5DI8A 3SE9H 1B4JH 5D7KE 5JHDB 4Z8FL 3N44F 5E5UB 1FL6A 3QPQC 3MNVB 4UDUB 5I6OA 1SMOA 1Q94A 1J1XL 5C0IA 3GXMA 3IMSA 2ZT9C 3MRDA 4YGVA 2QVFB 2WINA 2BCKB 3N41F 1CK0H 4HCRA 2VSKB 3UX9B 3N2JA 5ISZD 4Q2ZA 1CZ8L 1N2RA 2BK8A 4RGOH 1T66D 3R06B 1SUJA 3AAZB 2X9XA 3PPSA 1AQMA 3QIWD 2XX0A 3ARDC 4JZNA 2BP0A 3MRFB 5D6CB 1AKJA 3X11B 3DGGA 2HFEA 3LQAH 3BDBA 1KC5H 5HI3D 3D2UB 1HEZB 1FVDB 2LLGA 5D1ZC 1KFAH 1YN7A 4DKEL 1DVFC 4DVRH 2AV1B 3V79C 1VPOH 1RZJL 5JORA 3L5HA 4APQD 1EEYA 5BQ7B 3QR0A 2QPUA 4OZGE 3SPVA 5CD5D 5CEZD 1KGCE 3UZQB 5A7BA 5I8OH 1T80A 2GHZA 4TPRH 4PJGF 1LEKB 3KYOB 1ZIBA 4RAHA 2CR6A 4JN1H 4EN3C 5J11B 2XN9B 3F6LA 3VB8A 4AXWB 2FZ3A 5IQ9B 4AH2B 5FECA 5L2KD 2YAFA 4ODSL 1JZDC 3GS0A 5K5YA 2YBRA 4JRYA 2K6ZA 4WO0A 3EH5B 4JFXA 2EVHA 1M1XA 2YLKA 4ZYKB 3RVXD 4A04A 1E6JL 3TWYA 4OLEA 1TCRA 1LYQA 1UURA 4KUZH 2WNGA 3B6SA 1QR1B 5F1KC 5DVOA 3PWJB 4ZW5A 2EIZA 3WKNA 4M93C 3ZE2F 2R1WA 4D9QD 4AV0A 1ETA1 3UC0H 1R17A 4CUCA 1UACL 3BP6A 3HS8A 4IDJL 2HJFA 3EOAB 5I5MA 4JLRA 4NXSA 4ZPVB 1OOWA 1ZVNA 4ONOA 3HRPA 1EVTC 3KVQA 3QG6A 5BO0D 5EF1A 1OKEA 3UP6A 1Y1UA 4J4PD 2XBTA 1TQBB 4XPHL 3B2UD 2ZPKL 3I3EA 4KZCA 1YEGH 2JKWA 4UZUA 1NMBL 3RG1C 2HVJB 3UABA 5IF0B 1MH5B 2E6PA 5E8EA 4N2BA 3KS0H 4UIMA 5FOBB 4HSAC 4PCSA 1E5CA 2FL5A 3EJCA 1IAOA 4LCCA 4KQ4H 4LVEA 3WIHH 3O0LA 4HCGA 2DYPB 3ULVH 4BWUA 1FIEA 4OTXH 4Z7NB 1NOLA 1U9KA 4GQ9L 4KC3B 3DV6A 3HR6A 1BWMA 3OZ9H 5FV1L 1RZFH 3TCLA 4BQ6A 3IDIA 3DUSA 4EVNB 4BFFA 4N8VG 1EBPA 1PG7X 1TQUA 4LEOB 2EDMA 3RL2A 2X6MA 5LNGA 3FC8A 3MRPB 2Y3NA 3FBKA 2WBWB 3U9PL 1A1NA 3SCMB 4PU2A 2PPAA 3SPHA 2VSMB 1CE6A 1ACXA 1LK3H 3ULVD 3B1TA 3MO1B 5DD3L 2HKHL 1CL7H 1M53A 1Y7VA 2AJUH 3MNZA 3NEXA 4XRCB 2YA0A 5HGDA 1DO5A 1DJYA 2OPCA 4UCFA 4Y4FC 3FSAA 5FLVA 4AQZA 2A6KA 4ZPTA 3ZQWA 1ZT7B 4KK8C 5I28A 3NCYS 2EQDA 3KS0J 1QPXA 1HWHB 2YQ2A 4GQQA 3JBG7 4POZC 1SHSA 5ETUB 3FTVA 3FQUB 1L4IA 2J8UE 1BFVH 4W9IC 5DEGB 3OLIA 3WFEH 4ZMTA 1G9NL 5IMLB 3D0LB 3TFBA 2I24N 2YD2A 2HRGA 3EGSA 3UBHA 4Y2DC 1U2HA 3CHXA 5AAMC 2XVKA 1LWHA 3CAFA 1F4YH 4GAGH 3FFCE 5LAXA 3SY0B 3AS2A 1DCLA 2X4OA 1IV8A 3HG3A 3LQZB 3ZL4H 4XXWA 3UEQA 5I17A 2PTTB 4G7YL 4ABWA 2Y1VA 2ZYRA 5FAAA 1HOCB 3HAEB 4N24A 3WL9A 3M1BA 1FZOB 4D0CB 5F72S 4Y5XB 5B38A 4DN4L 3VW3L 1AH1A 1GAFH 3V4PA 3H2QA 4ORGA 4XP9H 4PM1A 4Z7IA 4BGDA 3K71A 2BS9A 3O3EB 2VOTA 3OF6A 4X4ME 4QOKB 2ENSA 2P24B 4KVNH 5F0MB 5JLZB 1T2JA 3FT4B 4WI6A 1FAIL 3MLSL 1E27B 4RZCB 1ZEAL 2K6YA 3C6LD 4OCYL 2YWYA 2ICWB 1U93B 3CE1A 3V0FA 3WUWA 2AGJH 3CSYB 5I2IB 5C0AA 3WFBH 2CO7B 2DMGA 5AKRA 3F2LA 3V6FB 3A0OA 2OL3A 1QTYT 3RPKA 4YHYC 3RVVC 2HG0A 1BVNP 3SZ6A 1Q9KB 4I0PB 3D9AL 3S2CA 1KTBA 1OQOA 1RUQL 4OZFB 1MSPA 4H1LG 4W70A 5JA9A 4OD1L 2EYRB 2XFGB 5MENB 2BS71 1XH1A 3UAFA 2NCMA 5GJTH 5ID1B 3WE6B 1CUOA 2AAAA 2UZXA 3DSNB 4JZJC 4OGXL 3L4VA 4YSEA 3KGSA 4X5LA 2E6QA 1I7UA 2EIBA 1KJVB 2J5LC 3MV7E 5E1IA 4MXQC 2AJSH 5TPWH 4QHNB 4M4RA 1RURL 2YKKA 4KZEH 3PL6A 4CW1A 1ZHBA 2EUXA 4RMSA 2FATL 2VXQH 2D0GA 1FRGL 4X42A 4WV1A 1JWSA 5DFVD 3IE4A 3VGBA 3STZB 3BGMB 1EDQA 5KSVA 2WQRA 3Q06A 4U05A 1BP3B 3CIQA 4P3CH 4WO4B 3VAEA 5C08B 1LEGA 4FQXB 4MS6A 2IV9A 4J1UA 4NJ9H 5DVKA 2XG4A 5DD0L 4BZ1L 4PREA 4E41D 2CR3A 1NCNA 2YMOA 1T7ZA 3HNSH 1OGAB 3G6JE 3M46A 5DHXB 3PYCA 3RDTA 1PL3A 4XNYL 3QUZC 2X10A 4QRRD 2FUTA 4YSQA 1A4AA 2I9LA 1NKOA 4XNXH 3CCHA 1P4IH 3OAYK 1YSOA 1N5AB 5J6GB 4JGNA 2RALA 2DLGA 4JFYA 4HKZA 3RI5K 4N0CD 1NL0H 5KWYC 3HNTH 3FKUS 4OLZH 4N1CA 1I7TB 4X9HA 3QZPA 4NFCA 3WAJA 5IJKC 1RY7B 2BNUA 4BEIA 3TEYA 4L5FE 4OJEH 3SDDD 1OF2B 1G1KA 5GZND 2EP6A 4PJHE 5AD0A 3ROOB 3FJTA 1AQDA 2PMZA 4ZXBA 5I73B 3GM8A 4Y89A 3E1F1 4YO0B 2X6VA 4L3EB 4N3TA 3QDGB 1HX0A 5D71L 4B6ZA 4MJIB 4P2QD 4UM9B 2P5EA 1LWJA 4ZJ9A 4FOMA 4MA1C 4JFDD 2P47B 4NQVA 4PY7A 3QCTL 2UXFA 1OAXL 1DSYA 3QPXL 1KTLB 2DI9A 3ES6B 2DBLL 3CX5K 2F7QA 3EW3B 4DKFH 2QV4A 2Y7NA 1JS4A 3T77B 4M1GH 4MTMA 1RZ8A 2UVFA 1TPXB 1XXDC 3VWJB 1YPZA 3UZEA 1MCLA 1G6RH 1A7QL 2AEOA 3MDJA 3U7WL 3DX8B 4F9LC 3MRQB 1H8SA 4LPVA 2QADC 3V0IA 1RZIA 4LCYA 2DKSA 2CGYA 4P2AA 2AQSA 3HVNA 3U2SA 1JNLH 1ZVSA 3TEUA 1ZE3C 1IGCH 4NYLA 8FABB 4U2YA 5J9PB 3WJMA 2Q8AL 1BOYA 1ACZA 4RAUA 5KZCD 1TU2A 5HJ3A 2ZWKA 2VC2H 4KY1H 4ZTPL 4RFOH 3IB4A 4GB9A 1JRHH 4N2IA 5IWLA 5CKGA 1JJUA 3FT9A 4OLXH 3LKNA 4JRYE 5JHBA 1C7TA 1M7UA 3TFKC 5B8CC 4KJYA 5D9SB 4CVZB 1SFDA 4ZUWB 2HWZH 4AL8L 3BN9C 1Q1PA 4IBLT 4FTVB 5KVDL 2WUBH 4QAMB 2BXZA 4QYAA 2Z93A 2QMKA 4XPTH 4NO2A 4BDVB 5BMFH 5HHQB 4HJSA 4S1RH 1U41A 2VZTA 3MNWA 4RGMC 2AI0L 3U9WA 4P46B 3RTQC 3P4MB 3F04A 1YEWA 2FWOB 4JFFA 2E3VA 1JGVL 2EE3A 5LBSH 4NKOB 5F7EH 1VESA 1ZSDB 3KGRA 3TTSA 3NRFA 2NXYC 4JJOA 3L4ZA 4MMXA 2ITDA 5DFAA 4F5CA 4NNYA 3KLAA 3S36X 1C5CL 3OAUL 4HBCH 4OCXH 3RWDA 3PXJA 4AQAA 1J9CT 3TA3C 1HIML 5EO0A 1M7XA 3RVTD 1PZAA 3GLZA 3GXTA 4LLMA 5DVLA 1FO0A 5DRNA 2E59A 1AG6A 5D4IA 2Q87A 4LRNL 3ZMNA 2OBGA 2EVFA 4KK6C 4XI5C 2X1WL 5E51A 2D7QA 4Z23A 5MEOA 3O2DL 3UTOA 1EDHA 1CD1B 3D25B 4JM2A 2EUWA 1K8IA 3RA7H 1XZ0B 2K9UA 2QELA 1GGCH 1E0OB 4YDKL 3STBA 3S5ZA 4Q74A 4KX7A 4LLYB 4KNQA 2CM6A 1C5DB 2JLPA 5C0CB 1T20A 3C87A 4OSUL 5I1GL 2IAMA 3RWHB 4G7VL 4LSVL 3TZVD 4QTIL 1IBDA 3BVUA 4YVUA 4E9SA 4OLVL 5DK2B 1GGIL 5GHWL 1QLFA 2IWGA 2X3AA 3EYQC 1J8HA 2ZYIA 4OLYH 4NQDD 4X5PA 2R27A 4L23A 1SYVB 4ZMQA 3MC0A 3MJ9L 3P3SA 4ODUA 1KJ2B 1VFBB 1THCA 2NZ9D 2WYTA 1G1OA 3FCTB 3JYBA 1JGUH 4QHLB 1NOFA 3FN3A 2YLHA 1A6UH 5L9DH 3GMLB 1SOQA 1MNUH 3BKYH 4XPBL 2A9NL 4KRMB 2PO6D 1KB3A 3PWPD 4ZOAA 2JQAA 4ALAL 5KJRL 1FYTB 3II3A 4AIZB 1OAZL 2WP3T 3HZYA 2A6IA 3GJFA 3Q5OA 5DURB 5HHPB 5D7IB 3KGUA 4M1DH 2RQ8A 1QSZA 4NGHH 3CDYA 2K7QA 4LU5L 4E9VA 2HLFC 2Z31A 3RI5F 1ADQL 3LIUA 1IGJB 4W68A 1DQDL 3S4SA 1LO3H 2XA3A 4XO9A 4E0RB 3DJTA 3HZMB 4X0NA 5G4MA 2Z34A 1CFSB 4PSRA 5TE7L 1QFUH 3OXRA 4WEEA 1FZJA 3KNBB 4DK3A 2TSBA 4WDIA 1R5VA 3OMZA 1A7NL 2UY6A 2HTKC 4JG1L 5F93C 2WZPD 3W56A 4XCYB 3OR7A 5T3XH 4FS0A 3WKMH 5DD1L 4ERSL 1P5UB 5I82A 1PAZA 4RRPG 4W4OC 5KSAB 2DDQH 3VXRA 1LE9B 2AJYL 2KDGA 3DC0A 4BUGA 4YC2C 2D8KA 2DQGL 1PF3A 2B4CC 4NN5C 4OQTL 1P0SE 4HCFA 1P53A 1TKWA 2DIAA 1KYUA 5T1LB 2ZP8A 3EJJX 4TV3A 5C0AE 3TURA 5E8DH 1PLBA 4FFZL 4IRJC 5IT2L 5AZ2L 2O4EA 5ITFB 3QNZA 3SGKC 1OARL 4PJAB 3HI5H 3H3KA 5BRZA 3U1SH 4XNBA 3ULUF 3KG5A 2JI3A 4M6ML 1ZHKB 4I5BB 4TSCL 4NUJB 3ZKXB 2XDHA 2Q6WA 5EIIB 4ZTEA 2ARWA 3L3GB 3AU1B 1HHHB 5H2BB 3QO1A 3E9UA 3BZFA 5GRJH 3GSRA 3MGTB 3WXWH 3COOA 1D9KD 1P69B 2EJ1A 4JO2H 4AEHH 1R3IH 2AITA 3V7MA 2K78A 3IFLL 3QAZC 1I9RL 2V9RA 5AYUL 4PJ9B 3Q9QA 4M7KL 1U6AH 4ABQA 5HYJD 1WFMA 2Q20A 5E6IB 4RDQG 4AJ0A 1XHHA 1MCOH 4NWTH 3ETBJ 4JY5H 5DXWA 3WO4C 1OM3H 3KLHC 5H35A 2F1EA 2Y1AA 1UFUA 3LMJL 4LFHD 1MZYA 3S36H 3U9UA 3BH9B 1DEEA 3QEHB 3EO9L 3VG0L 1RULH 2H26A 5BV7B 4L4VB 2O30A 3O6KH 4WWPA 4P5TD 1MCRA 4XX1E 2IH9A 3AMKA 5F7LB 1LMKA 4HWNA 3U79A 1D7DA 1X44A 1MWOA 3KGTA 1GYWA 5IM7A 1E8XA 4U1GB 4WNJA 2WXJA 4MLSA 4EI6A 1OB1A 3MCLL 3C5ZD 3CSTA 2KHAA 1QNIA 2NNRA 1YY9D 3FULA 5EO9B 3E8VA 3D50A 4NP4H 1CGYA 1AACA 3MX0B 3APMA 3N1FC 5GIRB 4HIJB 5KSBF 4LVHC 4NQEA 4X99B 5D1XD 2BINA 5JOPE 1MVYA 2OCJA 2PWEA 2F8XC 1S9XA 5ABZA 4OR1A 1GJIA 2X9WA 3VFTB 4Y7OC 1R34A 2H8PA 2FQFA 4N6QA 1FL5B 3SGJC 4GSDL 1R47A 1UM5L 3RX7A 3PQYA 3POCA 2NTFA 3ARGA 3P4NB 3BCDA 3BFOA 2EE0A 1AD9A 3DARA 1HHGB 4GSRA 4JFEA 4U1HB 1NMCB 4XVOA 4L8SC 4V1DB 1AHMA 4PR5A 2EDWA 5HHVH 3QI9D 5C0EA 4RWYL 4WI0A 2P7TB 2N7AA 4F8NA 3DECA 3S7GA 1GC1L 4C56D 2CRMA 1IBGL 4JPWH 4LPYA 2P5EE 4M1CC 2VR4A 1U8OB 3ILPA 3MUUA 4IDLA 2XYBA 1S7UB 1O7DE 4ODTH 1MN4A 1JF5A 1IGYB 1OT1A 4LDEB 5HDRA 1BIIB 1L9PA 2KERA 4PJXB 2EH7H 4WNQB 2WLZA 1SJHB 1AGFB 4JREB 1CG9A 3K91A 4DW2L 1YPZE 3A47A 2E76C 3DIFA 3B2VH 3K1KC 5EBMA 3RWEB 3DTDA 2ZOOA 4XCNB 2MWCA 4YAQA 2Y22A 3RKPA 3DRTA 3DX3A 1WBYB 1CQKA 2BVTA 1D2PA 4WWOA 5F1OB 2WLIA 3DMMA 4JO3H 1T7VA 2C4FU 3UADA 1YC8A 1ZA3B 4RBPH 1H15A 2DIBA 3NPSB 4KHTH 4R8WH 2WOBA 3CFUA 3VXOA 1YYLH 2K9FB 4HLEA 4FMKA 5DVPA 5KVEH 1H3PH 3V4VA 3LHPL 3SE3A 4Y5YA 2IOOA 1MRFL 3FB8B 3HZVB 5FO9B 2NRDA 4OBRA 4S1DC 2VYRE 3ECVA 4EKXA 3KEHA 3D0VA 3O45B 4Y19B 2VW4A 5JIMA 1DANU 3ZKSD 1FH5L 1IE5A 4OD3L 1EWHA 2E7HA 2CK0L 2MPAL 5K69A 3F6IA 2ERJB 3L3JA 3PDOA 5TE6H 4R3SA 4KOBA 2NY4C 4LCCC 1E5ZA 4AVHA 4EUPA 5BXFA 2VIRA 3I6LD 2JJTC 2LAAA 4GRLA 4NZDA 3I6GB 5DUPH 3PGFH 4YXKL 1MOEA 4QHPA 3GUTB 5D7IF 1WD9A 4JFFE 4I3RL 3V7AG 4D2NA 3ULSA 1C5BL 3OAZK 2R39A 1EBAA 2DM3A 2LVCA 3C60C 4JPKH 2OQJA 4KXBA 1DJIA 4GQRA 4TNVK 3TJEL 3U4BH 4F5CE 2Z3FA 3SOBH 1CLZH 4KROB 3NZ8A 1RI8A 2X70B 3DHMA 5HD8D 1CC3A 3KHQA 4XNUL 3QIBA 1HL9A 5IEHA 4GJTB 3BO8B 4I1PA 3EDDA 2WQAA 4XZ4A 4WKXA 4R5VA 5KS9A 4Y8DC 5ICZB 1TQTA 4GMTH 4APXB 1N0LB 1ETB1 1PU0A 3MRJB 1FDLH 4GS7C 5C8JA 5G2NA 4JQIH 3WBDA 4A2GA 4BFBD 4RMTA 4EIUA 1PJWA 4WW2B 4UTAL 1I8IB 4PJIB 4UT9L 1B6UA 4FI6A 3D06A 4XVJL 5KW9L 5IP4A 5BS0A 4M8UA 4PJAF 1UKSA 4QTHA 2FO4B 3D18B 4H7VA 4JFPB 2BFVL 5F9DC 1UENA 3O41B 2VLRA 2GC4C 5DD6B 3IGKA 1HNYA 4X5XB 3RJDA 1Q0YH 1OPGH 4XXWC 4FULA 2HFGH 3ARBD 1T3FA 4Z7QB 2IDTA 1WWWX 2Y4SA 1J8HE 1ZA6A 2ZCHH 1XGUB 2C3VA 1NGWB 2Q3XA 3OD3A 3GMNB 4IKJA 4Y1AB 5DHYB 1O6SA 2FBJL 2NNAB 3NCWA 4OCRL 5D7LD 1ZLVK 5I71C 4YLQT 3GMQB 5AYQA 1IEHA 2X4RB 3AS1A 1ZDQA 3FU7B 2FEDD 2F68X 2OJZL 2XVGA 2NY6C 4P5MA 1XMWA 3MRLA 1MCEA 3NCXA 4NSKA 1KLFB 4M61B 3LOWA 5MEQA 1EXUA 2JXMA 2QTEA 3RU8H 4CMMB 3CHOA 1NBYA 4TNEA 4D8PB 4BELD 1FNEB 2VDOH 2Z7YA 2FX8L 3QNYA 3U30C 3ERXA 3CZGA 5T1MA 5L8KB 1DFBH 5JQ6H 3FO9A 1TVBA 1NICA 4MVBC 1URLA 1TYRA 4TTDD 3J7HA 2HT4C 1T7YA 4MDJB 2Q7YA 4A6YA 1O7VA 1BQLL 2YXWA 1YEJH 4PN6A 4P9ML 4UAOC 1XSJA 1NAKH 4GKZB 2CGZA 1L6PA 3MV9A 1F4WH 2E0PA 3VFUA 2XTJE 4IJTA 4NERA 1MJJA 2AEIT 4QRTB 4YHIA 1JTOA 2JH2A 2PR4L 1RZ7H 3L3OA 2CD0A 5CU5A 4AI7A 1GZPA 4B60A 5K33A 1K8DB 4OIIL 1T22A 2NT1A 4FQ1H 2R59A 1L9NA 3DSFH 5EOTA 3FZUC 4LHUA 3NCBB 1M7IA 3VXRE 3IFOB 2B1HL 3IKCA 3K6FA 4MB3A 5HDQH 5GGQH 2W9DH 3JWOC 4XVSL 2NY0C 3P3UA 4KXZH 1PPIA 4LLAA 2D3NA 2F8VA 2F53A 3EG9B 2VDNL 3R8BB 2RTTA 3EDFA 1FH2A 3IU4L 4F15C 1N0XH 2GUOA 5BRZE 1GIGL 3LKRB 1D5XA 4LBEA 3MLRL 5DJ2A 2D31A 3OJMB 3A6BL 4OF5A 4WV1C 3KYMB 4QEGA 4KHXH 4FXTA 4PJXF 4QDGA 2EDRA 2E86A 5IBTH 3F58H 4CSSA 1BVNT 2LTQC 5EN3A 1OV8A 1F18A 3J8F7 3CQPA 4X7TA 1J0IA 5ABDE 3X2QB 3O3AB 1TDQA 3W5MA 5JR1L 2YWZA 3CFIC 1F90H 3HB3D 5I18H 3T71A 1ETJA 3RZCD 3EFDL 3O8XB 4NBZB 1WBXB 1SY6H 1NLDL 2OCFD 4AQ1B 2PPCA 4KNTA 1JGEB 1QHPA 2YZ1A 4OGAC 3CNKA 1SLXA 4FN0A 5TQ2H 2HRLA 2XV6B 2F8IA 3ARRA 4Q0XH 4OVVA 4GXVL 1P2CA 3DA0A 4PS8A 3WUZA 1SHWA 2ZKXA 2NNXA 3A4EA 3CJJA 3ARYA 3NN8A 3QAQA 4JG5A 4XAWH 5FO8B 1KTJA 2QV2A 3RNKA 4ZXBC 1O5PA 5HPMB 3VYPA 1NCAH 5E5LA 2UUDH 4JKNA 4Z0XA 43CAA 5ALBL 1UWFA 3GMOA 5T33H 3NCJL 3DJZA 4ZO8A 3BD3A 2WIIB 1E3XA 3MJ7B 3N6YA 2A83B 1CICA 3I02B 4NQEE 5CCHE 5L88H 3UBXI 2IALB 5H8DA 4XNZB 4P2CG 4TNVF 3TV3H 2NUTB 2ADJB 1MUJB 1MIEL 1JZFA 5IVXA 1KBGL 4WWKA 3QORC 3WLWC 5JIKA 4N2NA 1T6VN 5FWRA 4K7PY 4NNXB 1C1EL 1UFGA 4KZ0A 4RMWA 3PQYE 3DVNA 2OZNA 3UZEC 2H5UA 5JHDD 4LCUA 1XGTA 5E2WL 4EI0A 3GMRA 3EHBD 3HFMH 4JFEE 4IGBB 3LNGA 1NANH 2PXYB 4B9KC 2YUXA 4PCYA 1BFTA 3AUVA 4YDMA 3GNML 1WH0A 2X1PA 4CU8A 5FYLE 3WTXA 4HWBH 1U58B 3MMEA 5B38G 5F3HB 4HIHB 4Z5RB 4OM0H 2YA1A 4V2BA 4I3SH 4FJZA 4NPKA 1T5XA 3QUXA 5IWLC 4S11A 1KY6A 4LKXA 3HE6A 3JTBA 1CDYA 3TNNA 2WJ7A 1DVTA 1NGQL 3QJSB 3D2UD 3ESUF 4GW1B 1K4DA 3N06B 4WW2F 2VDLH 1Z3RA 4PJIF 3TBVA 3TPUB 1Z5YD 4K3GA 1HFUA 4B9FA 1I1YA 4CMHC 2FNBA 2X0UA 3WUWG 1MFCH 5IHBA 1TTGA 2CHNA 1MCHA 5DZOA 2KYIA 3TJHD 4FYQA 4LIQE 4UV4L 3CZUB 2XN9D 4JRXB 4IK7A 1CLCA 1HNFA 1JUFA 1MY7A 1QBAA 2EKSB 3I50H 4FHKA 3ZHLA 3FQTA 1ZVHA 4U1LA 5E6YA 5SWZB 4AV5A 2E9WA 2JCCA 3AGWA 5CN1A 5TTRA 4JHVA 3DURA 2KS0A 2AABL 5CIPB 2J44A 3RDJA 4NKIL 2ZKWA 4JHUA 4MMXC 3BAEH 3OKLA 5C7XH 3PABA 1JYWA 1YN6A 1CGSH 3EAKA 4PP2B 1VGKB 1GGYA 1XEDA 3QCUH 3NRPA 2GSGA 5JPMB 4L9DA 5G5DA 4XN9A 3MOBH 5AWNL 1TYEB 3EOBB 5IBLC 3LVTA 5JNYA 3SO3C 5IESH 2W59A 4I18C 1HXMB 1OSZB 5EEZA 2TSAA 2X4SB 3FHEA 4WW1A 5E2VH 4F33A 5GGSY 4N2MA 4WFFE 3FHQA 4BSWA 2P3YA 4TVPL 1ACYL 4NO3B 4P59L 4M8RA 4Z7VB 4JM2C 2JSFA 1LDPL 1VGEL 3BI9X 1KPUB 5IKCA 1DQQA 5D55A 3B4NA 3VX0A 2IG2H 5EC2B 1S9YB 1A1MA 3V6OA 1A6PA 2R1YB 3LV3B 4JFOB 4R83A 2ZICA 4Y4HA 1BLNB 3E6FA 2BOBA 3E8UH 2CMRH 4O02A 4DCQA 1TR7A 3L3DB 5IIEB 1SJVA 4NZ8A 4W9LC 2AS5M 2VUYA 1AI1L 2DKMA 4O2EA 3WCYA 3E7JA 4JHZA 2RHEA 3BP4B 4P5RA 3IJ8A 4R97B 2TAAA 2AERT 1J48A 3JVFC 5E99L 4NPYA 1EAOA 1NAMB 3QR2A 2OMUB 5KS9E 1USZA 1ZPLA 2D3JA 3CFJA 3MBEC 5CEZL 4B9JA 3CXDH 4X0KB 4Q6IB 3WN5B 1Z0NA 3NK3A 4UOW1 1Z0MA 4EMZA 1ML0A 5IJDC 4A2DA 1DSFH 3HHMA 3MCYA 4HQQH 1OE2A 3RHWK 1F0LA 2DLFH 3UDWA 4U3CA 4AW7A 3CSGA 4ACTA 4N8PA 3IMRA 4W6YB 5BS0E 3B7TA 1JNJA 4YPJA 5FYLD 3BAKA 5C6TH 3HNVL 1J5OH 5CD3B 1J9TA 2VLRE 1JZGA 2D0FA 2K3HA 4FNLL 1WAEA 5E7BA 5EULV 4CAGA 2VE6B 4AC2A 3V2AR 1NCDL 1AGCB 3CPLA 4KJPC 4X4YA 3WTTA 1NM9A 4HKXB 1H6EA 4XZUB 3HAEH 4Y4KA 4DN3H 1J86A 1GW0A 2PCPA 2Z31C 3FF7A 2WP3O 5CSZB 4UUJB 3D7PA 3Q1SL 3OWRA 3T0EB 1LK2A 3FTZA 2ITCA 3HEIB 2R69L 4J3OF 3RY5A 3MGOB 4U1IB 1MIML 3B9DA 2P8LB 3H3BC 2YRBA 4GP8B 2XTJC 2V8LA 1REIA 2XPZA 5I1AB 3MOAH 4OF0A 3T0DA 3KPLA 1BOGA 1EH9A 3AITA 3FH5A 2C4XA 2GHWB 1A6VL 4BKSC 4FLHA 3MRCB 5IROD 5IB5B 4QXUL 2DW5A 2HKAA 1SRDA 4GFTB 5KYWB 3GD1C 3SDCA 4GAJH 3KPSB 1U30A 3FUJA 1SYSB 1T89A 3IJ9A 1ILSA 1E3FA 4UINH 3VI4A 4E9WA 5I6NA 2XYCA 5DRZB 3CBKB 4JPQA 1S7QB 2XZAH 1JPST 4NBYB 3MJ6A 3ILQD 3TL5A 2HG5A 5DUBB 3K4ZA 5B4MC 3CDFA 4S2SB 1F58L 1ID2A 5E00A 3MYZA 5EFIB 1KB5B 4JCLA 3MV9E 2W94A 3FUKA 4YR6A 2R0KH 3FSOA 5IHUL 3O81A 5D1QD 1ASPA 2VXQA 2BDNL 1DUZA 1T0PB 4JB9L 4MRCA 1GKOA 1S2EA 3HG4A 1UUSA 5HGAB 5L6YL 1J05A 4NDMB 3BQUC 2NW2B 2PTVA 4KKBC 1XGQA 5B39B 5I66A 1F6FB 2WLMA 1EDYA 4ZFFA 2PETA 3B9KA 3WNPA 1T0MB 2F53E 1A6ZA 2VRKA 2H4EA 5A2BA 5TDNB 1Q9LA 3QUML 1YJDC 2BSRA 1IKOP 1F3DJ 3NACL 5KEZA 2ICWJ 1UWYA 3T2OA 2GTZA 4I0PD 4NC2B 3ZIYA 3FB6B 3H9ZA 1F5WA 1INQB 3BP7B 2UY7B 1PFCA 1WWAX 5CJOL 1GGUA 2COVD 1SN2A 4RFNB 3S3CB 4ZMZA 5MEND 2UZIH 1X5IA 1XF2B 5HP5A 1U8IA 1D5MA 3H8NA 5F7WC 4YFEA 4HLJA 4PTTA 2HH0L 4HKBB 1IAII 3VU1A 1R33A 1UADC 1NEPA 1X9LA 3QUKA 1EHLH 4O4YH 2E46A 4OFDA 5PCYA 3C5SA 1HI6B 4AQEB 2BH0A 4DQAA 1MHPH 3B2XA 3L2NA 2OTUB 4FQHA 1CLYH 2EXWC 3W0WB 4LKCB 2QZ5A 4L4TA 1IMHC 4P48A 1A3RL 1NFDB 2PWFA 4OAWB 1MPAH 2XKNB 1A0QL 1DBJL 5F7KC 3U46A 4GLRI 3H53A 2ZUYA 1BD2A 2GK2A 3VFWA 2IO5A 2CR0A 4WO4D 2VRQA 1TJHH 5C6WH 3KH3A 1PFOA 3ARGC 2VDRB 3FQNB 1QRNA 3Q01A 3E9TA 1UCBH 3C6SA 5F8RC 4EXPX 4HX1A 3ASNB 3MLUH 2NY1C 1NGPH 3MA7A 5DJDA 3SJVA 5CBEA 1XCXA 3D52A 2EKJA 2IFGA 2GEQA 1P4UA 1PSKH 5FUZH 3ULUH 5ESAB 4HUXB 1N4XH 2CRYA 1QACA 2VDPL 3HCVA 1DTUA 2CU9A 2D9CA 5IVXE 3PRZA 5J3HD 4FA7B 4R4BB 2LV4A 4Z7VF 4BKLA 4JR9H 1NUNB 1HNGA 3P9LB 5ICXA 2QQNL 3AS3A 3GEFA 4KKPA 1AP2B 2M8XA 3LEXA 4L3ED 4BUQA 3GHEH 3NZSA 5B1JA 1GTNA 2CLRB 3QDGD 4MJID 4WGVB 4FKKA 4UM9D 5C0JA 4L8CA 2CGRH 3M17B 1W0YT 3V6ZA 2EDLA 1I1CA 4HT1L 2X89D 1KULA 5KJ7E 1CD8A 1RZQA 5IMKB 3VQ2C 4HZ1A 3S4SG 1IT9H 3RHWF 5BRPA 4AVKA 3MROB 5FCSH 5BQDA 2G4EA 3CX5J 3QXDB 2IF7A 1QHOA 2EE9A 2W92A 2P8MA 2XOTA 3K6NA 5I23A 3N43B 4GW4B 3UTTB 4LMQI 1M2OA 3RX9A 4Y5YC 1OTSC 5DS8B 4GQZA 4WZ9A 3SPJA 3K2KA 5KANG 3NIFB 3CFCH 4K15A 4BHUA 4DOHE 5DS2A 2HZHA 4JFWA 4FXKB 5HYEA 4HAFA 2F53D 1GRWA 3C2SA 1AO7A 15C8H 2EIMB 3FN9A 3QJTB 4OD2B 4QRBA 4QXTA 2JF1A 3NSYA 1JZ3A 1HYSC 4X6EB 4L05A 3MODH 4TUKL 1U3HA 4M48L 5EUOF 5CGYC 4GRLC 2APVA 2VQ1B 3T09A 2R7EB 3QFDA 4PB9H 4F7KA 4HAKA 3IAPA 3ZE1B 3Q2LA 3K2IA 2JCCE 5GS0C 4N86A 3LPGA 4PRHB 3STLB 1J1OL 4G9DA 2FWSA 3EYVA 1XGRB 2H0EA 5CP7A 4WFED 4HS3B 1JGDB 2GAZA 4QXVA 4EO5A 4LF3A 2PW2A 3UBGA 1KBPA 3KCPB 3QIBC 4RFEB 4FTVD 1IGML 3SKJH 3VU2A 2HKFH 1MVUB 4IU2A 1IQDA 2M2DA 4A7SA 4ODVH 4P46D 5BO1L 4DWHA 1JK9B 4NZRH 3KBPA 5AVTB 2H6PA 3Q48A 1PG7L 2B2XH 2NY2C 5JIPA 1W0VA 2E8YA 1D6EA 4NRZB 4PIBA 3TCTA 5AG8A 1PMYA 1MCKA 5ACMA 1G87A 3V6OE 2QGDA 3QHFL 5E2UL 2V7HB 4F1SA 4K71C 3GRWA 2OYKA 3PGDB 3BUPA 1HINL 5GSVB 2Y72A 3HC4H 3EFOA 1SJXA 1N64H 3L13A 4AM0Q 1NBVH 3AUWB 3L1FA 2WTPA 4PGDA 2FX7H 2OA9A 1YECH 1M6OA 4WUKL 3ZHNA 4H8QA 4Z3JA 4YFDB 4BH7A 2NDGA 2A6JA 3BISA 2EH8H 3QZNA 2VNCA 1MCPL 3ZDZE 1XGYL 2VDKL 1I8KB 1RK1A 3LB6C 2XQBL 1L3NA 5C0CD 5EWIL 5T5NG 3DROA 5CAYB 1C12B 1QA9A 2XI9A 4ODBD 4A2MA 4M9OA 5KBLA 3D8MA 3GLEA 3OJVC 4WJ5A 3UAJA 1G7PB 3EJYC 1UCTA 1WVZA 2J2ZB 3FTGB 4CJ0A 4NRXB 2ARJB 3N85L 1QMUA 5KG9B 3Q2WA 3M1CA 5C86A 1ED3B 1U8JB 2XWTB 4NFDA 4YJZL 4PB0L 3WEAA 1FLRL 4M8QA 5HHOB 2NOYA 4KQ3H 1LO0H 1DQJB 1P4LB 2X38A 1KGXA 3NSFA 4IRSB 1D5IL 2FJUB 3ZU8A 5HGBA 4NKMA 3NJLA 5EH1A 1FNFA 3F12A 5AEAA 1CDJA 4BBWA 3W9EB 3BIBX 1Z1WA 3MFGB 2HJLB 4W9DC 5IBUB 1FYTD 1MCSA 1NFDF 2IBZY 1RAMA 2XWXA 2IFFL 2NPLX 3PY9A 4QNPE 1K6QL 5DURD 4BIKA 3OKOA 5E2TL 2FWLB 1L7TH 3AWEA 3FQWA 3IXTA 4WU7A 2P8PB 2IDQA 3OGCA 2BNQA 1RK7A 1UWEL 3QZMA 2EYSA 4EN2A 4QGYA 4TKWA 1LD9A 2VN4A 3VI4E 5CJ5A 2NX5B 1G7HA 1TTAA 4M3KB 3V9FA 2NYYD 4E5XA 3E80A 1KB9J 3QEQB 3H9YA 4L5FL 4WKZA 1MREL 4EI5A 1BDYA 3SDYH 1S78C 2CIKA 1CGXA 3LAFA 3CV5A 2HFTA 4LHJB 2Q1EA 4WI9A 2V4LA 3VVWA 1CDBA 5I16B 4A7GF 3GSNB 1ETZA 1I4FB 5KSAD 4JX0A 2J1WA 4F8OA 3QIWC 4XPGL 3SE8H 2GC7C 2EXTA 2P45B 4B9YA 5C0FA 1OLZA 2NSXA 4EUPG 2MKLC 1BBDH 4LLVA 1LO5A 3ZTDC 5HI3C 5BZDA 1T1YA 2F5AL 5CJQL 4FKEA 4FQQA 4N4YB 1G43A 3ISWA 1MCCA 2XPGA 1VERA 3TYGL 3GF8A 2WXKA 2VZSA 2ATPA 2ESVB 3KPTA 3O2VH 4S0SD 2V5TA 2YO3A 5BV7H 4OZIA 4ODXA 1GSMA 2DI8A 2MTPA 5LUMA 4PW9A 4BD4A 2XZQL 1ZHLA 5I1CH 3N43F 4WFHE 5EU4A 4YDJA 3RKDC 3L5WA 3LQAC 2NXZB 3NIFF 4XO5A 5DJAB 5EU5A 1UXSB 3K6SB 4QRPA 2ADYA 5E6ID 4RRPM 1KCRH 2CH8A 5IFJB 2L4OA 1RHHA 4JPIA 2P43B 3QEGH 4FKHA 3M8OL 1B9ZA 3CLWA 3ZKNC 4L4TE 2QFRA 4LSRL 1CICC 5DEZA 4UQ3A 3CFDB 4MNQB 1OAJA 2BY2A 2NTSP 4NPJA 3V4UL 4L4VD 4LSUH 2V33A 4QHMB 1W72L 1AQKH 4FG0A 4G6MH 4H20L 5AZEL 2J88L 4FQLH 1VSCA 2Z35B 3ZE1F 1QO3A 3MBWA 1BD2E 5FYKD 5IJVA 3BPOC 3ILEA 5E8NB 4F8QA 4Y16B 3INOA 1H3UA 4WTXA 1NCTA 1AYRA 4N26A 2AJZB 1QI4A 4XBGB 1ES0B 1QRNE 4FZEL 2ZAHA 1AOZA 2F19H 3QJVB 2YD0A 2DQHH 3NJKA 2CJTA 4I2XA 4RMBA 4MYWB 1UOVA 5JDJA 1QLEH 3SJVE 4YHMH 4G8AC 4MB4A 1OAUH 2ZKHL 2BSSA 3T6ZA 3KVPA 4I85A 5GS3A 3WKQA 1JK8A 3DUHA 4U6TA 2ENJA 4ISVB 3L5JA 3RWFB 3S98A 3LXUX 1QD0A 3QUXC 4K7PL 5I1IL 2F5BH 5EUKB 5IK3B 5DQDL 4CADA 2KZWA 2R0LL 2KQMA 1XSKA 4G5AA 3GFUA 1BZ7A 1KLGB 3K6DA 5FFGA 1QPPA 4MD0B 4OZHB 2ZUXA 4OJAA 4R26L 1AE6L 1FAKT 2Q8BL 4UM8B 4M7LH 4W9JC 4EDWH 4JQXC 2IEPA 4RGNE 1QUNB 2ZJSH 4JRWA 1AHWC 4MMZA 1IC7H 1ET8A 3DKHA 1OAQH 4J23A 2AZUA 3QULB 5FFOA 1DVSA 5I6XB 1T1WB 2A73B 3RIAK 3TT1L 2DMCA 3O9WB 2LR4A 2WTRB 3HMWH 2CIIB 5AVSB 1Q38A 1QPKA 4ZD3H 3VFMA 3ULVC 1BVOA 3MI6A 2AXWA 2EDHA 4URKA 3Q8EA 4K07A 3O6ML 2FSEB 4IKIA 3WHXB 4UQ2B 2GY7B 3ISYA 2LVEA 5D8JL 1CBVH 4S10A 2J21A 3BE1H 4YBLC 3H7BA 4XC3L 2OR9H 3KL5A 3I2CH 3K7UA 4BFOA 3EO1A 1OY3B 1AO7E 3L7FB 5DC4B 4JN2B 1HSBB 4Q4IA 3RWIB 1NCCL 3PNRB 4WTZA 1M3JA 2GFBA 3FSWA 1E2VA 4ZX6A 2J6EH 2D7MA 5FA4B 4PJGA 2WSPA 5E8PB 3RFZA 1OD7A 3JSSA 4X6CB 1P4BH 5LG1A 1FN4B 2EVIA 1YMHB 4GAAA 1W80A 2OI9B 4Q7DA 3T3PB 3MLYH 1OSPH 4ELMB 2WO4A 4L9LA 1JGLH 4PJFB 5K9QG 5INDA 3LDBC 2W07B 4HUVA 2BVQB 4Y19D 2E9IA 4JQIA 4Y4HC 3KYNA 3WMPA 1Z9SA 5CZRA 1WGVA 5I1DB 2AEQL 4Z7UB 4X6FA 1WT5A 3QQ3A 3NH7H 3FPXA 5CR8A 2ARJQ 3QC5X 5CILH 3GC3A 4CDHA 4XBPB 1UB6A 3W81A 5F97E 1T5WB 3KJ6L 2FNWA 2OMTA 5AUMA 3D6GA 3L9RA 1J0YA 4PJCE 2BRRL 4URTB 3C6LC 1WS8A 4P04A 5IVNA 1GJUA 2PWDA 5K9JL 7FABH 1YA5A 3AY2A 4TUJA 2F61A 4KWUA 5I5IA 1CFNB 2XG5B 3WYRA 4YQXL 3LNIA 3IRCA 3SYOA 4LL1A 1YDPA 3OPZH 3P0VL 3WEXA 4B7IA 3FFDB 4E68A 4KROD 1AOHA 1G0YR 2DQDH 3QNXB 3UDWC 3LEVH 1B0GA 4ONGH 4QWWD 4HUUA 5DT1H 3NYKA 4LARH 1RU9L 2JELL 3WOVA 5F9AC 1ZLVH 4AMKH 2X1XR 3NTCL 2ENPA 5JIDA 4OF8A 1IGTB 4WHTA 3RFRA 1KEGL 3ZSSA 4ENZA 3TO4A 4Y4KC 4D7BA 3IJHA 3HBZA 4XPAL 2B77A 2YD1A 5IW6A 3TBSA 3D85D 3TN0A 3SHSA 4V11A 4F2EA 1IFGA 3EYUH 5F7FA 3KLKA 5HGHB 5T8IA 2XWCA 1KPVB 4ZSOB 1JZJA 1E30A 2FIKA 4G6JL 4YDIL 3ZZLA 1SVZA 4FLQA 3VXPB 3H4FA 3JWOL 3MBXH 4JKLA 5E7FA 3NIDB 4TQ8A 12E8L 1T0OA 1AD0B 5DEFA 3LSOA 5T3XE 3MRIA 5IVOA 4CC4A 4Y1AD 3QUGA 3W1ZA 4QF1A 3N1GC 3I6SA 1W15A 3SDCC 4F93B 1CFBA 1T89C 1ZHNA 2W0KA 1CR9L 1EO8L 1JFQH 3FUDA 3ZZSA 4AT6B 3TBYA 1NPUA 2AMGA 4HCIA 1GOGA 3FT1A 1I3VA 2GJZA 4NQXA 1DQLH 2NY7H 1G7LB 4O2CB 5CGBA 1YEEL 4KO7A 3GSVA 1PZBA 1IGFL 4Z77B 4LSPL 4ELDA 1HWGB 5F8QC 4MAZA 2BNQE 3BKCH 3DUUA 3TASA 4X7SL 3B9KC 1O5DT 2XA8H 2ZX5A 1TETH 5E9DB 1KBVA 2ICEA 1EEUA 2IH3A 3ZTNL 5HY9B 5DC9B 3GMPB 3VD9A 3U6RA 1Z9NA 3Q6FA 3RPIB 2V2WA 1SY6A 2VR7A 3AM8A 2VZOA 3ALXA 4DGWC 5H4ZA 5KVFH 1XSIA 5H37H 3T08A 2WXMA 3NFNA 1WWCA 3A21A 1MFEH 1Q4NX 1A4KA 1SFHA 4DP5X 4FXGA 1N7ML 1DQMH 1MKFA 3EJQA 1WWBX 4R4NC 3FUFA 5T1KA 2OYPA 4XPFL 2VW6A 4WNSA 5I15H 3FTSA 4KGJA 4ANWA 2VXTL 4AYFB 3T2NL 3HZKA 4P05A 4YXLL 1FV1A 1VZIA 3SOTA 4IK6A 4UU9B 4X8JA 1OAYL 3RWCB 4DK6A 3BEWA 25C8H 4DQOH 1K4CB 4OZIE 2O1AA 1L5GB 4NHUB 3R06A 1Z3GL 3AAZA 4OIAA 3S5LB 3FT2B 1SEBB 3FCUB 3VGFA 1BEYL 3GIZL 3K5SA 3O6LL 4HJ1A 1DN0B 1FZMB 1A6AB 4J3OD 1G9EA 3L4YA 4QRPE 1IM3B 2XPYA 5GPRA 3BWUC 5JMRA 2H9GA 1MFNA 4I1NB 3IDMA 4I87A 3HHSA 1INDL 2Q2LA 4JDEB 1BQHB 5BQ7A 4HWBA 4RMQA 5HJDA 1IFHL 4OB5L 3SB3A 1LEKA 3LKOB 2LHAA 3KPMB 4FABL 4X6CF 1PVHA 3TEZA 1A8JH 2VDQL 4DK5A 1NBQA 1MQKL 5JW4Q 1TQCB 2HLAA 4TSAH 5AL0A 2E6JA 3CX2A 4ELMF 4PJFF 1V7NH 4W6XB 1A7RL 3T0XA 4RGNC 5B1JC 4AGOA 5CUSL 1E4WL 4B50A 4Z7UF 4DGVH 4HOZA 1L7IL 4I2XE 4XCFH 1TZIB 4G59C 3UJJL 4L29B 2AXFA 4TQPA 5LXGH 4HUMB 1HK6A 2CE6A 3GSWA 1SJEA 4JHBA 5EZOH 1PBYA 3IDYB 1CF8L 2ADFH 3L3IA 4HUCA 3OQRA 3F7VB 3KJ4C 3L8QA 4QAWA 3HS0A 3O4LB 5KSUB 4TLUA 5KVEE 4OFKA 3JTTA 2DTSA 3DX9A 3GBNH 4AZ8A 1ANUA 4K2UL 2ZUUA 1F6AB 4F24A 5F0PB 3MACH 2YSSA 2VCOA 4IGBD 4ZMYA 4XAKE 1A3QA 2DWEB 2PXYD 3SKOB 1NDMB 3QQ9D 1DVXA 4X80H 1RIHL 4W93A 2Q5BA 3T8VA 1GZHA 1YMMB 3LY6A 3V0HA 3SSGA 4F7CB 3QDMD 1U3HC 3CLFH 3DRQB 4L1HA 1NCIA 4X5RA 5DEJA 4KMTL 3MRNB 4XMVA 2QPFA 4WFGD 3AT8A 3OX8B 5EF2A 3VRIA 1CXIA 2B15A 4K23L 5AOZA 3EH4B 2VMCA 2ATKA 5CIPH 5EZLA 1XF1A 2RD0A 4HETA 1JV5A 4TULL 2NY5H 4DEPC 2V8MA 3VWKA 4J5VA 3IPBA 5H94A 1NQBA 2UWEB 4C59B 2LFGA 1KTCA 3TWCH 1ROWA 3QJQB 3VXTB 1RJCA 4XP4L 3ESVF 3L5XL 4ZOEA 3NIDF 3H4HA 1A5FL 5FCUL 3SCMA 3W11C 1H8OA 4A55A 1N12A 3QFJA 3RGVA 2O6DA 3BAJA 4JRXD 1NGZB 4OZ4A 3IK2A 4FHJA 2FQDA 2QPSA 3Q43A 4NNPH 2Y06L 5T5FA 1U8QA 1I7ZB 2IPTH 5CJXA 4YXHL 1KG0B 4PJGE 4QRUB 3N1MC 4WI2A 3CDZB 5SWZD 3S97C 3QP3A 3T4YB 5JYLA 2BSEA 4I0KA 3CVDA 1LMIA 2GYSA 4BH8B 4EIZC 1A6WH 1ZT7A 2XWBB 4NUGH 5CINH 4F20A 1G7JA 2W95A 4P9HH 2CHXA 2FYYB 4LVOB 4NOBA 4NQCB 5GRUH 1XIWB 4NZJA 2DQEL 5DEGA 4O00A 4QXWA 3BYTA 2WCPA 5I0WA 4K8RH 2A1WH 3C5XA 3CBRA 1ZIAA 3EGXB 3GS4A 4A63A 3LD8B 1KCWA 3LQZA 3D3VA 2BVYA 2MQCA 3HN3A 4OCSH 3GHBL 4MWFB 1RZKH 4FNQA 3ZTCC 1NAMH 5KBNC 4PRDB 2ICCA 2PNDA 1BXXA 4JVUA 5C07B 5AW6B 1QUPA 1JWUA 3HAEA 3VSTA 5KYXB 3EBIA 5ESVA 3OHXA 3VXUB 4PS7A 5I30H 1BVKA 3VACA 1FZOA 4D0CA 3EDEA 1Q90A 2UX7A 1HCVA 3OKNA 3QQ4B 1NEZA 2OYMA 2JFCA 4LDOB 1YRKA 4UDTA 4ZODA 5IFHH 1OWRM 1SHMA 2EVGA 2Z7WA 1IIKA 4K8RD 2P1YA 5TQ0H 3ZZ1A 3SKNA 4ZS7L 2J71A 4QOKA 4QRFA 1UOKA 3FT4A 3A4DA 4GQPH 1FGVH 2KT6A 1IQWL 1E27A 2HP4A 1Z5LB 5C6PB 2QHLA 2O5YH 1T21B 2B59B 3HLKA 3N04A 5I76B 5IV2B 1WIOA 2PTUA 1JTPA 3BSZH 4HS8H 3VX1A 4PGJA 2BW5A 3UTPE 5KJ4A 4NS0A 3NFPA 5DJCA 3WELA 5JYMA 5E08H 4AIOA 3CSYA 2YPLB 2DLEA 2GJPA 4UZSA 1UWXK 3PXLA 4Z1PA 4L3AA 4FGMA 5T3ZH 4ZMXA 3TOPA 1EGJH 3QXAB 1H5BA 1QNZL 1IAIM 1RUAH 1ORSA 1WV7T 4JFVA 3R0NA 5LGYA 1ZTMA 4HF5L 1G9MH 2GBUA 1JPGA 2F58H 1YJDL 1BPVA 2FQGA 1N6QH 4XWGH 5HHXL 4RX4A 2XN2A 4DFHA 3CSBA 1YEKL 1E50A 1P7QB 2XWJB 4P3DB 3FUEA 5IG7A 4EBQL 4JQVA 1EAPA 1I1AA 1KJVA 3LKPB 4LCIL 2GT9A 3EYFB 3UTZA 5K1JA 1TSRA 1PS3A 5FUCE 4KO9A 4EI5C 2MHAB 1LQSR 5JDSA 2ZF9A 3UEZA 3KXFB 1HN1A 1KTKE 5D1XC 4C57C 4XMKL 3RWJA 4TTGA 1XB8A 4JY4A 5L2JB 1KIPB 3STZA 2MQ0A 2OXGA 4L0ZA 1DVZA 1YNKH 4FQXA 1F2QA 2PCYA 5FPIA 3QDJD 1YC7A 2BPBA 5DJ6A 3IVKA 3NJFA 4UNTA 4J3TA 3KBFA 2ZNXA 5F7AA 3QI9C 5CEYA 2XT1B 3IU3B 4LVNB 1JSYA 4PS4H 4YSCA 3ULAB 3LS5H 1XF5B 2CJ3A 3LIZH 3UTQB 3IGAB 2CAKA 3ME0B 1FUNA 4H26A 5A7EA 4U1KB 3NK4A 2V17H 1IJ9A 3HPJB 1VRSA 2DMBA 3P4OB 4U7KA 1G7QB 3DK2A 5DRXA 3WFCL 4NFBA 1FFNB 2OSLB 4TQEH 5FYLL 3NFSH 4MD5B 4P23B 2FCBA 5IB4A 1Z6JT 4QT5B 3GK8L 2G3ZA 2A4EA 5B1AB 4IJ3B 5LDUA 3NIGB 1SLVA 3AREA 3HRZB 1BZOA 5JOFB 3QO0B 3S0PA 3N3EA 2VXUL 2WXNA 1DE4A 2H2PD 3VJ6A 4A68A 2JIXB 4R0LA 5TFSL 3AZUA 4WIQA 2FUQA 4W9HC 4HMEA 3DIVA 5DSCB 1KTLA 2ZKYA 4OLUL 1S8DB 2E7MA 3RJQB 2IDUA 1VIWA 4DGYH 4MA8L 3VWJA 1XEUA 1FC1A 4MX7B 3KBEA 2VDRH 3QWRA 2WB7A 5ADPH 1OLLA 2B0SH 4N8VB 4N5EC 1AJ7H 4QR7A 1WBZA 3MRQA 1V05A 3W0WD 2UWEF 2LW3A 1NJ9B 4PTUB 1RFDH 3V4VL 1XCQB 5CP3H 2I27N 2BWDA 1U8MB 3S48A 5ADOH 2EDBA 3CFKA 4XCEB 5J9PA 1J0ZA 4CU7A 1A3LL 1TLKA 3IDXH 3LRSB 4KTEH 2WJ5A 2X1QA 2O5XL 2YOAA 7PCYA 4WI8A 2CPCA 2H45A 1TENA 3O6FB 5TK2A 1XR8B 4XBEL 1JZ8A 2R0WL 1QFWM 4MJ5B 1NC4B 2CA4A 4TOYH 5LGHL 4DZBB 1TMCB 2CDFA 5C09B 1ZV9A 5D4JA 2Y5TB 4MDIA 4KDTA 2E7DA 4MMZC 4QD2E 4ZUWA 2W1NA 2CO6A 2WLHA 5HD8C 3EZ8A 3WFHA 2C3WA 1UG9A 1CJYA 2KC0A 3V6BR 1M1SA 2SODB 4PJDB 5KSBA 4LSTH 3EJPA 3NZHL 1SM3L 5D5MA 3I9PA 4NKDB 3MA9H 5HHQA 3X3GH 1I3GL 4FADA 1EHXA 4F92B 2QKIB 2YMTA 2WGXA 3MRMB 4HUWB 4G70B 5ECJE 3REVA 1X7QB 1ZJBA 3P3RA 3CK0L 1PX8A 1OE3A 1V7MH 3QUYA 4R7XA 4LFHG 5IOPA 4PG9A 5C0RL 2CLZB 5JPNA 4LEXH 2VLME 3HC3H 3IFPA 1KT2A 3ARDB 3LPFA 2GJJA 2ETWA 3QISA 4MNGB 3IJEB 1BJ8A 1RP8A 2VH5H 3FK3A 4MXWL 5I8KH 3GGWB 4BE6A 1DLHA 1IUZA 4E5XG 1KGUA 4NJAH 1H0DB 1R19A 2F0CA 5D1ZB 1QVOB 4LBAA 3RFZC 1KTRL 1DVFB 3QXWA 4HIQA 3UTTD 2UZPA 1NH6A 2F54A 1XH3A 4GEIA 2V3EA 5A2JH 2FEJA 1XD1A 4PRPB 1UEMA 4I9XA 2KPNA 3T04D 4C4UA 2XNAB 3T9WA 1HHIB 5HVGB 5AKSA 6CGTA 2OMWB 2QVIA 4Z8FH 3JVGA 2MRYA 2Z92B 3H9SB 5D6DA 2MCG1 1WT5C 4EN3B 4BSJA 4U1MA 1KFGA 1J1XH 5CZKA 3T0BA 3OB0H 4HV8B 2MH4A 3N0AA 3V5HA 4ADJA 2WTOA 4R2GD 3OJDB 2XACC 4ZW8A 3QFJE 4KK9D 4AKPA 5HHMB 5B7MA 1JVOA 4FHBD 3MYJB 2AJ3A 4P2RA 4ZDHA 3QNFA 1CZ8H 2VN5A 4LLUB 4BUHA 1CI5A 1N67A 2ZUQB 4AY0A 2EDFA 1KIQA 1AYOA 4PRHD 5IQNA 3WEMA 4YE4L 2GJ6B 2WQSA 2R0ZL 3ZUNC 1S9WA 5EPMA 4MZ3A 2BCMA 5BJTB 4DKDC 4HA1A 1OGTB 1UD4A 4KO6A 3MXVL 1MQ8A 4DKEH 3VXSB 2N01B 1RZJH 5ACZB 5GS1B 1CFQA 2DQUL 3VXQA 5F3BB 4AIZA 1IL1B 2FT8A 2FJGB 1BZEA 3A6OA 4A6YL 3R18A 2VLKA 3D3VE 1K2DB 1MHHB 3I3BA 1FBIL 3TO4C 4JJ5A 3REWA 5D7IA 1QSFB 1CLOH 5DO2D 5FR3A 1D5RA 5I8CB 4FYSA 1JMZA 5LWYL 2F6AA 3TN0C 3C5JB 4ODSH 1KIRB 4HGKC 4LDLB 2V3DA 2WAHA 2XLLA 3X1EA 4XOBA 2QVKA 1E9OB 4RNRB 1T0NB 1IEBB 4GW5A 4U1SA 5EOCH 1KEML 3ARFD 1SBSL 1E6JH 3HZMA 2DBJA 2H3KA 5AOIA 4JANB 4L37B 5ILTL 3QIUC 2MNJB 1BZ9A 4QOKE 5DGQA 3G5YB 2OSYA 2X87A 1E2ZA 4DP8X 3IF1B 2VR9A 4GO9A 5AW7B 4N6RA 3LRHA 1UVQA 1P5UA 4Y9EA 5BZWB 4CC4C 1UTDA 3GHPA 3MU3A 3WNKA 1UH3A 2ROYA 5AW0B 3AABA 1CT8A 4IDJH 3CFEA 3MZTA 4BA8A 5J6HB 4ZS6C 4KGLA 1ZV2A 3EGDB 3NIGF 5T1LA 4AJVA 2DOCA 4GBXA 4WRLA 4XPHH 5FUCC 4ZMVA 3C8KB 2ZPKH 3HC0A 4POUB 5CSBA 3QZWA 2ZTBA 4H44C 1NMBH 5E6ZA 1LL1A 4KKAD 1KJ3L 1S5IL 1U8NB 3SQBB 3V5DB 1OB0A 1DDHB 4I13B 5K9OB 4N8CL 1LP9A 3NQIA 1HHHA 5HHOD 3ZT6A 5KYYA 3MGTA 4IRSD 2O61A 3DETC 5C0DB 1HEHC 2AK4A 2R23B 4XH2B 4D7PA 4BKTC 4PJ9A 4RGOL 2V7NB 4DAGH 3PJSA 1EFXB 2WMPA 2AJVL 4IM8A 3D4ZA 2BIQA 2CUMA 3HLAB 4M6OL 4PQXA 2W5PA 1DCEA 4MSWA 4ZFGL 3VFRB 1ZS8B 1CBJA 3OLEA 4H2AA 3CZFA 3IEAA 2WO2B 1X9RA 3U9PH 3JWDH 1J1PL 2XRAL 3IJYB 4YFLI 1CN4A 4U6VL 4AUYA 1NKRA 2OMZA 2WY3B 4KKCD 2NYKA 2ZCZA 5C0BA 2FB4L 2HKHH 4LLWA 3BIKA 1ZAGA 1KGYE 4YSOA 3I6KA 4YSSA 1WS7A 3CLEH 3TT3L 2CZNA 1ZOXA 35C8H 4KOCA 2CXGA 4E42A 1N10A 3AG4B 3QEQD 4JN1L 3BUYA 1S7XA 4G11A 4ZQKB 4ZO9A 2EYTA 2WB1A 5GIRA 1HILA 3TVMA 1G9NH 1UB5B 1I9IH 4PJDF 4KTDL 4M29A 3KYAA 4PS3A 3MRKA 1KGJA 1SUHA 6PAZA 2XFXB 2XV3A 1XF4A 4ZOBA 1FL5A 5FGCE 4G7YH 3PHQB 4ZW3A 2EUZA 4JMNA 2BC4A 2RA1A 1YY8A 1D5BA 1TITA 1TJMA 2Q9OA 2OMXA 4IMLA 4QLWA 3ROLB 3P73A 3UC0L 3GS7A 3ZPDA 1UXWB 2JKTM 4DN4H 3K4DA 1E67A 3VW3H 2VJXA 3T65B 2IADB 2IGFL 3A4FA 4PFEA 3L3KB 4PJBF 2HT2C 4U33A 5FM4A 3UTSD 2ESVD 4EDXA 5KUKA 3ULUE 1AXSA 4JZJB 4OFPA 3BFQG 1FAIH 1FVEB 2ZOUA 3RBGA 4E9TA 3MLSH 4Y1SA 1ZEAH 2W0FB 1WUNT 4FQ2H 5J11C 1KLUB 3L6FB 4OCYH 4UTBH 4UNUA 5CKAA 2Y7QB 1MDAA 3X1FA 1BMWA 1ZWIA 2NXZD 4O5LH 4Q89A 3ECBB 3HE7A 4MCMA 3RWEA 1RLWA 3I9IA 3FNKA 3L81A 3MCKA 1HE8A 3NZUA 5J4MA 5CEXB 5D4QA 2PPDA 1X5LA 1HZHH 1W8EA 2H3NB 2G2RB 1LO2L 3GINA 1MCNA 4OFYD 4MNQD 3TO2A 1I3RB 3U0TB 4GUPA 5GISH 3V9EA 2AKRA 1N68A 1ND0B 2XHNA 3D9AH 3PWLA 4KX9A 4K9EL 4EIGB 3QUZB 3GSUB 1PZ3A 3FB5B 1R9FA 1OTUD 2PCXA 1U8KB 3EADA 4LQ1A 5EDXA 2C1PA 3FCGA 4OGXH 2GK0B 1TQBC 3FT3B 2OV0A 3LX9A 4HKJA 4HPHA 2PKDA 4BFIA 3D48R 3R0MA 4MQSB 1WD8A 1GR7A 3ZYZA 1DDTA 1GZHC 4LLDA 3P40A 3RL1B 2OW6A 3K74B 5CM1A 1OP4A 1DZBA 1RURH 5KSBE 4G8GA 2XKUA 1KJMB 1JPFB 4X7FC 5D5ME 5DF0A 2J6EA 4JFTA 1S7TA 2G2NA 1BFVL 4O02L 1FRGH 4KUCD 3WFEL 5FM8A 1H8LA 1M2VB 4R7NB 4JKPL 4GKSB 2Y7MA 4G6AC 2VM4A 4OZGB 1X6NA 5GGUA 1J88A 3DIDA 2R56L 3VWKC 5DD0H 2WWMC 4G1MB 4BZ1H 4QJ5B 1IKNA 3QSKB 3QRGL 5CLZA 3E6HA 5LBGA 2R8SL 4X9FA 1AVAA 3O9WD 2DKUA 3SCMC 4MNHB 4KDVA 3RGVC 2CUAA 4F9PA 2YIHA 4ODWB 3B56A 5CJXC 4BK4A 3IM1A 1Q0XL 2QL1A 2QADB 4APXA 1N0LA 1JVLA 2WWKT 5EO1A 4JK0D 2F54E 4JY6B 3BPCB 2P42B 4KZDL 2OMYB 4JFQB 5GS2H 2N4IA 1TFPA 3EJRA 3WXVH 3MREA 5FYKL 4M43L 2WD0A 4HJEA 3S8FB 1TUPA 2FO4A 2WVVA 4G3YL 4OF7A 3ZW3A 3DXAA 1DJZA 2FJHA 3VQ1C 2P80D 2EVJA 3FCBA 4MAUH 5C0ND 3QCTH 4P2RE 1A25A 1OAXH 1M7DA 1R5WA 2FT6A 1N59A 2VN7A 2OJEB 3QPXH 3UC2A 5DMIL 4HS6B 3VGAB 1Q9WA 4KVCL 3GO1L 3FCSA 2A6DA 5ICYB 2G9HA 4YIQB 3QJHB 3U0PA 3C09B 1FNHA 3WNMA 4Y5XC 2QGBA 4N20A 3U7WH 3MFFB 4X9IA 3RTQB 1FIGL 1KLFA 5JHAA 3ILQC 2CXKA 1S7VB 4QYOB 2O6PA 1SGKA 3WJLA 2HXAA 4D8PA 2NXYB 2EACA 2OMNA 3KVDD 3OB8A 2Q8AH 2R1XB 2VLKE 1AQHA 3QYMA 4I8DA 4ZTPH 4CNIA 3SDAA 3ZSTA 2OULB 3QWOA 2BY0A 3HBPA 1BGXL 3AG1B 3TA3B 2CHZA 4CGUB 1FSKB 3W2DL 1R0AL 3CU1A 2CWRA 1WCBB 1PNCA 5LAPA 1EEZB 2FD6L 4J3SA 3NJMA 1JDAA 1WAAF 1E5UI 3CZNA 1B2YA 3QPKA 4JO4L 4TS6A 5ESQA 2JB6B 1TTRA 4YEFA 2GITB 3FO2A 1TVHB 5LCVL 4AL8H 3QC6X 3HNSL 4I0PC 1FZKB 1L9TA 2ZNWA 1FFOA 4HMDA 4DETA 4QRSA 4X83A 3ARVA 3FOLA 3IJ7A 3EYOA 2J8UB 1R3KB 1KBWA 2AI0H 3OKKA 1P4IL 1KPRB 3AU0A 3D5OF 4RMVA 4JM4H 4X5WA 3EJZD 3IFOA 3P77A 4OI9A 1NL0L 5M94B 3QUYD 3FFCB 4YUEL 3H9HB 4GUCA 1BPLB 2X4TA 5FK9B 1I1AC 1C5CH 4HIEB 3LH9A 4YHNB 3NA9L 4DKTA 2BMKA 3OAUH 1LEIB 5TK4A 2X0WA 1K5NB 4MHHI 3CZKA 3CC5A 3SDDB 3B3IB 3FQXA 1HIMH 2BNRA 2QR0B 4MAYA 3LKRA 5H37A 4N0YL 5E4EC 1NCBL 2M26A 4NENA 1U8PB 3S35L 2EUVA 3TV8A 4LRNH 1LP9E 1LTXA 3WDHA 4NQSA 2HX9A 1JZIA 1KN2H 3IKKA 3O3DB 4WO4C 4FQXC 2Z9TA 3QA3B 1KF9B 1UZ8B 2AK4E 3CN3A 4PRBB 1VADB 3G08B 5SWQB 2BP8B 2VUKA 5DQ9B 3V0WL 1IAIH 4ZW7A 4YDKH 2P4AB 3UPAA 4HWZB 1U42A 3KDMA 4NC0B 3FRUB 4M5YL 2HB0A 3KM2A 2G75A 5BZXA 3O8XA 5DJXA 1WBXA 1BF5A 4OSUH 5I1GH 1JGEA 3IXAA 2WAQA 3CIAA 4GRMB 4F91B 4XNMB 4G7VH 2WZAA 4LSVH 5EF0A 4QTIH 4LLQA 1FQ9C 1GW6A 4HD5A 5J06A 2VO8A 5GHWH 2BIOA 5C0BE 4JFHE 4DO5A 4GLRH 4LO9A 1JNLL 4P3WA 1E40A 2PYEA 3CUPB 2YGQA 3HR5B 5FO8A 4OGQC 3P2TA 2J72A 3MJ9H 4BV1A 2VC2L 4KY1L 4M56A 3BZEA 2VDKB 5HPMA 1IJNA 3AREC 1JRHL 2Z8VC 3ARTA 5DJ0A 4XPBH 5BOZG 5B3SB 2E74C 2L04A 3K1DA 5F7NC 4WENB 1A14H 1N3NA 1NUFA 2A9NH 2EDEA 2DQ6A 3VQLA 1NC2A 2QGCA 4JUSA 3UG4A 4WWNA 4ALAH 4R0LC 4F57H 3ULUC 4KK5C 4YC2B 2MOQA 4YOKA 4P4KA 2X12A 4N85A 1MUJA 4FLSA 2UXVA 1OAZH 4GOSA 5BW7A 3MV7B 4NN6C 1XTMA 2AP2A 1JBJA 2PCFB 3U48A 1TPXC 4PJEA 4MD4A 4AYDC 3VWJC 4OZGF 2Y36L 3ELAT 4XPTL 2N7SA 4CC0A 1AGEB 2WN2A 1IKFH 1ADQH 5F9OL 1DQDH 4G71B 4ZO7A 5AALA 3GDCA 3HUJB 5KTEH 4JDZB 2TRYA 1ILUA 3KPNA 3HAEG 2WNXA 3BMWA 2FVNA 5JW5A 4XVUD 5JQIB 1MRDL 1CGWA 2K6WA 5J89A 3G6JB 4JG1H 4OCXL 3WO3B 1FNAA 5I19H 3GZOA 4YK4C 1HQ4B 1W0WB 3OSVA 4LSSH 1BJ1J 4TRPL 5FGBC 4ERSH 1UJ3B 4DTGL 5I1KH 4AGPA 3KR3L 4TUOA 2DL2A 1ET7A 1MLCB 2AJYH 4QCIA 4QIRA 4AZUA 2HN7B 5GGTH 4DPCX 2DQGH 4EQ2A 2DRUA 4OQTH 5MERB 1KCVL 4PJ5A 4IOIA 4KDTC 1YYCA 4QHUB 2WXOA 4FFZH 3VGHA 3K72B 5AZ2H 2DWSA 1JD7A 3H42L 3BGFB 1JOIA 3U36A 4PJHB 5D7SL 5DI8B 2F74B 4NM8L 4M6MH 4TSCH 3UJIL 2NQDA 5DFTA 3VXMA 4P46C 1FL6B 3VRLE 1GYAA 2EEDA 1U3NA 2HUHA 1J5HA 5C0IB 2ZYSA 3MRDB 2Z6FA 2WINB 4FFWC 3NPZB 1XZWA 1HHKA 1UT2A 3PWNA 2Q3ZA 5JPNC 3T2PA 1N2RB 5F0LB 4Q58C 1I9RH 2CHWA 3ARXA 5AYUH 4X6DB 5C92A 3PE9A 3GYRA 1Q1JL 2C9PA 4JZNB 3NEOA 3VD0A 4XVTL 1QBML 3WNOA 1JGUL 2ZOKA 3D4GA 3TYFB 1A6UL 3DGGB 2AQ2A 2HFEB 3LMJH 4G8GE 5L9DL 3HZ3A 3BKYL 1HXMA 1JF1A 1OSZA 3O4LD 3VG0H 3GRWL 1AC6A 1WGOA 1YN7B 4PUBL 3DX4A 1NBZA 4YLCA 2P28B 3FQ1A 4Z3GA 3I9GL 4ZFOA 5JORB 1Z9MA 4IKLA 4B41A 2IIJA 2OK0L 1E4KC 1MLBA 4Z7OF 3SPVB 4FX5A 5IB2A 1I31A 4HK3N 3JVGC 1P7KA 5D6DC 3IRPX 1HL8A 2ISDA 3L3DA 3M07A 4M1DL 4XHQA 1YMMD 4Y4FA 3H3PL 4QXGL 3W5NA 3HBGA 3KH4A 4J8QA 4GKNA 2YBRB 4JRYB 5GGVY 4TMPA 4JFXB 4FCAA 1AIFA 3Q2VA 1M1XB 2MNWA 3ZDWA 2QHRH 4WWID 2V5MA 1W72B 1TCRB 4UQAA 4I48A 4IOSA 5IHZA 4LAQH 3HG1A 4GP4B 3BVDB 4UANA 4Y2DA 4GSDH 4YZWA 1UM5H 2EIZB 4CSPA 3N55A 2DYRB 1R3HA 3C6EA 4KU1A 2R1WB 4H0LC 1SN5A 3O2WL 2VLJD 4W9EC 4RWYH 2CCWA 4PYHA 1GC1H 2E9JA 2JNZA 3OMAB 4JLRB 4Y0GA 3RYMA 2LU3A 3WHE1 3RNQA 3DXAE 3QG6B 5CD3A 2EIJB 1CGTA 3P30L 5EUOA 5FS5A 1J5CA 5E8DL 1O75A 1B9KA 2VE6A 3BSZA 3DBXB 4Y2LA 3U1SL 1PLAA 5CCKL 3V0DA 4ANKA 1KACB 3BLKA 4UUJA 1Z7JA 4UIMB 3FF8A 4C83A 4DW2H 3T0EA 2FL5B 2NY4B 4LCCB 1IAOB 4NQCD 1XIWD 1BWWA 3QEUA 2A0LD 1G4RA 1BG1A 4H40A 4EZJA 4N0RA 3DV6B 1R3IL 3FRPA 3JV6A 1EGJA 4TLSA 3IDIB 3DUSB 3ZDXB 1VB9A 4F58H 5CGMA 1JPEA 2JVUA 2UVEA 1O7SA 2C9SA 1UWXH 2DICA 3A24A 4QO1A 3RL2B 1L3WA 1P5UC 4JY5L 5C07D 4Z76B 3A67L 3MRCA 3VXUD 4AITA 3PHAA 3VFSA 5KYWA 4ZG1A 3KPSA 3NAAL 2WXLA 1A1NB 3KDPB 3LHPH 1WIUA 4UQCA 1CE6B 4FFTA 5I5JA 2IGTA 5CLWA 4XOEA 3LXCA 1JL8A 4QHKJ 3MNZB 4PBXA 2DEWX 5A16B 4PGEA 1A7BA 1JDDA 1JHTB 4P0DA 5HGDB 4K5PA 2J8HA 1FH5H 1HH6A 5KVMC 4DEWA 4OD3H 1FG9C 2CK0H 4FTDA 2A6KB 2VM3A 3BP5A 3DNKA 5SWSA 2X2HA 4BSVB 3ZGIA 3TBWA 3QG7H 1UM6L 3HG0A 4X8CA 4G8EA 1LE5B 2CDEB 3S96B 4NP4L 3CBJB 1DBKH 2J5WA 4K7FA 1H3WM 3BW9A 4Y2NA 2X09A 2X28A 3EGSB 1NDTA 2XWDA 4H8UA 1H9VA 2YPLD 1ZGLM 4BCXA 4PJ9C 4PJ7A 5LAXB 4PP1D 4KI5E 3HUJF 2JKRM 3TJEH 5I17B 1RIVL 2Z7ZA 1O9WA 5CMAA 4WGKA 3Q6GH 4LAJH 1X9UA 1MHEA 4BRJA 4XNUH 4ANVA 4KDWA 2VXSL 5MEPA 2ZSVB 2L8AA 4YDNA 5KVFE 3M1BB 3WL9B 4J6RL 2BNRE 5I6LA 3VFGL 4XP6L 1QI3A 3G6JF 3LIZA 1FFQA 5BV7C 4TNGA 1F97A 4PPTA 3BP7A 2UY7A 4N2FA 4L3FA 3G9AB 2NY6B 2DIJA 4ORGB 3K71B 5FO2A 3NSXA 1XF2A 4MJHA 4C56B 1B4LA 3KLSA 3S5YA 1YEDB 4M9PA 1CTMA 1W6WA 2BO0A 1CYGA 1P7QD 4U1GC 1L6ZA 3GXIA 3VD4A 1NINA 4PY8J 1XTLA 4ODTL 1KBKA 2ED6A 5F96H 2X3BA 1WQVT 2IDFA 2K4AA 1TIUA 3K6SA 5KW9H 2HVBA 3RX8A 3LVEA 3ALPA 1NFDA 3KXFD 2YQGA 4P5KA 1OP9A 2WNKA 1TJIH 2BFVH 3B2VL 3WUWB 4Q97A 1CFTA 5FB8B 2AAVA 3GQFA 4HIXL 5A3IC 3F7KA 2L7QA 5C0AB 1UKTA 1OK0A 1H19A 3L95A 3GSOA 4UAOB 2ITEA 2KLTA 4FQCL 4IRZL 4HULB 4UB0L 5IOKA 2PYEE 3EJSA 3KLLA 2FBJH 2G5BA 4KHTL 4OCRH 4HLZH 2OMBA 2APXA 1YYLL 3WFDL 3KAAA 4X6DF 5KVEL 1G1YA 5FWQA 1DVUA 5LO7A 1FG2A 1SOSA 3L9EA 5CP3A 2DH3A 2IWEA 2LQRA 2UZXB 2FJFA 1G9HA 1NGYA 4HUXA 4F3FA 3CZLA 1FCGA 3N0PB 2NY0B 5FKPA 4G43A 1EJ6A 1YCSA 3HA0A 2C9UA 1I7UB 2FX8H 3R1GL 3VD5A 5FYKU 4AG4L 4R4BA 4DZ8B 3O3BA 3IGLA 2IPKA 4JREC 1C16A 4M4RB 2GCYA 4PJEE 4F15B 4LZKA 5HSFA 3PL6B 4CW1B 3QDAA 1AR1C 3F7YB 2KUTA 2BSTA 1ZHBB 2APSA 3BX7C 3FOMA 1BMGA 4M00A 3CFMA 1NGXA 2ODIA 5DUPL 1JWSB 3NJVA 3QFGA 4KJWD 2ADGA 5KSVB 1R5IA 2ZXWB 4HUKB 5IGXL 4P9MH 3VA6A 2JIXD 4HHAA 4AJYV 2YSTA 1CXEA 2DWDA 2GPZA 2XG4B 4PREB 4LOUD 2EC9U 2K1MA 1CLZL 3RDTB 5C9KA 2X2IA 4OIIH 3QXDA 43C9A 2I9LB 1KNOA 4GW4A 1GOFA 5GRZA 3N9GH 1BFSA 3PP3H 2CKNA 3BDYL 4N2EA 2B1HH 4JFYB 4HKZB 4IEFA 1DLFL 4KI5D 4XVSH 5JXED 1QEXA 1QX1A 4PJ5E 4EOWL 2VDNH 5C0GA 5DMJB 2AJXH 4OD2A 3R7QA 2BNUB 2R4RL 2ERJC 3IU4H 1ZLWH 1DJWA 2IOIA 4X6EA 1GZQA 5AD0B 4ZQTA 1OXYA 2V6HA 4QRQA 1AQDB 3AW5A 3MLRH 4ZXB