2F19H

Three-dimensional structure of two crystal forms of fab r19.9, from a monoclonal anti-arsonate antibody
Total Genus 40
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
40
sequence length
221
structure length
221
Chain Sequence
QVQLQQSGAELVRAGSSVKMSCKASGYTFTSYGVNWVKQRPGQGLEWIGYINPGKGYLSYNEKFKGKTTLTVDRSSSTAYMQLRSLTSEDAAVYFCARSFYGGSDLAVYYFDSWGQGTTLTVSSAKTTPPSVYPLAPGCGDTTGSSVTLGCLVKGYFPESVTVTWNSGSLSSSVHTFPALLQSALYTMSSSVTVPSSTWPSQTVTCSVAHPASSTTVDKKL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Three-dimensional structure of two crystal forms of FabR19.9 from a monoclonal anti-arsonate antibody.
pubmed doi rcsb
source organism Mus musculus
molecule tags Immunoglobulin
molecule keywords IGG2B-KAPPA R19.9 FAB (LIGHT CHAIN)
total genus 40
structure length 221
sequence length 221
ec nomenclature
pdb deposition date 1992-05-27
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2f19H01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2f19H02
4YHML 5I1EH 2AJVL 1H3VA 5GRJL 1SMAA 1U95A 3Q48A 4KJQC 1TENA 4HZLB 1KBGH 4X5WA 4G9FE 4C54A 1HHGA 2QEJA 1H8NA 4M62L 2OYPA 4HS6A 3U4EB 4ENED 4JO4H 4LHUB 3MV7A 2P8MB 1LK3H 3AFLA 1AKJB 4GQ9H 5J13B 2IALB 1HEZA 3LOWA 5FYKU 3NCYS 5BOPA 5JOEA 4P23B 4XTRC 3WFEH 5LGKA 4IDJL 4XWOC 4YGVB 4K3GA 4HWBH 3U4BH 4AG4L 3BIKB 4QYOA 3OGOE 2AK4D 2IPKB 1C08B 3QQNA 2HFFA 3IKCA 1S7XA 1WFNA 3IJYA 1FYTE 5JOFA 3Q6GL 1MH5B 2GW5A 1LNUA 3LEYH 4K8RD 3OJDB 3I02B 3SO3B 3JVGA 5EO1B 4I48A 4AMKH 1XR9B 5CCKH 1FFOA 1KPRB 3NTCH 4Q7DA 4JCMA 1N4XL 4U1IB 4I3RL 3VXMD 4RRPG 3L6FB 3QNYA 5DJ6B 4F8TA 3QPQD 4KAQL 3SOBH 1P7QB 4XRCB 4YXKL 4HAGA 1W0WA 3BH8A 3DBXB 3LRSB 4P5TC 4U3CA 3HI6L 1FVCB 3TBSA 5J12C 3B2UC 4TQEH 5D7SL 4P2QA 4NN7B 2FD6L 4MDJB 4Q2ZA 1MI5B 4TULL 4UOW1 4YHLH 2B8OT 1CG9A 4G8IA 3KS0J 4BA8A 5B3JF 3QDMD 2Z35A 4Z8FH 5HDOA 4UIKL 3JWDH 3FRPG 1A3QA 4OZFB 4OD2A 4PJIE 4HIIA 4PRPB 5I0ZA 1D9KC 1QSEA 3BP5A 2XQYK 5C2UB 1QRND 3MRFA 4K7FB 1P4IH 4OZFH 3PWNB 3D0VA 2UWEE 4PGJA 5D93C 5CILH 4AENA 4CMMA 3OKLA 4X99A 2ORBL 3RX7A 5C0BE 3CIQA 4M61A 5B4MC 1HINL 1MCHA 4A6YB 2SEBA 1NSNL 2M1KA 4P2RE 4Y1AB 1K8DA 4OAWB 2FBJL 2X1QA 2QADD 2YXMA 3OB0K 1YEEH 2CKBL 4ODHL 3TJEL 1NCBH 3IXTB 2PO6D 1RK1B 4MCZB 5I1CL 1FJ1B 3ZHDA 4P2RB 4Y1AE 5HJ3B 3V52L 1P1ZA 4IOFD 4NO3A 4FNLL 2FBOJ 5FGBC 1QRNE 3RNKB 4ZS6D 2QHLA 1KG0B 4BKLA 2ZSVB 3O45B 1A7NH 4LGRB 2R0ZH 4MQ7B 2PR4L 1K5NA 1KEMH 1P84K 1X3DA 1R5WA 3JUYA 3T77A 2W60A 3ULVE 4PGDB 4RCAA 1J7VR 4WDIB 3SKUD 4LLDA 4WV1C 5JNYB 3V0AC 4WFHE 4I2XE 3CVIH 3MNZB 1AQKL 3N06B 5KS9A 1I9EA 3PWJA 3U79A 3VWJA 3IRZA 3ULUH 2APWA 1S9YB 1YN7A 5MHSE 5DTFA 5J7CC 2P5WA 1R24B 1MSPA 4YQXL 1WFUA 1ZHKA 4XWOD 4APQD 3DUUB 3VFVA 3IXAA 2EKSB 2MQ3A 2YSSB 2VLME 3EO9L 3K1KC 4QOKB 3C9NA 2Q8AL 2WK2A 3TEUA 3HZYB 2NYYC 2ZSWB 1DBML 2FX9L 4PJAF 1T2QL 3FRUB 5F93C 4URTB 2EDKA 4J3VA 1KOAA 3FJTA 4G8GD 4KI1A 3D2UA 3U9PL 1AD0B 4XGZA 4Y7MA 1BPVA 5TE6L 1IVLA 5IMLB 4XBGB 3GHBL 4FS0A 3L5WB 5IVOA 3LQZA 3S96A 1G7JB 3BW9A 2IBGA 1X5YA 2IQ9H 5BW7A 1GC1L 5C0IB 5ID0B 1TIUA 3AREA 5EWIL 1DVFB 4MA1C 1BFVL 5J4MA 2IADB 1R0AH 1U2CA 1HSAB 2FYYB 3PL6B 2XIDA 3MMEB 2WW8A 1KIRA 1TFHA 4HULB 1WBZA 2OR7A 5L0QC 2PTUA 4LVNB 1F3DJ 4L8BA 1RK0B 2HRPH 2NY0C 2D4FA 3SKJH 3VXUE 4FABH 5AD0A 3U2SB 4WVRA 1I9RL 5ESQB 1IJ9A 3EJZC 2FH6A 4H5SA 4FTVD 4M7JL 4KJPC 3UPRA 4HJ0C 3DPBA 4X4XA 1GZPB 3SGJC 5GS3A 3O2WL 4JPVL 2OXGA 1BFOA 1OF2B 3IDNA 5E0QA 3SDCC 4NM4H 3U30B 4NQDD 4TSBH 4Q6IB 1U9KA 2FEEL 1X7QA 2DQFA 4P49A 5DUML 5T1KD 4DVBB 4JRXD 1O7SA 5JPMA 1HYSD 4G6AC 2P8LB 1A7OL 2P1YA 4NRYA 5ITBH 1RU9H 3ARQA 3LKSB 5TE7H 2OK0L 4ZFOA 1L0YA 1NGPH 3LKNA 5BJTA 1MF2H 1EGJL 4CMHB 4X80H 4IEFB 1FO0A 4LIQL 3GBLA 4U0RC 4PIRF 4XP1H 2VAJA 4JFDD 5HHXH 2CUMA 4PJGB 1WISA 2Y36L 2PYEA 3L3HA 3LN5B 1ZEAL 3B9KC 2XNAB 1NFKA 4XXDA 1E6OL 2FEEI 4A2MA 1IFHL 4F9PA 2NNAB 4FQXD 3WNLA 1GL4B 3T1FB 3WBDA 4DKEL 4KXZH 4C4KT 4OLUH 3QCUL 4GMSL 1C12A 3MRNA 1F4YH 1EBPA 5JOPD 2F58H 5I66A 3WNKA 2FECI 5IMMB 1EAJA 1BD2B 1SY6L 3NPSB 4Z0XB 1EEYB 2R2BB 1D5IL 2UWEB 2I9TB 3GKWL 2V7NA 3UTSE 3BEVB 1DQJA 4YR6B 3X12B 3M45A 3SGJA 1EAPA 4R97C 2XACC 3RKPA 2GI7A 1EEZB 4DVRH 4J3UA 2QSTA 4X7DC 5T3ZE 5IW6B 1NUNB 1ZSDA 3GSNH 3W5NA 3JXAA 4HMEA 1JZ5A 3D0VB 3SDXB 3MLRH 5JHDA 1CTNA 1BQHA 3NIDF 2OS7A 1OAZH 1KJ2B 2CGRH 2EC9T 2X4NB 2XQYG 4P3DB 5HI3D 2QHRL 3D85A 4DOHB 2HN7B 4MLIA 1VENA 3MJ7B 4NQEB 1JWUA 3U36A 3QXVA 1DR9A 1CXFA 1JRHH 3AS2A 4XXCA 3CH1B 4HUUB 2EICA 4C83A 4HJJH 2BRRL 1NMBL 1I7RA 1ZTXH 3QBTB 4PBXA 5IM7A 3O4LB 4RISH 3RZCD 4UB0L 1SY6H 3LPWA 3TBWA 2EXYD 5SWSB 5D7JD 2YRPA 5BS0E 2WUBH 4ZTOL 3MGTB 5IMKA 5SWZB 1ERNA 5CAYB 1EH9A 1M71A 3H7LA 5E5MB 3GIZH 5E6ZA 4GBXA 1YEHL 5SWSE 1JZ3A 2D7NA 2MTPA 4H5SB 5EZLB 4U6VH 3EIFA 5TQ0H 3N9GL 3WL9B 3I02A 4RBPK 5I2IA 1U8PA 3BZ4B 4LLMA 1N64H 3ZZ1A 1EEUA 5F1NB 4PJFE 2FL5A 1WBZB 3GSRB 4PJHB 1A6WH 4WDIA 3DUSB 3STZA 3UJTH 1YNTA 2G5BA 3T2QA 3VWJB 2HG5B 1JVKA 5HHXL 1AO7B 3WUWA 2DWEB 4WIQA 4OZIA 1D6VH 3CXHK 3KYNB 3LKQB 1CCZA 1NGPL 2YWZA 4L8CA 2NY0B 2PO6A 1FJ1A 1TVHA 1RU9L 1P53A 3UJJL 1A7OH 5FM4A 1VADB 3VGDA 3RNKA 4Y1AA 1A4JB 2MCG1 1P5VA 4R2GB 1BZ9A 1A9EA 5DD0L 5F1KC 3CVHB 3KPSE 4S1DC 3MUJA 3O11A 3QPXL 1QKZH 1S3KH 1MFAL 3CK0L 3KPOA 4GG6B 4NZUL 5I1LA 2HFTA 5GZND 1U93A 3ZTJH 3FQRA 2YD3A 3O2VL 3D2UB 5D1ZD 2KQMA 3SHSA 3O8XA 4KDTC 4KQ4L 4FFWC 4M6NL 3L7FB 5L2KD 2X4SB 4Q9RL 4N90D 2YZ8A 3OQ3B 5KBNC 3CUPB 4LSQH 4ZMAT 1XF2A 3UTPD 4W68A 3MA9L 4WHCA 1YNLL 3KLHC 1D9KA 3RDTD 1WBYB 2BSSA 2R2EB 2VLRA 2P46B 1MJ7L 2H2PC 5I73C 1PG7L 4JY6A 1P7QA 1A3RL 3L5JA 2ZUWA 1E4KC 4H0HB 5BQ7A 1MPAH 2IQ9L 5JQ6L 2P5WB 2Z31B 2E8YA 4B50A 4ELMB 5F97E 3BZFB 4NRXB 5C0AB 2BNQD 3Q1SH 4P2OA 2BFVH 5DDHA 1H5BC 4QXTA 3GHBH 5D2NB 4LNVA 4R7NA 3BJ91 3PNWB 4HH9A 5TE6H 3ULUC 2WBWB 2I07B 1MHEB 5IG7B 2YUZA 2WIIB 2CLVA 1I7UA 4HV8B 5KTEH 3HUJF 5EOTB 3HR5B 5CP3A 3KPRE 5MI0C 2HJLB 5IMMA 1A22B 5JMRA 3QIUB 4OZHF 1OAUL 5F9OH 2P49B 5FYKL 1P4LA 3MXVL 4YFEA 5DJDB 4O2EA 1FV1B 1XCTB 2YR3A 1NAMB 1CICB 5IBTH 4QRRA 3O8XD 1UACH 1G7MB 5FFLA 2X4NA 2BHUA 4BFIB 4G7VL 3EW3B 3VXMA 4Z7VF 1FVDA 3PUCA 4JM2B 3OAYH 1IAMA 2C3WA 2BSTB 4I4WA 5DYOA 4JANA 3MUY1 3BP6B 2AV1A 3ARUA 1HCFX 3GRWH 1MI5D 5HGBB 1LE5B 3LB6C 4WWKD 3MLUL 2VL5A 5E2TH 1CL7L 2VE6A 1N8ZB 1EEYA 2R2BA 5EH1A 2B1HH 4OLWL 1YEKH 5B38B 4JFFE 3STZB 3V4PL 5FOBA 1EAPB 4U2YA 5IFJB 4XVTH 5F88B 3CJJA 3VFMB 4KWUA 4HJGA 5CHNA 2BVQB 4QRQA 3GI9L 2XKSA 3C60A 1PKQB 2ENSA 3SE3C 4J1UB 4P9ML 5J12B 4HXBH 4JRYA 1TVBB 1HINH 1I8LC 4GUPB 3TCLA 2ZCLL 4S1QL 4YHPB 3PP3H 3V6OA 2ORBH 1GIGL 2L0DA 5DLML 2GTZB 1CL7I 3G5ZA 4CN6A 1C5DA 5IB1B 3ESVF 3RBGA 4AH2B 1P4IL 4LAQL 1UEYA 1QFOA 4QRRE 3HFML 3LIZH 2AEQH 3SKMA 3IS1X 5D6DA 1Y6KR 2LVCA 4NYLB 1DVFA 5IJVB 1CD0A 3PGDB 4WENB 1ZAGA 3S5LA 4AM0A 1LQSR 32C2A 1JGDA 1RHHB 4Z7UE 2VDNH 3C5JA 1ZA6A 5D7SH 2ZJSH 2MPAH 3S88L 3QHZH 3RJDA 1ZT7A 1LO5B 3GJFK 3WIHL 3KNBB 3MLTA 5LXGL 3BAEL 4OD1L 4H20H 3DXAE 1GGYA 3KPLA 4OGAC 3HMXA 1RZ8A 3D5OF 4K3DH 3O41B 4KMTH 2YPLA 5I1IL 3LCYA 4P2YA 4UU9A 2QLVB 1LHZA 3P30L 5D4QA 5E94A 4KQ3L 1W8OA 1MOEA 3S3SA 4YDJB 1B3JA 3GK8L 5ELIA 3BE1L 4Y19E 4AIOA 4JQIL 4BZ1L 4NHCL 1CGVA 3V6OC 4XCYA 4NRZB 3LQAH 3U9UA 4MJ4A 2COQA 1EHNA 4PYHA 1GZPA 1MCLA 2X4UB 3KYKL 3L9RA 1I7UB 4JFZL 4AG4H 3KPSB 3DGGA 2JIXD 3BRFA 3WS6C 1FRGL 3WO4B 4YDVA 1QSFA 4ZFGH 1K2DA 4GQ9L 2NY7H 3BQUD 4JFHE 4WTXA 4JO4L 5TGBB 1B9ZA 3MRMB 4JB9L 5EBLA 1GZQA 4TVPD 3FQNA 4NC2B 1KENL 1HSBB 1BOGB 2OL3B 1FVEB 2FJHB 4JDZA 1BQUA 3O6LH 4RGMB 2FH8A 5KSVB 3E3QE 2DI9A 3MFFA 3ROOB 2Q76B 3C8HA 4NQSA 5EORH 3OGCB 4IMKA 3VFNB 4PGBA 1YNKH 3NCYP 3HN3A 4ZAKC 4PJ8D 2W0FA 1UM4L 4JFOA 1QBMH 3RA7H 2DQGH 5MEQA 2AP2A 5HDBF 5TPWH 4PJHE 3PGFL 2J6EL 3MREB 2BSRB 1FE8L 4YFLF 4QO1A 2IMNA 3BPLC 3FN0H 5AZEL 2YD2A 2CIIB 3LKOA 5J1TC 5C0BD 5FUOL 1Q9WA 1PQZB 2UYLA 1JTTA 2BZDA 4EN3C 2DM3A 3T77B 1FL5B 3MRCB 1AGFA 2Y5TA 5C07E 3MTRA 3N85L 4PJXB 4JGJA 2EH7H 5E8OB 3HAEA 1H0DA 3U1SH 2E6PA 1S7SB 2FJGA 1YN7B 3HG1B 3OAUL 2R8SL 4P46A 1WIUA 3LRSA 1AXIB 1KB5B 2P47B 2V2XA 2BRQA 3PE9A 2ADIA 4YHNA 3STLB 5EIIB 1WK0A 4KDVA 3O3DA 1HIMH 3MRBB 4M5YH 3DV6A 5F7UA 1LP9F 2VDRL 1UA6H 2CR6A 3MLPA 1DANU 2GIYA 3B8SA 5D7KE 1JWSB 4JM2C 3HS0B 3MRFB 2ZPKH 3GMMA 2BK8A 3IAQA 1HH9B 3HAEG 5CJ8A 1CDJA 5HHOD 2HT4D 2APFA 1A9EB 3HNVL 4YK4C 5A43C 4KRMB 3FQWB 5KSAA 5IIEB 2XWBA 5HHMB 5IJVA 5HYJA 4MD0A 3LSOA 2AS5M 1RZ8B 2L4OA 5FYJD 1Y18B 2IEPA 2WBKA 4PJDE 5D71H 5C2BH 2UZXB 4HEPG 5H94A 4GW5A 5FA4B 5DC9B 1LO5A 5IB2B 1FFOB 3L3IB 4QHLB 5LG1A 1TQCC 3CLEH 5CSZA 2FO4A 4OIBA 2HJKA 3HNVH 3CSYA 1T66D 3HNSH 1YEDA 5CHNB 5ESAA 4OZGF 2PYEE 5DRXA 4X5XA 1INDL 5KSUB 4P4KC 3CX2A 3SDAA 1WZ1H 5FKPB 1ZWIB 1MH5A 4KV5E 3AB0C 5IFAL 3ZSTA 3C08H 5JO5A 3L3OA 5BV7B 4Q6YA 3RWIB 2VE6B 4LIQE 2E8ZA 2F5AL 1X4ZA 4QRPD 1PFCA 1NFDB 4YK4B 5ALBH 3WCYA 4UDUB 4DJMA 3OXRA 4YIQA 5T1LA 1KTDB 4QXGH 4H8WC 3N85H 1KJ2H 5FXCH 4O58H 2NXYC 4ZFOL 5FUCC 5C7XL 4KVNL 1GGBH 3TBVB 4JKWA 3MJ9L 2FLBT 4L4TB 4YDKL 5C08A 3HB3D 4FFVC 2AV1B 4MNQB 5MEND 1CZ8L 4PB0H 5BZWA 1JP5A 5EC1B 3GMRB 4TOYH 5TPWL 1FVCA 1NGXA 2GJ6D 4EI6A 3LH2L 1WC7A 3OF6A 5JORA 2IGFH 4OLZH 4JRYB 4JFFA 3S36L 2OZ4A 1N59B 1QYGH 3AAZB 1C7SA 1F6LL 1YYML 4N0YH 3MLXL 2Z93B 5C92A 1JPTH 3THML 4QTIL 4N8CH 3HAEB 5HGAA 3QAZC 3MV8A 4QYOB 4P2OC 4F7CB 1YEFL 4MXQC 1LO0L 2PW1A 2V2XB 1A6VL 4K94C 4PB9H 1I85C 1G0YR 4I8DA 5EIIA 4XP5L 1ZGLP 4UINL 3ZT5A 5CFHA 1HH6B 1CGSL 5GGQL 5EUOA 5FYJL 4NQUA 4CDGC 3UTSD 1BIIA 1BQHG 2FJGB 2X10A 5J6HB 2ADJB 4KK8D 1XEDA 4UQ2B 1CLZL 4RFNB 4NC0B 1JRHI 3SDCD 3ZE1F 2ICWJ 4DTGL 4M4RA 4F7PA 4OZHE 4U3XA 4ZPVB 4NZDA 3KXFA 3KYKH 2EYTA 3CFJB 3K81A 1MJJA 3M17A 3PGCA 1BVZA 4QHUB 3OV6A 3MSPA 1F3JA 3CCHB 1XIWD 3BE1H 3MV01 4I2XB 5FCUH 2YD8A 1X5IA 5MEPA 5MEQB 1BZ7A 2R23B 4NWUH 4YH6A 3OXSA 2EE2A 4KQ3H 1UZ6E 1PBYA 4JO1H 4X4YB 3BGFB 4XZUB 1GZQB 4K3EH 3FMGL 4ELME 3BN9C 1JTPA 2BOBB 3B43A 1HXMA 3GBML 2WMPA 4WJ5A 1A0QH 4PJBE 5ECJE 4JKMA 3SGKC 4G9FD 4H20L 4OZHA 3P77A 1XGRA 3IXAB 5HBBA 3SDXA 3BPNB 3WIHH 5BS0D 3DUSA 5DFVC 3AY4A 3QHZL 4XB7A 5CJQH 5F7KC 3MLYH 4PJXA 2HG5A 5IUSA 1ULVA 4XTRD 1I1YA 4ZQKB 2DLFL 3MV8B 4ONGH 5IV2B 3TESA 3VRIA 4LLWA 4X7EC 5C0IA 2UWEA 4HUWA 4L3CB 2W0PA 5FKPA 5EO9A 3U7WH 2X1OA 4ONFH 4DN3L 3L5WA 5DLMH 3JTSB 1HHKB 1Q9WB 4YWGH 1IGIL 5K59F 3ZL4L 4XXCC 5EFIA 3RUGE 2Y9RT 1L6ZA 3H3BC 1HNGA 5HHPA 3K2UH 1UM5H 4IS6A 1S9WA 4R9HA 3PHSA 3GSUB 5I1LB 1BZQK 3QDHA 5DJYA 2E3VA 3OHXB 3BD5A 4X6DE 4OBRA 4UQ3B 1KEGH 2VKXA 1FFQA 4D2NA 4FQXB 1T7VA 2B1HL 1KJVA 4NNYB 1NAMH 1INEL 4Y2DA 2HMID 4WI7A 3MV7B 5CIPB 4POZD 3UJIL 1ZLWH 1HKLL 5DVLA 1MRDH 4PV8B 3MFGB 4X7FC 2H9GA 1NDMB 3F5WB 1QFUH 1JGLL 1EZVY 4P9HH 3SDXF 1INQB 2N56A 5DK3A 1BOGA 3TO4D 3MV9E 4CNIA 1IGFL 1QSFB 2F19L 2CKNA 2DQFB 1SYVB 5L6YH 1J8HA 4XHQA 4YEEA 4LRIC 5H37H 2JIXB 3E6FB 4KVCH 4KKLC 1MFDL 5EO0B 2NX5B 3QFJE 1WUNT 2V5MA 2JJWA 3BZ4A 5EC2A 1DLFH 3V6ZA 4F57H 3RY6C 1YMHA 3KS0H 5ICYB 5C0RL 5EU3A 4GH7B 2X1PA 1W72B 4F9PC 1N59A 1Z9OA 3P11H 3Q6FB 4KUZL 1J8HB 5KTEL 3BKCL 3GJFH 3MMEA 3E8UL 1RIUL 4R4NC 4U1SB 1Q94A 2F53A 5FB8A 3BSZL 4UV4H 5F7HA 4LMQE 5DD6A 2RFXB 4OCWH 1A21A 2YKLL 4FQ2H 3CH1A 3KPRD 5CSZB 1MCEA 3RL1A 5DQ9A 2EDHA 3PWPE 3QPQC 4IRJB 4OD2B 4OUUA 4LRNL 3WN5C 2IFFH 2F8OA 4WI4A 5ANMB 1KACB 5T5NF 1YUHA 4ODVL 4ACPA 2J5LC 4FQPA 3QIUC 3M1BA 1YNLH 4CADB 4OCWL 1CT8B 3MA9H 3VFPA 5JHDB 5DMJB 2CO6B 4NN6C 1CFTB 2VZSA 4FFWD 2VQTA 1DN0B 2H41A 1KT2B 3OKKB 4R7DB 5E8PB 5HI4D 5F3BA 4WW2C 1F58L 3H42H 1JZ8A 3C60C 3O2VH 2CK2A 4XPGL 5AG9A 1CDUA 4GLRH 4ODTH 2I9TA 1HH9A 3UMTA 4D0DA 1W0VA 1OQXA 3NAAH 1T0NA 1BLNA 4MJ6B 3AXLA 3GJFA 5EU5A 4G9DB 1OGAE 2YPKB 1P7QD 5JHLH 4KVCL 5BO1L 2UUDK 5GJSH 4Q9BA 4UNVA 2VDML 2YD7A 2VXVL 2VSDA 2DIBA 2EIDA 3LHPH 2A0LC 5SX4I 4EJ1C 4PR5A 3KLDA 3GSXA 3BUYB 5CEXA 5I71B 1D6VL 4YDLB 1ZS8B 2VUOA 3VG0H 3I6LD 3B9AA 2MNUA 3CU7A 2EDFA 2GSGB 4L8BB 3UJIH 1LO4H 4U6YB 3ETBF 4MNGA 1G6RH 3JZ7A 3R0NA 3TFKD 4DGVL 2ICWA 3TJHC 4MVBD 3KPQA 4JPKH 5EG6C 3QUXB 1A3LH 3E2HC 1XCQA 2HH0H 3BYYA 4U6VL 3G6DH 5D1QC 1YEHH 3J7HA 4UQ3A 4YHOH 3TWCL 4HBCH 5J11C 2NY3C 4S0SD 1KCSL 1DCLA 2DQUH 3DNKA 3GSUA 4I0PD 5HPMA 3CLFH 4X0KB 5HYJD 1N6VA 2OTWA 4RGNC 1A4JA 5IG7A 4Z95H 4D94A 2EE6A 2PCPA 3I2CH 4HJJL 4G3YL 1HQ4A 1GC1C 3DTXB 5GRUH 4K55A 5I8CB 3S35H 5EU6D 2DKSA 1R24A 3VGEA 1CR9L 4GXUM 4ONGL 3WN5B 3P0YH 3KPPB 1IM3B 5GIRB 2VDQH 1AHWA 3CFJA 4PYGA 3VDAA 3WUWB 1KULA 5ENWA 1OAZL 4WUKL 1D5ZA 4XPAH 4HLZH 4LMQI 1NCUA 5F1IB 1SHMA 3GSNL 2YN3A 4M9PA 5F70A 1N7MH 2XA8H 3OJMB 5HI4C 3RZCA 2DF3A 1U8PB 3RWHA 5LBSL 1HH6A 3DI2B 4JG0H 2FJFB 3EYQD 3MC0A 4Q9QH 4XBGA 4JFHD 3CCHA 3AC0A 4NWUL 1EO8H 1XF2B 3RVVD 5HHOE 2ADGA 1ADQH 5FCUL 1QUNA 2VABA 1XR9A 1S7UB 2FO4B 5ALCH 5E5MA 1QBLL 3L7EB 1SEBA 1LILA 5I8OL 2EDYA 4JZJB 4PJFA 1P2CA 3C6LD 2F58L 3OJDA 5EC1A 3S98A 5GPRA 1JUFA 2Q8BL 5ANMA 5C0AD 3WO4C 4DTGH 2X5PA 5JW4M 1HYSC 1D5BB 5HXMA 3I85A 4PJ5B 4QRPB 4PJAA 4NKQB 2QJDA 2CPCA 3AS3A 3C5ZA 1M7DB 4N0UE 2C4FT 3VJ6B 2ICCA 5E4EC 3DIFA 5HYQA 4PV9A 4XP5H 1FFRA 5L8LB 1XAUA 4TSCL 1FVDB 5EPMB 3O3AB 2DMKA 4G6JL 1SMOA 3KG5A 3NZHH 1YEFH 3ARBC 1PX4A 1OSZA 1Y6NR 1MF2L 4OTXH 2FO1A 4G8IB 4N8CL 3I75B 1QLFA 1IGYB 1RMFL 4YHZL 3WFBH 2YPVL 4JFXB 3ZKSD 5IMKB 1KPUB 3IETB 3V6FB 5I15H 4CRPA 1YPZF 2FGWL 4TSBL 5IVXF 3LH2H 1E4XI 4JPVH 5FOBB 1RHFA 1DZBA 2X7LA 3GJFB 1CZ8H 4PB0L 3O4LD 1YEIH 3RZCB 4DGYH 1HHHB 2YD1A 4PTUB 1A14H 5D1QD 4DK6A 3WS6A 3BMWA 5C0AA 3MJ9H 2I9LB 1KLFA 4N5EC 1IGYA 1KLGA 4M7LH 1GGBL 4ODUA 1YMMD 3RY4A 3QCTL 1A1MA 4P23D 3SEPA 3BESR 2NR6D 3VXNB 1FL5A 4O58L 5ADPL 1DE4A 4P3DA 2E27L 2R69L 1KJ2L 4QY8B 4ZO8A 3T08A 1EVUA 1FNEB 2NY4C 5ACZA 3ILPA 3UBXA 1OHQA 4HS6B 1GC1H 2XN9D 4S11A 4HC1H 1G7MA 4PJCB 4XC3L 2P7TB 5EUKB 3VXMB 2H8PB 3RHWK 5C3LD 3ZKMD 3U9PH 3K74B 3EYUH 1BD2D 2RFXA 4F15B 5L9DH 3GSNA 1T1ZB 3QIBB 1FYTA 3DX8B 1A64A 3KGRA 4N9GA 3HS0A 2G75A 3P9LA 3RAJH 3X14B 4KY1H 4Y8AA 3HLAB 4V1DB 1CLYH 2I60H 2NMSA 1DBMH 2RQ8A 4G6ML 1N5AA 5LGHH 3JTSA 4ORZC 1CFSB 4JFDE 2Q8AH 5IJKA 2EXWC 3QFJA 3PXHA 5EU3B 3HUJE 1KTRL 1MWAB 4MJ2A 1J5OH 1C08A 1A6TB 1BF2A 2UVFA 1DBKL 3K46A 4Y8DC 1KIUA 1QOKA 4OIAA 1CGXA 3O8XC 3DV6B 1CICC 5I6XC 1HXMB 3ULUL 1OSPL 4JDVB 5A16B 2NY2C 3IDJA 4HPOL 1D5ZB 3BPCB 2RCSL 1XIWC 3SKNB 3BW9B 4UT9H 3IF1B 2XWJB 5DEGB 2XTJB 5K59E 2W9DL 5KVGH 1MRFH 4W4OC 1J87A 3VA2C 1ZHNB 5D8JL 2WBJC 2KZ1B 3HZYA 1RZIA 2W65A 3FQXB 1RI8A 4YXLH 3SDCA 2ARJQ 4NKDB 4U6TA 4FQ1L 3MO1A 3F7PC 3L3DB 4W81A 1NBVL 1J9CT 1NCBL 1O0VA 4JKPL 3O3DB 5F9WB 5I73B 1KT2A 3OKKA 4R7DA 3K7UA 4GO6B 1CD1B 4L4VA 3VFNA 2VL4A 4M5YL 3VW3L 2XZAL 3S34L 3FO0L 3P4NB 3RJQB 3FB6A 3H7BA 1HHIA 2PW2B 2IH1B 4JHAL 1H15A 3IRPX 4K94H 3EDJA 3ES6A 2K3TA 4LVHB 1FNFA 2EH7L 3BKJL 2BSED 3WIHA 1AI1H 4QRSB 2Q6WA 1CDIA 4MNGB 4YHLL 5I1DA 1FVEA 2FD6H 3IDGB 5E70A 5HJ3A 2DLHA 4ZXBC 4ZYKB 3LQAC 5E2VH 2V2WA 4RFEA 1OD9A 4YFDB 3MRCA 1A6TA 5T1MA 5E8NA 4AEHL 1QSVA 3L9RB 4Y16C 1X6LA 1U8KA 3DSFL 1IL1B 3EYVB 1VGEL 3QUYC 3ZDYE 5JA9A 5EIVA 5C8JB 2BXYA 2V5SA 3E6HA 3A6BL 3IDYB 4G5ZL 4KI5C 2ARJA 3AXLB 4X0KA 4EQ3A 3D39E 2VISA 3ULVC 3DWTA 3ECBB 4WGWB 5K93A 4QHNB 3GMNA 3EO0B 3TLRA 4OGZA 4LU5H 1TQCB 1YYLH 5FF6B 3ZYOA 2FWOA 5J89A 1ZHKB 4IRZH 4WFGE 4F7TA 3H9SB 2M2DA 1CLOH 4KJYB 4AM0B 3MNVA 3QJHB 2PYEB 2OP4L 5CIPH 4K3JH 1UEMA 1ZA6B 1XF3A 4HGMA 1A1NB 4M48H 5HHQA 1TTGA 2X2YA 2QQLH 4NFBA 4U1IA 3TIEA 2JELL 4OF8A 4U1GC 3K80A 5CP7A 4JZNB 2WANA 4O4YH 5ICXB 4JFZH 3TGXA 4DVBA 1EJOH 5GRZA 3RNQB 2X7LB 3IFLL 2EE3A 3N50A 4RZCA 4HUXB 4CVZA 2G2RA 3FOMA 1JZ2A 1RUPL 4YDJA 1U3ZA 1I8MA 1K5NB 2JJTC 2EDRA 4J7RA 5D7IA 1TVBA 1JK8A 4R0LB 1FG2A 4UT6L 4ESKA 2V7NB 4I3SH 2N1KA 5C0NC 4R90H 1AIFA 5GRVL 4D0CA 4ZO7A 1P69B 2ICES 2X40A 3QUZD 1CQKA 1G9ML 2QKIA 2AXGA 5SV4A 4QXUL 4G8FB 4K2UH 5AYUL 12E8L 5A2FA 3SPVA 4PTTB 4P46C 2ZJSL 3OR7A 3VJ6A 4IJ3B 4E0RB 4G8GB 1YMMA 3RBSA 1UKQA 3SE3A 2YD4A 4MAYD 3L5IA 3ZKNC 3LPGA 1WAAA 2NQCA 1IEHA 3PQYD 3BGAA 2VDPL 4Z7QE 4U1HB 4QRRB 1P7KA 3INUL 4HS8L 1C16A 1FC1A 3S5LG 2Z4QA 4U1KA 1FO0H 1Y0LA 3MPCA 3S4SA 2I9LA 4Y4KA 2VABB 3V6FA 3V8OA 3NIFF 3WFCL 1UWXH 4OM0H 5KANG 5JIPA 3GMMB 3SDAB 1SEBB 1NKRA 4XPHH 3NZ8A 1CE6B 3GI9H 1MAML 2A74A 3PHOA 3A6OA 3EOBB 4NQTA 2OMBA 4Y5XC 4EOWH 1FFNB 1U8KB 3UYRH 3VDCA 1D5XB 5DVMA 1YEKL 1OCWL 2VLRE 1NAKL 4QRSA 3WS3B 1BWWA 4I48B 4P2CG 1DBAH 2R1YA 1NFDE 3P4MB 3EYOB 1MVUA 1JK8B 4XNXL 4J6RL 5ESQA 4LNRA 4ZYKA 5JZ7D 2R2EA 2VLRB 4PY8J 1PZ5A 3GRWL 2O61A 1NDMA 4XAWH 5EPMA 1AD9A 3TBTB 4ZFFB 3NFNB 3KLAA 2DQIL 2GJ6A 5DVKA 1KIQA 2GTWB 1M71B 2LVEA 4HIEA 3MOBL 4G7VH 3O0RH 4J12A 4NHUB 4XWGH 2DWDA 3PQYB 4WTZA 3RGHA 5KSAC 1R3HB 1U8QA 4Q0XL 5IBTL 2HJLA 4ZUUB 3DHMA 4QGTA 2EC9U 5FYKH 1IAIH 2VLKE 1AGDB 3NA4A 5KW9H 3BGFC 4GRLA 5KW9L 1H3XA 7FABH 1JYVA 4ZAKD 4AK1A 3T3PE 4Z5RB 4QHNA 3WNNA 3FO1B 4S1SL 1HDMB 4WV1A 2L7JA 1AR2A 4FRWA 1BBJA 2DMBA 4P3WA 3FT4A 4L29B 3V5HB 3O0RL 5IGXL 2P5EA 4X9HA 4R6UA 4L3CA 4CN1A 1C1EH 2HFGL 4YIQB 1MPAL 2DQIH 5D1ZB 3BN9D 4YC2C 1PG7H 4X9FA 5C0CB 5EU6A 4XAWL 3J8F7 2DQJL 5D9SA 4O02L 2OZ4L 4WFED 2ZUTA 5B8CC 3TZVB 1JYXA 2E7BA 2NYYD 4OM1L 1WBYA 2BSSB 2VNCA 1AGBB 4J6RH 2Z92B 5F1OB 1CQYA 1ZVYA 4KUCF 3OR6B 1I9JH 1T1WB 5IT2L 2KBGA 4KTEH 1A9BA 2OJEB 4BH8A 2FHBA 4PRHA 4C4KO 2R0LH 4PJHA 3I6LE 1MFAH 5IMOA 5DZOA 1K4CB 3VWJD 1HOCB 3D3VD 2Z8RA 4AYFA 4XCCH 2X44D 5B3JE 4HXAH 2ZSWA 4IIQB 4MAYA 1MQKL 3BOVA 2IF7A 3EKCA 1UYWH 4PJ5E 4AL8H 3S7GA 4JFYB 4WTZG 1YEGL 4LHUA 1UKSA 4WEUD 5T1LB 2N7BA 4U1HA 1A4KB 3VH8A 2XZZA 3PV6A 3ARDC 4R26H 5BMFL 4JPIB 4GRWF 4MA3B 1BP3B 3V7MA 5HHME 1H8SA 4OZFA 5T5FH 4OKVA 4NKOB 1A6WL 4ZNEE 2A9MH 4HIHB 3A67L 5D70L 2VC2L 1TTFA 1L7TH 3C5SA 1J0HA 2FATL 2NW3B 5DK2A 5ESVA 1CXEA 3B5GA 2Q87A 5DQJB 3VD4A 1UGNA 1ROWA 4EKXA 3VFMA 5M94B 4AZ8A 5BV7C 4WWKB 3EFFA 1E4KA 1KB9J 2WUBL 2GEEA 2HVKA 3BUTA 3QIWC 4WW2A 3U2SA 5AD0B 1NGQL 4UT6H 3WKNA 4JO2L 5GGTA 5ICZA 3NCFB 43C9A 4XCYB 3MROB 5DD1L 1RJZB 5EC2B 4YE4H 5FK9B 1VEMA 3P9LB 3X14A 3IKKA 4ZUVA 1KB5A 5H94B 4LEXH 3VMOA 6FABL 2X70B 1VACA 3QDGA 2CDFB 2JELH 2H32H 2QHRH 2D0HA 5SWZD 3RNQA 1L0QA 4PGCA 3UTOA 4DOHE 2QQLL 4GG6F 3VFGH 3QCVL 4ZSOB 5B8CB 2MWCA 4M48L 4DQOH 3ZKMC 1HK6A 2FIKA 1XMWA 3D85D 3LKNB 5BJTB 5IROC 3MLRL 3DROB 4LEOA 3OMZA 4JANB 4ELMF 3VWKC 1JI2A 4DFIA 3QHFL 1NAMA 2H26A 4P57A 1BREA 1PKQE 1B4JL 4X6BB 2JK5A 2XRAL 1CK0H 4FQLH 5BVJB 5C09A 5B3NA 2XNAA 2CD0A 1C5DB 4K71B 4RGND 2OX5A 5EZOH 1YYLL 4NGHL 1OAYL 4LU5L 3FZUD 4LSUL 1BGXL 4M7KL 1D5IH 3RHWF 2AJYH 3QZWB 1RIVH 4IM8A 5CLWA 1X5LA 1ZLSL 3WKML 5CJXC 5ICXA 1LO3H 1TJGL 3Q6FA 2OBGA 1VGEH 2R9HD 3HZMA 1LO2L 3ET9F 4J1UA 4MNQE 3FFCB 3DRTB 4O51A 1V7NH 2G60H 1FZKB 1T89A 1RAMA 5CZVH 4IRSD 4CN4A 3LKPB 4PJ7B 5DR5H 3CPLB 2A73A 3G08A 3WHE1 1S9KC 4U4BA 1I1YB 2FYYA 3HC0B 1MAJA 1UB6A 2LTQC 5JMOC 1ZEAH 3BO8B 3DIFB 1AI1L 4G7YL 1MWAH 4HPYH 3QH3A 4XP1L 1PQZA 2UYLB 3HE6B 1IGTA 2EH8H 1E6JL 2YOCA 4KJYA 4AIXA 2CMRH 3QEGL 4PJ5A 2VLLA 2ITDA 2XXMB 4MD4B 4NRZA 1LP9B 2X4PA 1DQDH 2DRUA 1QHPA 4Y0GA 5TF0A 2BNUA 3VW3H 1YC7A 2BSTA 4BSWB 1HZHL 3EO1B 2GJZA 1BX2B 5F3HB 5KAQF 3WD5L 1D5BA 4PJBB 2VDLH 1I1AB 1KPVB 1EXUB 3Q3GA 4D9QD 5DS8A 3ULVH 4PGEA 3FO2A 3O3EA 3X3FL 1TJIH 4U6YA 1I9RH 3E6HB 4FABL 2JJUA 3K1DA 3QEHB 1FG2B 4GKOA 1Q0YH 4Q74A 2W9DH 3ALPA 3PWJB 1ZT1A 3ARBB 3B9VA 2EDDA 1H5BA 4WI3A 4HPOH 1KIRB 2R4SL 4P99A 1EA9C 3PG2A 5EWIH 1VEPA 4JHBA 3ZT7A 4DAGL 1OTSC 3VXSB 3OAYK 2GT9B 4H8WL 3D39B 2Q3ZA 4IRSC 3FHQA 3SJVD 1QNZH 2BNRE 2GTZA 4U0QB 1YA5A 1J5OL 2X9XA 2FB4L 5BRZE 2APTA 3V5KB 5KZCB 3ARBA 1QSFD 3CFCL 1B2WL 4MAYB 3ZYJA 3GSNB 5D2NE 1FNSH 2X4TB 3IKCB 1W0VB 3W39B 3UO1H 4XVSH 4XVSL 4YZFE 5I30H 3MO1B 3SDDA 4M61B 5CEZH 1C16B 3EYUL 5L9DL 3NIDE 1K8DB 1R3LB 3VGAB 1HNFA 3KWWA 1YEJL 4HWZA 4J3WA 1S7WA 3FRPA 3BN3B 2NCMA 2NY6B 5HGHB 3KPQB 4YQXH 4XNQB 3P2TA 3SCMA 1LD9B 4XC3H 3F7RA 2DIJA 3SCMC 5BVPL 3VI3F 3W0WD 2O61B 1RZ7L 4M43H 4O5LL 4M3JA 1FNAA 4L8SC 1WVZA 4YFLI 3TN0C 1LWRA 3MRGB 1YUHB 2HMIC 2R4SH 3MLWH 1DUZB 3DI3B 5EN2B 2WZPD 3LS4L 3P73B 3MV8D 3BPCA 2R1YB 4Q2ZB 1OGTA 1QLRA 1S7RA 2PR4H 1QPPA 3MNZA 1NFDA 4WW1A 1KLUA 1Q0YL 4HUVB 4RRPA 2JJVA 5J3HC 3G5ZB 3QCTH 5FYKE 2W91A 1OP3H 5FO7A 1G7LA 3WJJC 1HQRB 3BH9A 4PREA 2C5DC 3HC0A 4CVWA 4LCCA 1BBDL 3MLZH 3V52H 4ZOCA 1RJLA 4IRSA 4ZODA 1AR1C 3OB0H 3FFDA 3QWOA 3TJEH 4OSUL 4FTVA 1YEEL 3WXVL 2IBZY 1NFDF 4ZUWB 2HJKB 4J23A 4JVPA 4NFCA 1NSNH 5EZLA 1MHEA 5AZ2H 3WFBL 1RMFH 3KYOA 4HLZG 4JQXA 1J8HE 1KPUA 4EI5B 1DBBH 3TYFB 5TDPB 1NUGA 3LV3B 1MLBA 5I74C 3MOQA 2YHGA 1XFPA 2RB8A 4O2FB 4F3FB 3JWDL 4Z8FL 4G6JH 4M7ZC 3QDJD 3MNWB 4KZEH 3CFBA 3SBWA 2IALA 4ZFOB 3O9WC 4CL7A 3SGDI 2K9UA 3KPMB 4CUCA 3AREC 2NXYB 4TULH 2AJUH 4N1EA 3LEXB 4TQEL 2XWBB 3WUWG 5GSRB 4LVHC 1Z5LA 4GMTH 2O5XL 4QY8A 1JUFB 1P84J 3BPOC 2WIMA 4NN5B 3SOBL 4X6DA 1GCFA 4KAQH 5DJZB 1ADQA 4RWYH 1LO2H 4WY7H 1GGIH 3UYPA 2APBA 1CE1L 2FR4A 2CSPA 5HYJE 3FL7A 3RIAK 2GY5A 5D7IB 3T0EA 4LDOB 3FKUS 5AEAA 5T3ZH 3WFDH 3OR6A 1P2CB 1D9KD 2W0KA 3RDTA 2P8PB 4GKZB 3QNZA 5TH2A 1BVKA 3KDMA 5IFJA 4OV5A 1KGCE 1KCVH 4Z0XA 2EXYC 5LBSH 1WT5C 2XRAH 3IDGA 2HVKB 4WW2B 5HVFB 3C5ZB 3S97C 1F3DH 5C08B 1MCBA 1EK3A 3PNWA 4HH9B 1AO7A 4JY6B 3VXME 3JWNC 2BCKA 5EO0A 3DMMA 1H5BB 4XPAL 4DK3A 2R15A 1QACA 3QXAB 5IK3B 3BISA 3QCVH 3O3AA 5EOCJ 3QDJB 1WTGT 1B6DA 1N0XL 4W70A 1P6FA 5F89B 4QKXB 2O26U 5ID0A 2FDBP 4TUOB 4UDUA 2CDEB 4PPTA 1N3NA 2IQAB 3B6SB 1KBGL 4WU7B 5EDXA 2CIIA 5GRJH 2BX5A 5I18L 3FO2B 4IHOA 2NTFB 3KPTA 4FG6C 4AIZA 5I1EL 5INCA 5L8JB 1UJTA 5I1AA 5CEZD 1A1MB 5HVGB 1NC4D 4JO2H 4Z7VE 3CLFL 3DO3A 1QQDA 4LSVH 4IS6B 4QCIA 5CSBA 1IQDB 1I8LA 2VSCA 1XH3B 3NFSL 4Z7WB 2CKBB 4ETYA 3OPZH 4YHNB 3LS5L 3HZKB 1I9IL 1IGMH 2XYCA 4GRWE 2YRZA 3WV0A 1SJVA 4HCRA 4M7ZB 1OAQL 4JPKL 1RJLB 2FCBA 4UT7H 5GIRA 1L7TL 1LEGB 1X5KA 4LLDB 3A67H 2DTML 3BYTA 4DGVH 1YPZE 3O6ML 2ZCHL 5EIQA 3G6AB 1G6RL 1TETL 1P5UA 5BQ7B 5KOVC 4C58B 2VRAA 4LF3B 5FKAB 1WT5A 4F7CA 4M3KB 2FL5B 5JIKA 3PDOA 2APVA 3VD3A 1UVQA 5DJCB 1QLRB 4HX1B 2IANE 1MCRA 3AAZA 3NABL 4L9LB 1EXUA 4AL8L 5B4MD 4L4VB 5KAQG 2OR9L 1NCCL 4R4BB 1GHFL 3DVGB 1JPGB 3SDYH 5B39A 2P24A 4Y4KB 4ZAKB 5HGDA 3DTXA 1S9XA 3NFPA 4MNHB 4LKXB 4X4ME 3RX8A 4XNQA 2FZ3A 3O8XB 4I13B 1H3GA 2PYED 4MD4A 3F6IA 4H1LB 1BZ9B 3H42L 1DL7H 2Y07H 4EEEA 4Z7UF 4U1KB 3S4SB 1J0JA 4PRNA 1R5VA 4K9EH 4GG6E 2XWJA 1BX2A 1UQSA 2BHZA 4L4TA 2JCCA 4OM1H 1R6VA 3IS0X 5HDQL 5F9JA 1F6AA 3V4UH 1TLKA 3BQUA 4RNRB 3ALXA 3P9WB 3ZKXC 2DQJH 2P5WE 3NGBB 2ED7A 5HY9A 4IRJA 1D5MB 3CFBB 4BQ9A 4ODVH 1W0WB 3BH8B 1T6VN 5I1DB 4YPJA 4ZTPL 3EJYC 1IM9D 3RKDC 2MMXA 1ZHLA 4A6YH 3QUKB 5DGRA 1ZGLM 2G5BB 3RUGB 3GB7A 1G7IB 3VH8G 1IM9A 1EV2E 1T4KB 1Q0XL 1DSFH 3DETC 4XRCA 5HGAB 3OKNA 2VITA 5FYLH 3Q5YA 4JJHA 1JMXA 3NA9H 4KRPD 3N1PC 4WNQB 3EUUA 5DJ0B 3CSPA 5BZDA 1CBVH 3T4AB 1BFOB 1OF2A 2E9JA 4U1LA 2ITCA 3P11L 1QR4A 1TVDA 4R97B 1BD2E 5C09B 4FN0A 1RFDL 2ESVE 5IM7B 2P8PA 5FDYA 5D7LE 2SEBB 3KPRB 4PLOB 4P23A 1I8MB 3QJFB 1Y0LB 5D7JC 4DZ8B 3QIBD 3OZ9L 3QZWA 3EHBC 3TM6A 3T2OA 3VFOA 4H88H 1MFDH 3IXTA 1CF8L 1U8JB 2IPKA 2D2OA 1ZLUH 2C9AA 3ZDZE 4U3HA 1KJ3L 5CEYB 1FGNH 4APQC 4LQ1A 2XKUA 3E6FA 3GMRA 1VEOA 3QQ4B 2VZOA 1J1OL 4U0RB 1G9NL 5JTWA 1NL0L 1TJHH 1NLBH 2H1PL 1ZT7B 2V17L 4GAGH 1JGLH 4Z9KB 3R4DA 2VZVA 1R5VB 1KTLB 3UTSA 3LKPA 4PJ7A 1U8JA 1KCUH 3HB3C 1Q9LA 2KH2B 4HGWB 4GKSB 1T22A 1MJUL 1OCWH 3A0OA 4X98A 2MCPH 3QUZB 3H2WA 3SY0A 5ID1B 2FWOB 1CN4A 3VGFA 5B38G 5AWNH 4IDLA 5C8JA 4U1JA 4NNYA 1T1XB 1AFVH 5GGRA 3TYFA 2ATPB 1U3HB 1F8TL 1VFMA 1N5AB 5CJBA 4OZ4A 3HC4L 4N9OB 4G9DA 1VSCA 2V5RA 1IAIM 4TPRL 2V2TA 1FO0L 3G6JB 3PWUB 4JDTL 4ONHB 3ZHLA 4HS8H 2A6JA 5IEKB 2Z8SA 3E0GA 4ONFL 4DN3H 1KB5H 5GS0H 2VDPH 4U1JB 2F54D 3KJ6H 3VCLA 3ZDYF 3N1FC 5AG8A 5CMAB 3VU2A 1MFCL 3CFIC 1KCRL 1RJYA 1AGCB 4L9LA 1DUZA 2DLFH 3ZE0F 1QBAA 2Z91A 5J1AB 2AQ3A 4LSTL 1M6OA 4K8RH 4GRWB 1EBAA 5I1KL 2AKRA 5CP7B 2J12B 2MSPA 4FQIL 5DJYB 3CFDB 4P9HC 3GM8A 4K2UL 1H3PL 4H26B 5D1XB 2GAZB 3RL2A 4YZFF 1A0QL 2J8HA 1U36A 2J7LA 3FMGH 4CVUA 3IVKA 1NCTA 4R90L 1RK1A 1T2JA 1T3FA 4MNHA 4I3SL 2EECA 1PAMA 2HKHL 4BZ2L 4C56B 2JCCB 3O6FC 3X13B 4XX1G 4NJ9L 3Q5TA 3S4SG 4BZ2H 5D2NC 2DWDB 3S37X 3VI3E 1M1SA 1C5BH 1RUPH 3C60B 5LJYH 5GS2D 1FC2D 1G7HA 5B22A 1G9EA 1T7ZA 1EJOL 4HF5L 1TITA 5DJ0A 5BZDB 1KIQB 5GGVY 2QSCL 3TF7C 3C5SB 4W4OA 1C5CH 3LZFH 2M26A 1S9VA 4KKBD 1T4KA 4YPGA 2BERA 5AUMA 3S3PA 3HI1A 3ARFC 3LRHA 3DGGB 4LSTH 3U4AA 1BBJB 1CGSH 2VLJE 4OZGE 5T1MB 1G7HB 3PXJA 3F58L 4HHAA 4FA8A 4EN3D 3CXHJ 2W38A 5DEFB 1AHWB 3MRGA 1IAKA 4BFBD 2APXA 5IQ7L 1FIEA 2HRLA 3KJ6L 3U0PA 2BVPB 5L7XH 1KPRA 3THMH 1S5IH 2NTSP 3O11B 4N8VB 5I16A 1QYGL 2IH1A 3GSOB 3HC4H 4QWWD 5C0FA 1RURL 1WAAF 3EDFA 4X6DB 3RVUC 5ILTH 2VLJD 2GAZA 4Y5VA 3UYOD 4WI9A 1QA9B 3M17B 3L5XL 3U6RA 1X5ZA 2V9RA 2MHAA 2KDGA 2ZOKB 4L9DA 4WGVB 5AWNL 3GJEB 1FZMB 1N6QL 1FG9C 3FQTA 4YDKH 3NIFE 1J05B 1QFHA 1CFQA 2B1AL 2LE9A 2MKLC 3QG7L 3IGAB 2O5YL 3DARA 3QXAA 5DTFB 3TN0D 4FXKA 1DQLH 5GS0C 1QRNA 3LV3A 2ILLA 5D2LB 1ZSDB 2DBJA 4HKZA 4OIIH 2WBJB 3REWA 1G9NH 2RJMA 1G0DA 3IU4H 4BQCA 4JY4B 2C3XA 4G6FD 3GSQB 4NP4L 2YPKA 3RRQA 3S34H 3CC5A 1IKNC 4LPCA 1CF8H 3HNTH 4R4FL 1ETZA 5IFAH 5C0BA 4DGIL 5C9JA 4YC2B 2J8UA 1I4FA 3CU1A 1OTUD 1DP0A 3V7AE 1INDH 4KJWD 4F58H 1Z0NA 2BNRD 3D87B 5D8JH 4F9LC 1JWUB 4XCFH 3U36B 2RGSA 4UI2A 4HDIA 3T0EE 4BSWA 4L8SB 5KVGL 1J8KA 2WBJD 1A6UL 2G75B 5FYLL 1KC5L 5F3BB 1U8LA 4MNQA 2AK1L 5SX5K 1YC8A 1FDLH 2RCSH 4PJDB 4X98B 4OCSL 4ZFFA 1XGQA 2AK4A 1OSPH 2UUDH 4PJ9A 1LE5A 3UZQA 3CGTA 5FYLE 3T3PF 5ERWA 4EUPH 3ZTNH 5L2JB 3QFJD 5J06A 1RUAL 1M7DA 1DBKH 1DE4B 4IMKC 4Z78B 3DX6B 5I9QB 2D7PA 1NBZB 5HDQH 3GMNB 5IW6A 1IKFL 2VIRA 1IGJB 3U0WL 3QEUB 1BD2A 4G6MH 3DX9B 5A3IC 3DRTA 4L1DA 4WUUE 3OJVC 1HYRC 2I60L 4K7PL 4OQTA 2AW2A 5DUPH 3O9WD 3QULA 4YR6A 3X12A 2L7UA 5DRZB 2C26A 5E4IA 4ZSOE 1QLFB 1P7HL 1D5XA 3I3BA 3T8XA 4JFXA 3C6SA 4LLVB 1XGPB 4LOUD 2YC1B 4Y4FD 1QFWM 1LE9A 5F7WC 1CDHA 3VXSA 1EZVX 4Y5XB 1TCRA 1OSZB 1NCCH 4C83B 4JZNA 1Q9LB 5DVNA 4JFQA 1J0IA 1CXLA 2VZ1A 3OAZH 2DQDH 4IMLA 2CRZA 3NABH 4L8DB 2W9EH 4LAJH 1K3ZA 3FB7A 5JXED 1P7KB 4FQCH 1KJMA 4ZOBA 5LQBL 1X5JA 4NKOA 3VFWB 3DLQR 1EMTH 1HWGB 2D7MA 1JL8A 1FLRL 1EVTC 4ZDHA 2WSKA 3BVNA 5FAAA 1TETH 4WW1B 4YLQT 4RNRA 4K23H 4PJEE 5DS8B 2WINA 2DTMH 5TJWK 1D5MA 1YY9C 4XZUA 5FUOH 4PJDA 3HE6C 4BZYA 3FFCD 1L0XA 3SE4C 1I9IH 1IGML 4M6OL 1IAOB 1TDQA 2J6EH 4GRLB 5SWQA 5HHPB 3WDHA 5E8EA 5C0DA 1A2YA 4G8FA 2BVYA 4YDIL 3NFSH 4I0PC 2FGWH 4FQQB 5GZOC 5E24E 5K9OB 3ARZA 3ECBA 3DETD 4YHZH 1S78C 5I1HL 2FEDD 3KYNA 1K8IA 3WMSA 1JWSA 4POYA 1FL3A 5KSBB 1A6AB 1JHLL 1IGTB 3RVTC 1QR1A 5IV2A 4OTXL 5DEGA 1PJ9A 5A1AA 2J8OA 5D2NA 1NGWA 2RIKA 4JE4B 4F7EA 3SJVB 1YNTB 4LCIH 4OF3A 1IBGH 5JIIA 4MLSA 4UTBH 1YY9D 1FAIL 1GAFL 4XBEL 4HCRH 3UZVB 3HI1B 1AXTL 4RGOL 2Q6WB 1MFBH 4PJXE 2YN5A 3QFDA 5F9AC 3FB6B 3H7BB 5L0QB 5CZKA 2JB5H 1WWWX 3D69A 3FT3A 3KLHD 1CVSC 2A1WL 3Q2CA 3O2DL 4XMPH 3MJ8A 2XA3A 4P5MA 1Y18A 4XPFH 4YHYB 1REIA 1I3UA 5HHVL 1UXWA 2Q8BH 5SWSA 5CBAA 3NCJH 3FFCA 1PLGH 2GUOA 1KB9K 1KCVL 4FQXA 1IC1A 4I2XA 5INDA 5I1AB 2EYRA 5I8OH 2E6QA 3TPKA 1QBLH 4L5FL 3SBWC 5GZNC 2ARJB 2C3VB 5JZ7C 2N4IA 5C09D 1A5FL 4QCIB 4JN2A 4OGYL 3GK8H 5BZWB 1XF4B 2XZQL 4NZRH 1EO8L 4C59B 4C57C 1G7QA 2WP3O 3P30H 3ARFB 1GPOH 2VDOL 1JMZA 4OZGA 4XMLL 4Z76B 5IW1B 5IESL 3REVA 5FGCB 1GGIL 4AEFA 4OCRH 4XPFL 4OD1H 1T5WA 5BRZB 2EIEA 2P4AB 4WRLA 5HVWA 4GMTL 2J88H 2XN9B 3O2DH 3JSSA 2MPAL 3S88H 2KL6A 3N1QC 5KVMC 1WLHA 2PW1B 4DFHA 1NC2A 3W2DH 4PBWD 1AXTH 4RGOH 5D6CB 2F5BL 4XC1L 5CMAA 4ZPTB 4MDJA 4HCRL 3SQOL 4D0BB 3FCTB 1FAIH 4XBEH 1LVEA 4M5ZH 5EU5B 1OB1B 4LLQB 4G3YH 1IRAY 4LAQH 4UNUA 5FGSA 3I2CL 4U1SA 1LE9B 4NFDA 2J8UB 5TE4L 3RVUD 5I19L 3STBA 4NBXB 5C0AE 1JE6A 3BZEA 2OSLA 3TWCH 4YHOL 2R2CA 3D0LB 3DMMD 4M03A 1JTOA 5F9DC 3MLZL 5INCB 4XVTL 1LNUB 3ZE0E 5C0JA 2J3SA 1BBDH 1MCOL 1DQQB 5IVNA 3MUZ1 1V05A 5E1HB 2BHYA 4PP2B 1S5HA 1Q38A 1QQDB 3DO7B 4WFEE 2CUIA 4K23L 5E2TL 5TFSL 4NUJA 1LO4L 4G8GA 4PJHF 1L4IA 3EBAA 3FB7B 3DROA 2NTFA 1FL6A 1NEZG 2Y6SC 1I3GL 3U7YL 1I75A 5HYEA 5L2JA 5T3XL 4EI5A 2XWTB 1P4BL 4N8PA 4L3EE 5FO9B 2ICEA 1H8OA 3DBXA 4QHMA 1NJ9A 5GGRY 2H32A 1SVZA 4M43L 3T0AA 1FSKC 3CZFB 4E42B 2VXVH 3S35X 3DO7A 5GJSL 5DHVA 4Z7UA 1JN6A 3LY6A 4IIQA 1W72A 1YEJH 5KSUA 3T1WA 1NEZB 1L7IL 5EO9B 1GGCL 3L1OL 4XPGH 5IR1B 2A74B 3PHOB 5DUPL 3TZVC 2F8XC 3T8XB 4L3ED 2MQCA 3VXTA 4C56D 1PW3A 4NC1C 5C86A 5DMIH 3U0WH 4X6EA 1B2WH 5D1ZC 3MV11 5I6XB 2AJSH 3IETA 1TMCB 1PG7X 4G8EA 3BP6A 3IDUA 3FO9A 4TUKH 4HUXA 4TTDD 1S7TA 4M93B 2AGJH 3PL6A 4XT1C 1MFEH 3RU8H 4LRNH 3VGAC 2ZUQB 2X89D 3OKYA 1SEQH 1Z3GH 1MJ7H 4LPXA 4C56E 4PY7A 4NZTL 3OJ2C 2EO9A 4NNPH 4FMKA 1AC6A 3VXOA 4P4KA 1KC5H 1S7QB 4F15C 4Z77A 2JB6A 4M8VA 4OZFG 4RAVB 4PJDF 5MENE 2AXGB 5C0EA 5CBEA 4KI5F 3BI9X 2GYSA 3UPAA 4I0PB 3QSKB 3BKYH 2HLFC 3L7EA 4PG2A 1C8PA 3WHXB 4P4RA 2BVPA 1A9BB 3VI4E 4TTGA 4FTVE 3WD5H 5DD0H 4I77H 3NGBC 3UCRA 3BPLB 4ODBD 2ADIB 2VXUL 2FRGP 3NFPB 1K4DB 2BVOA 2X1XR 4G6AD 5JOFB 4Z6AT 4PRID 3N1GC 1IM3A 3NMEA 3CMGA 3CX5J 5DJAB 4JY5L 4JREB 2D0FA 5E7BA 2DQEL 3LMJL 5JA8B 4KV5F 5GGSY 2Q7YA 4PJEB 2AQ2A 5FA3A 3D69B 3D39A 1QFWI 1CFQB 5I17B 2VAAB 3UJTL 1LEGA 5FHAL 1P9MA 1AGBA 2O5YH 1P9MC 2B1AH 3OKMB 1JCKA 2OLDA 2XPGA 4X4MA 1KTKE 2DTSA 3WS3A 5AAWA 4PRDA 4D9LH 4OFVA 1A7BA 4JFOB 2DJ4A 2IAMD 1T3FB 2V7HB 4U49A 1MUJA 1ZVSA 4JN2B 4ZTOH 1IGIH 3PQYA 4I1NB 3ZO0A 1ZLSH 2V6HA 3BP5B 1WITA 1MHPH 1BGXH 1Q9OA 3L3KB 1OAKL 4JZOB 4M7KH 3HI5L 3C8KB 3QH3B 3S3JA 3GUTA 3FB5A 4ZNCD 2VZTA 1IILE 4K7FA 2NX5D 2E9BA 1CK0L 4JRXB 4HQQH 3F58H 1FYTD 1QFPA 4DN4H 3BEWB 3D6GA 4HS3B 3S6CA 1RQ5A 1JHKL 4ODSL 1HSBA 1KN4H 3L3OB 2XFXB 4P0DA 4TUOA 5DJCA 1GGUA 2C1PA 3FONA 3H9HA 3IJSA 5MP6H 4ZXBA 4MB3A 2H2SD 2IFGA 3N1MC 4R0LC 2YUXA 6FABH 3BT2L 2PXYB 2DKUA 1SYSB 5JXEC 1FN4B 2V2TB 1HKFA 3F7VB 2NX5E 2ZG1A 4LPUA 5HYSG 1A1OA 5CSGA 1CFVL 1OARH 4KTDL 2WWMD 3DX8A 4MA8L 1KCKA 5EZJA 1NMAL 5CZXD 5FCSH 5BVJA 1NGQH 3D39D 2X89A 1MCQA 5FIEA 5CINH 4NPYA 5IB2A 3TVMD 3TYGL 1T1XA 4QTHA 1ZHLB 3JWDC 4JFFB 3QDGD 1ZV5A 4FQQA 4OD3L 1S7RB 5JUEH 5DMGD 4NHUA 4GKSA 5EBGA 4PGCB 3VXOB 2GKIA 3QRFM 4FQIH 5HY9B 4PV9B 2MFNA 1IFHH 3RGVB 5I1KH 2ED9A 1YECH 4JQXC 2OL3A 1E6OH 2FIKB 1V3LA 5ABDE 3CXDH 5T5FL 2E7MA 4L3EA 2AXFA 3P3YA 1Z9LA 4PJAB 5L2KA 3BUYA 5BMFH 3E2HB 4PY7B 1KCRH 4L8DA 4LIQH 4X7CC 3QJHA 4X80L 1VFUA 1H9VA 2NW2B 5C1MB 2ZKHH 3G6JA 3PWUA 4ONHA 1KB5L 5GS0L 3VGGA 4QTIH 3GM0A 3EYOA 3P4MA 1JPTL 4X6EB 4HIJA 4NDMB 5IHUL 4TPRH 4YDLC 4XCCL 5M7QA 1FPTL 5D7LB 2IH3B 4NM4L 5F6HI 5LVEA 4XX1E 4NWTH 3O2WH 2G2RB 5ID1A 1SYSA 5L88H 3VXQB 4OKVB 4R3SA 5SWZA 4PJXF 5CKGA 5KJRH 3AB0B 3RUGA 2MCPL 1UM6H 5EULV 2D03L 4KVNH 1ITBB 3WLWC 5DHVB 2XI9A 4M6AA 1MNUL 3DHJA 5E7FA 4QEGA 4JO3L 4QXGL 4O02H 3JV6A 2NXYD 3RY5A 5D2LA 5ERWB 1U92A 3OL2A 1NL0H 3FCTA 4QHMB 1J1OH 5ALBL 2DLGA 4ONOA 1TQBB 3V2AR 2F5AH 4R2GD 4AJ0A 2XTJC 4LQFL 4HK3N 5DURB 3RWCB 4MDIB 2XV6B 1Q9KA 4ZS7L 5FK9A 2PUQT 1HCVA 3P4NA 2QQNH 3SDXE 4TVPE 4UILH 4RDQG 5TDPA 2Z0BA 1H3UA 3QDGB 4PJBA 3FB8B 2RAMA 3IU3B 5E6YA 2WM0A 1B88A 5FUZL 2XZCL 5E6IB 7FABL 2B0SH 2A38A 2AI0H 2WIIA 3KPRA 4MS8C 1XIWB 4JG1H 3RGVD 2NY1C 3JTTA 3SKOA 4PRNB 5FF6A 3HNSL 1CBVL 1FN4A 1KCLA 3TZVA 3F65A 2BY1A 4YXHH 4Y16A 5DD5H 4KU1A 1OGAD 4KJQD 1KUMA 3I50H 1AH1A 5F89A 2VXSL 3T09A 4XWGL 4C55A 4Q97A 4HKBA 2P5ED 2ADJA 3WNOA 4YO0B 4PRBA 1AQDB 3QIBC 2X9WA 2VKWA 3MRPB 5D71L 3DURA 1IL1A 3EYVA 2AEPL 4HS3A 2YBRA 4S1DD 3RKDD 4MQTB 4N0FB 1W72H 3O2DA 5ISZD 4P59H 1ZGLA 2XN9A 4CVXA 3HA0A 3ZDZF 5DMYA 1UCBH 4MAYC 4GKZA 4JRXE 1JGUH 4XNXH 5C07D 4WJ5B 1A7NL 3LVEA 5DUBA 1MCKA 2MHAB 2ZOKA 3P77B 5TDNA 3HZKA 4LDEB 3AY4C 4TRPL 4P5KA 1QZ1A 4EOWL 2PTTA 5DJ2B 4J4PA 1BFSA 2V7HA 2ZPKL 3ILQC 1DN2A 1KGCD 3KPNA 4N0CD 1MAMH 4OI7A 4PJ7F 4P4RB 3DGCR 5IP4A 2BNUB 3WIIL 1N5YL 1S7VB 2JB6B 1J0ZA 1EFXA 3MRQB 3QUZC 2VDRH 2NY4B 3EDKA 2EKJA 3S8WA 3GBNH 1TVHB 1IC4H 5GHWH 5CJ5A 1J11A 4HV8A 4X6BA 3DSNA 2OR9H 1MCWW 4KDTA 3EOTH 3OX8B 4MQXD 4NOFA 2ADFH 1KELH 3TH4T 1NCDL 4XBPB 2R8SH 2DLTA 4PJEA 2Q7YB 4XB8A 5E95B 3EAKA 1F00I 4I18C 2WQRA 5IQ9A 3HZVA 4I18A 3DVNA 2C3GA 4LASH 3V0VB 2LQRA 4EVNA 2ZCHH 1CYGA 4RMTA 1V7ML 2GFBA 3UTZB 3BFOA 2R9HC 4Z7WA 4PUBL 43CAA 2EDQA 4TVSa 1XGPA 4YXKH 1GSMA 1G9MH 3KAAA 3PGFH 4LSRH 4V2CB 3RY6A 2AABL 2F54B 3MODL 3WFZA 3MACL 2DQGL 4LSPL 1CD8A 1Q1JH 3KR3L 1M7IB 3QNYB 3T0BA 4JQVA 3D18B 3RDTB 4MJ5A 5K9OA 3T0DA 4PJ5D 3D3VE 4HWUA 3ZLQC 2F54E 2X4UA 2QSVA 2BVQA 2CH8A 3ORJA 2CRMA 4NKDA 1NEZA 1JF5A 1QLEH 1U3HD 1ED3A 3F12A 1OGTB 2JK5B 1CT8A 3VFPB 1CGYA 2VXTH 3ULUF 5L2KB 5ACMA 4EBQL 2JCCF 1AE6H 4HG4K 4WCYH 5DZNA 4KK9D 3DMMB 1U41A 4KC3B 4L4JA 1N0XH 4GKNA 4RBPH 1T5XA 1LK3L 4M9OA 1F42A 2VTFA 4L3EB 4F7PB 4F33B 2H3NA 4JZJC 1I8KB 4D8PB 5D1XA 3KXFD 2LABA 4ZFGL 4WO4D 4K3JL 2P8MA 2WLZA 1FRGH 1QSEE 2A6IB 2BCKB 3M8OH 1XGQB 1AE6L 3KPMA 2EIBA 2R2HB 5FV2A 5JDSB 1S9WB 4NHCH 3HRZA 4BZ1H 5MEOB 1Q94B 4YBQC 3ROLA 2HFFB 3WO3B 4F7MA 3WXWL 2J4WL 5T3ZL 3WFDL 3LDBB 2P43B 4D0CB 1CDYA 4BH7A 4NO3B 3A6BH 4P2OB 3BP4B 4PJ9D 1Q1JL 3KR3H 3QR2A 2A83B 2F9BT 3LKRB 4GFTB 4LSPH 4RMVA 4I0PA 4RMUA 4JLRA 3EFFB 1KLUB 4LSRL 1NKOA 2I07A 3GSQA 2BOCA 3PF2A 3RPIA 3BAEH 1NBZA 4OGAD 4AEHH 5FECB 2V5TA 1V7MH 4X5LA 5DJZA 5DHVH 1R5IA 3FQUA 1CFTA 4KKCC 2QQQA 2AJUL 1RUQL 1FSKB 2EC8A 5I8CA 4P3CH 1NC2B 3F12B 5DGQA 4AT6B 1YMME 3BKJH 4MQXC 2AEQL 1I8IA 2EDJA 4U2ZA 1R3JB 1RZKH 1KELL 3KYOB 4YBLC 2GJJA 4HDIB 5K9QG 1MLBB 1S9XB 1CICD 4CW1A 5C0FB 5IMOB 4HXBL 3CVHL 3ZHKA 1JZ4A 4DKFL 3RIAF 2A6KA 1GH7A 4WTWA 4FQ1H 5DD3L 5CBAB 1S78D 1U58A 4JM4H 4ZOEA 4YXLL 4OI9A 1Z2KA 5INDB 4MNQD 25C8L 3HZVB 4X8JB 1BJ1H 3ESUF 1UZ8A 2FHCA 4D0BA 4MQSB 4XPTH 4CVXB 4RAUB 4LBEA 1HQRA 4PRHD 4PREB 3MLUH 2NLJA 2ICWB 5JIHA 1AD9B 5EU6B 5JR1H 4U31A 4UT9L 4I0KA 5CGTA 5GISL 4HKZB 4P59L 4FFYH 2DM7A 4W6XB 4QHLA 4XNMB 4LNRB 4CU7A 1ZGLB 1ZT4A 2AEPH 2FSEB 2BY2A 3MRHB 1KFAH 4DW2H 1UZ8B 4HWZB 1WZMA 1FL3B 3ARFA 2GY7B 4M4PA 4NO0D 3QWQB 5F96H 4U6XA 2OQJB 4ZO9A 1LD9A 2VXSH 3I50L 1AO7D 2PCPB 4P5KB 1OLLA 5DD5L 4YXHL 5LCVL 3BGMB 5LGHL 1K9TA 5E6IA 3MXVH 4FOMA 1RUMH 3NN8A 4EN3A 4F9LA 5F9OL 3KHQA 5I30L 3FO1A 4WV1B 3U6RB 1FIGL 1T6WA 3I3DA 1K6QL 2EEDA 1S7VA 2XZCH 5FUZH 4HH8A 4ZAKA 1A6ZB 5HGDB 1T03L 4ZXBD 3P4LA 2EDOA 3MGOB 2QQNL 5EZIH 3BRDA 5DJ8A 1BM3L 4XNYL 4HT1L 3HC3H 3RPKA 2BFVL 1VFBB 5DEFA 1WCBA 4JFFD 3MRPA 4WHYH 2E7HA 1T21B 4LQFH 4LHUG 5E5RB 3KVQA 1JPGA 1SJEB 4PJ8A 4XMKH 4E5XB 3F6LA 1U91B 4U7KA 1FHGA 2Z8VC 1MJ8H 1RUKH 2Y5EA 4GXVH 3FOLA 1BVKB 3KDMB 4AQ1B 4EDXB 3C2AH 5D1ZA 5ADPH 2UZYB 4HEME 5JNYA 3VXTB 3LKOB 3MBEC 4M7LL 3CMOH 1MCSA 3TJHD 3ULUD 4M6NH 3BP4A 2ENYA 4X6CF 3ZE2E 1A14L 3KPSA 2HLFD 2HWZH 3BEVA 1U3HC 3RTQA 1JYNA 3NH7H 1QSZA 1QKZL 2ZUVA 3QPXH 1YEDB 4JRWA 1J86A 1M7XA 1IKNA 2HTKC 3G5XB 1OTUC 1RY7B 1FYTB 2EDTA 3IU3A 2H26B 4H1LG 3UJJH 4Y2OA 2E6JA 1SJHA 3DJ9A 2R4RH 2R0WL 5CGYD 1T0PB 2EDBA 3B3IB 5DI8A 3VXRE 1RULL 2EH8L 2KPNA 3MFFB 3ROOA 4GKNB 5GS1B 4LEOB 1MQ8A 1MWAL 4XXDB 5JW5B 3BVNB 1XR8B 5IKCB 3CXDL 1F6AB 5DR5L 3FAWA 4G42A 1KTDA 5CWSB 4MHHI 3D0LA 1J18A 1N64L 3OG6B 5A16A 3QJFA 5JUEL 4NO5A 5TQ0L 3DRQA 4UUJB 1D3CA 4PG2C 1IEAB 3TYGH 3BRGC 4N68A 4LGPB 3GSVA 43C9B 4OZ4B 5EZJB 1SQ2N 1LO3L 3MRNB 1IARB 2OSLB 1MRCH 3QI9B 3U0TB 2CK0H 2KZWA 2AJYL 4WNQA 5C6PB 1XGUB 4LSUH 4WWKA 1N6UA 3JUZA 4L1HA 5EZOL 1CFVH 1OARL 4KTDH 1U3HA 4OQTH 2CXKA 3NPZB 5TF1L 1GYAA 2WV3A 2BVTA 1G7IA 2DLEA 2LV4A 3BPNC 4FQLL 3TZVD 3BKMH 1MELA 1OB1A 4LLQA 2XTJD 3BT2H 4HZAA 5JPNB 3GSVB 4NQCE 3WHE0 3QHFH 3SY0B 4CDHA 3QDJE 2QV2A 1J0KA 1PSKL 4KHXL 4PLJC 1TZGL 3VFGL 2X70A 3HMXH 4AT6A 3MGOA 4KHXH 4TNWF 3ALWA 1E28B 4HK0B 3OX8A 3ZDXF 1A4KA 2VDQL 1B0RB 1MLCA 1FO0B 4O2FA 4F3FA 4OJFH 1CXKA 3TNNB 4QF1A 4QHKJ 1R3KA 1CR9H 1NGZB 4CAGA 2WP3T 1G9NC 4Z7VB 4MJID 3VFOB 3L3KA 4L4TE 3C87A 5T1KB 3H3PL 5I0DA 3FQRB 1F2XK 5DD1H 2JJSC 3GKWH 5B39G 3HI5H 4JZJA 1A7QL 3FB5B 1MHPL 3LQMA 5L8KB 4DZBB 4LFHD 4PRHB 1U0QA 3HMWL 5BV7L 5J1SC 1QPXA 5TDNB 3U0PB 1KCSH 3QEQB 2NZIA 1JPFA 1UXSB 5C0GB 2CLRB 4XCNA 4N8VA 2YD9A 1A1OB 3L3JB 3G6DL 2C1PB 4M1GL 3ROLB 4KTYA 3CSYB 1F4XL 2FATH 4L4TD 3UC0H 1PZ5B 2VC2H 4EDXA 5CUSL 5E08H 1EX0A 4X7TA 2DAVA 1JNLL 2Y36H 2MKWA 4L9LC 3TH3T 3REWB 1OM3H 3EDDA 3B9KD 1EHAA 3FOLB 3SGKA 1XGRB 4JY5H 3H6JA 2OK0H 4ZQKA 1MREH 4GLRI 3N0PB 3TN0A 2I26N 1F3RB 4WHTA 4P4KD 1MCIA 3H9SA 3BDXA 5BO1H 4V1DA 1F4HA 3RP1A 1CICA 3GSOA 3SE8H 4MX7A 3QP3A 4MGXA 2A6KB 3NAAL 3EYSL 3NH7L 2JCCE 3IVKB 1K85A 4HFWA 1BJ1J 4ISVB 2ZG3A 4I0CC 2LU3A 3D9AH 2JJTA 15C8L 3KPOB 1LK2A 4XP9L 4GG6A 5KANI 2VAAA 4KTEL 1C7TA 5I71C 4WHTB 2PN5A 3SKJL 5E9DB 1MHCA 2WINB 5F72S 3UBXB 4KKNA 5LAXA 5E8NB 2YZ1A 4I3GA 4NNPL 3MJ9A 4OCYL 4OLEA 4NZTH 1AHWC 1XGTA 4LLMB 2B4CH 4I5BB 1ZLUK 5C0ND 1BIHA 1AKJD 3C6LB 4NRXA 1MFEL 3CPLA 3G08B 1VCAA 3PWVA 5GQBA 4F37F 2EO1A 5IROA 5IGXH 3AM8A 1KYOJ 2A6JB 5IEKA 4XNYH 1OT2A 3BD4A 2ZUSA 5IHZB 2PF6A 3FQTB 3ULVD 1M05B 2D3VA 3BXNA 1IGCL 3BKCH 1BLNB 4KUZH 1F90H 4E41B 2C7UA 3IDYC 5H35A 1RUML 3NCMA 1NGZA 1MFNA 4N8VG 4HGKC 5LGJA 3HE6D 2EDNA 2GJZB 5EU7C 3VFUA 1SVCP 4PRIA 1EO7A 3O6FB 1DLFL 4CU6A 4HGWA 2DDQH 1BWMA 1LEIB 2IQAA 2CR3A 1AP2A 1LDPL 4DW2L 4OAWA 3EYFA 4XPBH 4FZ8L 4OBSA 3QDJA 1IGFH 3VI4F 4X7SH 3VFWA 4FFYL 5HHOB 1P4BH 3JV0A 4P9HL 5GSRA 1QFUL 3B2VH 4L3AA 1CGWA 1I3GH 4WO4C 1XF5B 2R0ZL 4GOSA 1DBAL 1U8MA 1NAML 5DQ9B 1NAKH 2QKIB 3WLWD 1SJXA 5F7FA 5I8KL 4X4ZA 1KEGL 3B5HA 4KK9C 4U7MA 2CLZA 4QRPE 3TA3B 3FN3A 3LN9A 1U42A 1WZKA 3HCVA 4QXWA 5EOTA 1Z6JT 4PD4K 4XPHL 4MYWB 3TCLB 3K2UL 2QADB 3C8DA 5I19H 5H2BA 1EFQA 4HLJA 3UTTA 5TE4H 1EUUA 4LCWD 1ITCA 4Z0BH 4PJIB 4GBXD 1OP9A 2Z4QB 4OLYL 4S10A 3LN4A 4PRIE 3CZFA 4QF1B 2BNQB 1VB9A 5SWZE 3QEUA 4Z18A 5J6GA 2O5ZH 4XAKE 5IKCA 3T0WA 1RUQH 4OCLC 5E1AA 5HPOA 4NUGL 3MQIA 1F4AA 3MLYL 3OHXA 1WCBB 5ETUB 5HGBA 32C2B 12E8H 3IB4A 1WWAX 5E00B 4QXUH 4LPVA 1AD0A 4XGZB 1FGVH 1ONQB 1VPOH 4JCLA 4JHZA 5CD5D 1WIPA 5IESH 5J13C 4NBYB 4XMLH 4HUKB 2ESVA 4LHQB 3FO9B 4H1LA 4LKCB 1X5AA 2J4WH 3CD4A 4OGYH 4NPYB 3CNKA 1F2QA 1A5FH 5I76A 5DA4A 4JFPA 43CAB 3LEYL 3GDBA 3Q6GH 1OOAA 4FTVB 4HJGB 3UBXG 2C3VA 3IFLH 4PRAA 3NCJL 2CLZB 4HJ0D 5DMGC 3M8OL 3A6CH 3BWAB 1PY9A 1W0YT 4IDJH 3G6JF 5DSCB 3OKNB 4TSAL 4TVPL 2HTLD 5C9JB 1CLZH 3JWOL 2NXZC 3TVMC 1UVQB 2H2SC 5DK0A 5DJ8B 5IHBA 2D7TH 3QUKA 4OI8A 3GMOA 4X6CE 4M62H 1MFBL 3ZE2F 2A2QT 3LD8B 5HYSB 1GAFH 2VWEC 1A6VH 5F7DA 4UTBL 5JW5A 5K9JL 2VXTL 3B5TA 4NC1E 1P1ZB 3B83A 1QLEL 1L9NA 4S2SB 4BFGA 2FX7L 3FB8A 3CH8A 1WICA 3K4ZA 3TT1H 5I1HH 4A2LA 5HHNB 1MEXL 1D7FA 1UXWB 3T4YB 4MXVE 3QG6A 3KPLB 4G5ZH 2CRYA 3VWKD 3P0VH 4YDIH 2EYRB 1S7UA 5I1JL 4QOKD 2QBWA 2IAMC 4HKJB 1BEYL 1T1WA 2FLRT 4M6ML 3FTGB 4Y16D 4E41E 4K7PY 2VITB 4N5ED 3MCLL 2UV3A 3U30C 2BXZA 2YBRB 4LASL 3KPSD 1YJDH 2D9QB 3F7YA 1CFNA 2R56L 4ODUB 2VYRE 1VFAB 2EE9A 4P46B 3H8NA 2BMKB 1KN2H 4YX2H 4PJIA 4FQCL 1J0YA 4YUEL 4OF0A 5AYQA 3RVXD 2Y6SD 1S9VB 4K94L 3F7QA 4O2CA 1IQWL 1EEZA 4LF3A 3QFDB 2DQDL 3EOTL 4KRPB 3GHEH 5DT1H 3QUXD 2LTQB 2XZAH 3HE7D 4Y5YC 1IC4L 3GBNL 1QSFE 2Y06H 4JFQB 4R96A 3SJVA 3TA3A 2X9YA 4XVUD 3VFSA 3AS1A 4GRWH 1WZ1L 5IB5B 3BD3A 4JR9L 1JN6B 2YA1A 1B4RA 3ARWA 1CFBA 2VOTA 4TRPH 2XT1B 4N0UB 1A6ZA 2E9WA 2RHEA 1T04A 3IDMB 2F53E 4AEEA 3ARDD 3TIDB 3MJ7A 4NQEA 5CD3A 5FO8A 1BOYA 3GMLB 5BXFB 4EDWL 4TNWK 4HIHA 1T22B 2LU7A 3QT2A 1IGJA 3IFOB 2RBLA 2NY5C 5MI0B 3PL6D 3ARXA 3EOAB 3PP3K 1W72L 3GO1H 1KTLA 4NKMB 3VXNA 5E1AB 5HGGS 1MVFA 4CKVX 4XVUC 1ZA3B 1G84A 1VA9A 3OAZK 3G5YB 3I84A 4OCSH 3MRHA 4LLVA 3PIQA 5FKAA 2C1OA 2AK1H 5KSBF 2OL3L 1G7PB 1A8JH 3GFUA 2MJWA 3QNXB 1TCRB 4KK5C 5GRXG 3GSRA 3RVTD 3MROA 1KXQE 5C08D 3UTPE 5FYJU 1CS6A 3IDNB 3WJLA 4H0GA 4JG1L 1CLYL 3D18A 4G8GE 1BHGA 4ODXA 3DOSA 2H8PA 4JR9H 3RAJL 2X42A 4P5TA 4Y2DC 35C8H 5DRXB 2C1OB 4PLKC 4U1LB 3MRDB 4N9GB 4OGXH 4XNZC 2F8VA 3JWOC 4MWFB 4DGIH 4JJ5B 4HIXL 3T0ED 4NO2B 4ZS7H 2P42B 2XQBL 1I4FB 1MCCA 2H32B 4U33A 4JVWA 1HIML 1R3JA 5D9SB 3GHEL 1IAOA 2Y72A 4L4VD 2IADA 5DT1L 4D3CL 4NIKB 1TNMA 5B21A 1PG7W 3UTSB 4GS7C 3MJGX 5GS1A 1UWGL 2H3NB 3C6LA 2D7OA 5DHYA 5FM8A 3TBVA 5C3TA 3QQ4A 4Z7NF 1CU4H 1YJDL 5KN5A 2D03H 3EYFB 1UM6L 2AVGA 3OG4B 5IW1A 1WV7T 1CI5A 2DN7A 4M6MH 4JLRB 1YY8A 3FN0L 1U8NA 5AZEH 1N6QH 4W6WB 3D3VA 3VXRD 1BEYH 1BZ7B 2R23A 1YEIL 3RVWC 1AJ7H 1FE8H 5KVDH 5E03A 5H35B 4E41A 4EI5C 2VISB 4QRPA 1XT5A 4JHWH 3QDGE 3P0VL 3MYJA 5EB9A 1WGOA 5ILTL 1MI5E 2K7PA 2NXZD 2OM5A 3W0WA 4LKXA 2ITCB 4JQVC 3LKRA 4NQVA 5IHUH 3TT1L 5M95B 2DJSA 4BK4A 1M05A 2WBJA 1UJ3C 4KROB 2BMKA 4ELMA 3GNMH 2ZKHL 4HKXB 4O9HH 5IQ7H 4MAUL 5K9JH 4ODXB 4RMRA 3NZHL 1U3YA 4Z7UB 4Z7OF 3NOIA 4JKLA 3LDBC 4N0FA 1E0OB 4X9BA 5I17A 1YECL 3FFCE 2D7TL 1N0LA 4BUHA 3MX0A 4LBEB 4NNXB 5EU4A 5GSVA 1A7RL 4JVUA 4PJGA 4B53A 4EUPG 3MOAH 5T3XE 1U2HA 3MJ6A 5CD5C 5GS2H 2D31B 1MCJA 4OD3H 1C5CL 3SGEH 3C2SA 3BIAX 3MGTA 3GI8H 3A6CL 4NQCD 4NKMA 3HPLA 4HF5H 3SCMB 2D7QA 3VXPA 1KPVA 4MD5B 1ZVSB 1U8LB 5EUOE 1E4XL 2EEBA 4PGEB 3PP4H 4HFUL 5T1DH 1XH3A 1NGXB 4EI6B 4Z77B 1IC5L 5CS7A 4PRDB 4MA8H 4PS4L 4YGAB 3C8KA 3K4AA 3V6BR 3O3BA 4EZMA 2CUHA 4Y5YA 4IRSB 4Q58C 3VRJB 1YPZA 4KMTL 4WFHD 4FP8H 4KHTL 2BNRA 3I6GA 3O6KH 2V5YA 2GT9A 1DQML 3MLVL 5AUMB 1S7QA 3O81A 5D72H 3BH9B 3V5KA 4R7NB 4NT6A 3GGWA 3RVXC 4U6XB 1R3IH 5J0BA 4X7TB 5KG9B 1VFAA 1KN4L 2Y7QA 2VLKB 3P40A 4BJLA 9CGTA 4NUGH 4PTTA 1RJYB 1ZT4B 4RMSA 2GFBB 4GBXC 3UTZA 5D96B 2W0LA 4HQQL 4DN4L 3MBED 5IVZA 1NPUA 2DL9A 3JTTB 4I9WD 3BWUC 1I7TB 2QQKH 2YC1A 3UDWA 3W9DA 1GOFA 1KXVC 2VWEE 3QDMA 1OAKH 4IOIB 3O4OC 4PJ8C 3ES6B 4Z0BL 1S7WB 2IAND 4HKBB 3EZ8A 3L7FA 5GS1C 2I5YH 5KVEH 1U8IA 5C09E 4UAOB 2DQUL 1BAFL 2P5EE 2OR8A 5GGRB 3I9GL 1U58B 4IOSD 3TH2T 1EERB 4HFWB 4ISVA 5I2IB 3KNBA 1J1XH 2JJSA 3O4LA 3KLSA 5IFHH 3QO0A 3FOMB 4WI6A 3V4VL 4S2SA 1LMKA 1F3JB 3AS0A 2ZCKH 4WW2F 3T2NH 3DX6A 5I8KH 4MD5A 1B0RA 1MLCB 3S36X 3UDWC 3PIQB 4PJEF 7CGTA 5SX4H 3SDCB 5MENA 4M1DL 3WSQH 5JW4N 5FHAH 3TBYB 5E4EB 1XGYL 5DZLA 4DWHA 4MMXC 4XP4L 2FSEA 1DN0A 4JN1L 1TJHL 1V3JA