2F5AH

Crystal structure of fab' from the hiv-1 neutralizing antibody 2f5
Total Genus 43
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
43
sequence length
232
structure length
228
Chain Sequence
RITLKESGPPLVKPTQTLTLTCSFSGFSLSDFGVGVGWIRQPPGKALEWLAIIYSDDDKRYSPSLNTRLTITKDTSKNQVVLVMTRVSPVDTATYFCAHRRGPTTLAAAAAAAGPVNAMDVWGQGITVTISSTSTKGPSVFPLAPSSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYTCNVNHKPSNTKVDKRVEP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystallographic definition of the epitope promiscuity of the broadly neutralizing anti-human immunodeficiency virus type 1 antibody 2F5: vaccine design implications.
pubmed doi rcsb
molecule tags Immunoglobulin
molecule keywords PROTEIN (ANTIBODY 2F5 (LIGHT CHAIN))
total genus 43
structure length 228
sequence length 232
ec nomenclature
pdb deposition date 1999-04-08
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2f5aH02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2f5aH01
4JFZL 3IKKA 3L7EA 4WU7A 4HDIA 5IQ7H 1OL0A 1ZHBB 4B0MM 4R8WL 5HY9A 5F97E 3ARBD 3E8UL 4CMHB 3J8F7 5L9DH 1EX0A 2CK2A 4EDXB 5D96B 1LEGA 43CAB 4LLDA 3R8QA 3HLAA 4PJDB 1SBSL 5I15L 5KVFL 4PJFA 1A7RL 1F2QA 1EDQA 4AM0A 4LSUH 4G6AD 3A6CL 4ZS6D 5IVXE 4UB0L 4DVRL 3BVNB 3BGFC 5C0EA 4FFWC 3VRJA 5LAXB 3I6KA 1Z5LA 4JCLA 1R3KA 3DX8A 4EI5D 3QUKB 5FO7B 4D0BA 4PTTA 1BZ7B 4TPRL 1UM4H 5IB1B 3PABA 1X5JA 4HLZG 3RIFK 1KJ2B 1QLFB 3TA3C 3O11A 3V4VL 2FJGB 1JZ6A 4BZ2H 1LGVA 1AGDB 4QXUH 1F3RB 4PJXB 2BOBA 3ZMRA 3IXTA 4WO4B 4M6NL 3JV6A 3SGKC 2J7LA 5JOPE 1OTSC 1FNHA 1S9WB 5GRYA 1A4JB 3QPQC 2B2XL 3B5GA 3P0YL 3QDJB 4Y5XB 3TVMC 4OCLC 3X3FH 4JFEB 3MRGB 4WEBL 2IBBA 4GKOA 4OLZL 2A83A 3B8SA 3L3HA 5A16A 4HSQA 1DE4B 4EN3B 5TE4L 3V4UH 1IKFL 1TZGH 4QRTB 1YEKH 4OD3H 1EHXA 1RUAH 3MRKA 5FGSA 5HHVL 2MKLC 1KEGH 4YDVA 5FF6A 4FQ1H 5F9WB 4MDIB 4MZ2A 3R0MA 5B4MC 8FABA 4HWZA 1AXIB 2IQAB 1M71A 2VDOL 5KVEL 1E27A 5JA9A 4NM4H 4X98B 4LF3A 5D7LA 3SPVB 1F4HA 1CIDA 1NPUA 5MP6H 2BSSA 1CZ8H 3LDBC 3LZFH 4OT1H 4UDUA 3TPUB 3FHAA 2ORBL 5L2JA 5J13B 5L8KB 1KJ3L 3I6GB 4EUPH 1MH5A 1DUZA 3V5DB 1YEGL 2P47B 3CX5K 4YXKH 4JQVA 3MRHA 4ZUUA 1CXIA 3QIWD 2PO6A 3QEHA 1T80A 5K9QG 2R1XA 3WNOA 4POYA 4QXTA 4OD1L 3RAJL 5HDQL 3DX8B 5ACLA 4HIHB 2QTEA 1XMWA 3ESUF 4NNYA 4ZFOB 4PRHE 4PRIA 2ERJC 3TVMA 5LBSL 4S1DD 2XRAH 3WFCL 4OSUL 1CU4H 5C0AB 5GRUL 3IAGC 4P0DA 3DWTA 4JZJA 2DWEA 3ARPA 3QIBB 5LGHL 4P23C 3BW9B 3PXJA 1RZ7H 1I8LA 1LEIB 3QXTA 3DYOA 4BZ1L 4KPHH 4R97B 3UYOD 1JTOA 1NL0L 5IIEB 3ZE2E 2VDKL 2QADB 1QYGL 4RISH 4PREA 1TFHA 5LKNA 3IJYA 4LHUG 4M7ZB 5F7YC 3PL6A 3UYRH 4PTTB 1EMTH 4WU5A 2FWOB 5CJOL 1JZ2A 3P4NA 4QRPA 2D2OA 1XFPA 4BKLA 1FC1A 1WBZA 2E6QA 3PWLA 2D0HA 3RWIB 1Y6KR 5I19L 3MRKB 4X99A 4OZHB 4RFOH 5JR1H 1QKZL 3EJYD 3SDAC 3FB8B 3KG5A 3OJMB 3CAFA 5EBMB 1DSFH 3IXTB 4WO4A 3ABZA 3VWKB 3SEPA 4CN4A 4ZTOL 4HK3J 2GK2A 4K94L 3HNVL 5J06A 3KS0H 4KVNH 3TM6A 4GT7A 1UCBH 1GIGH 3OAZH 1FIGH 1O7VA 5IBLC 2H32A 2JLLA 1KCUH 5L88H 3UO1H 4QRTA 4XT1C 4Q9QH 3WIIH 3DXAB 2W1NA 3CZFB 1HSAA 1C7SA 3VGBA 1X5AA 3WS3A 1T0PB 3RTQA 4HWEL 2VB5A 4XCEA 5EZLB 5E2TL 1F6AB 4G8EB 2ERJB 3PWPE 3V52L 3ARDC 1MHPL 2PCPA 4YNYB 1TTGA 2CDGB 3MRCB 1PQZB 3D3VD 4O00A 5FA3B 1Q94B 3SY0B 4XC3H 3ES6A 1MCNA 4IJ3B 4P4RA 1AH1A 1Q9KA 3MOAH 5KAQG 1R3IH 5CSZB 4G9DA 3K4AA 2MMXA 3Q6GL 2JJVA 5ICZA 5JA8B 3U83A 2ZOKB 4OFVA 3LEYH 1INDH 3L9RA 3TGXA 4JRXD 1W8NA 4PR5B 2Z93B 5FK9B 5C6WH 5SX4I 3TIDA 1AC0A 1X5LA 4LP4A 3GI8L 1DN0A 3QB7C 2IQAA 3LRSA 4ZPTB 3OXRB 1PEZA 4RAVB 2CDFA 1EZVX 4H0GA 5ERWB 3G6JB 4K3JH 4Y4FC 4P4KD 3ZKSD 5KAQF 5HGHB 1YECL 3CDGA 3BN9D 1ZXQA 1G7JB 4PJCA 4L8SC 2NR6C 2ICES 3BPNB 1HKLL 3KPSE 3W5NA 1K4CB 2FO4A 5GGTL 1U8HA 5I1HL 3UP1A 1TCRB 3SDDC 2KKQA 1RZGB 4XCYA 1KIUA 1P6FA 3MLTA 3QCUH 1KCKA 4LLYA 4LIQL 5JW5B 4K94C 1RUML 3QG6B 4MX7B 2V5RA 3T2PA 1G7PA 1XF5B 3PWVA 4NM8L 5FYJE 4HDIB 4HHAB 3HFML 5I74B 2CGRH 3RIFF 5C08A 5GJTL 5EH1A 3O81A 3RNKA 5LWYL 1B90A 1J1PL 1YYLL 3SCMA 4PB9L 3MLVH 4RQQB 1OTSD 4WUUA 4XBGA 4PRAA 2HKFL 5EN2B 2BNQA 4Y5VB 4KDTC 4C4KT 3P4OB 3ZT5A 4ODXB 4FNLL 1EFXA 4YEEA 2BXZA 3TA3D 3T65B 4QRRA 4DEPB 3BRFA 1PDKA 3VI3E 4YC2C 3BH9B 4PJEF 4PGEB 3GK8H 2BNRD 3CJJA 3RWEA 1LNUB 1VFBA 3DO7A 2V7HB 5J11C 5FOBB 1SJHA 1IAIL 4N0FA 1IM3A 4EI5C 2JCCA 3CLEH 4OB5H 1A0QH 1JNNH 4AEFA 2BNUA 4WW1A 4TSCH 5IKCB 5E2WL 4ZS6C 5FO7A 3OB0K 1I3RA 4PJ9D 2G9HB 4M7ZC 3L9RB 3BQUB 1FZJB 2J8UA 1NFIA 4W4OC 4MA7L 1RQ5A 3GMMB 2D7PA 1J18A 1ZAGA 1FE8H 1KIPA 1MQ8A 2X44D 3OZ9H 2HKFH 4TVPH 1ZS8B 1KGCE 2E9WA 4LQ1A 3GSVA 1ZLUH 3IDJB 4PJXA 4KDTA 2XFXB 2BFVH 4OBRA 2PCPB 1Q8MA 2CUIA 4RFNC 2YUZA 1OSPL 1AD9B 1RJLA 4Y4KD 4NM8H 5FIEA 3KHQA 4GG6A 2H32B 2ZG1A 1T6VN 3QEGH 4FN0A 1F6FB 5DSCA 1B9ZA 3FRUB 3IKCA 5IVXB 2XY1A 3KPNA 1NMBH 4QTHB 1MRCH 4WFGE 3BIKB 3TPUA 3VGEA 4GBXD 5HI4C 1AFVL 3OJVC 5GGTH 3R1GH 1S9VA 1OAXH 1MJJA 1I9IH 1HKLH 3OR7A 2XI9A 4X5WA 2WBJA 1JFQH 2OMNA 5JIKA 1GOFA 2PR4L 4MDJA 3D9AH 4O2FB 4G6JL 2YMXL 4XHJC 5IW3A 5IMLA 1DCLA 4M7LH 4K3JL 2X4RB 4M7JL 3V9FA 3FT3A 3SCMB 3OJDA 3MBXL 3K0WA 1KIQB 3EW3B 3BX7C 4F80A 1MH5B 3QWRA 4OCYH 3HMXA 5DVNA 2A6IB 5B21A 2X4UB 4JPWL 3S5LG 3QJFA 1J8HA 3PQYB 3JVGC 1FO0A 4N68A 3UTPE 2DIJA 2D4DA 5HYJA 1VFAB 4LVHC 5C9JB 5K9OB 4WEMB 3HNSL 3ARDA 4RFEB 5EBLB 1FFQA 3QNYB 4RBPK 2V5YA 5H35B 1CGUA 4Z7WA 5EUOF 4X4ME 1MFCH 1ZT1B 5JHDD 2C3VA 4FQJL 2AK4D 4DN3L 2MCG1 2FYYA 1IAIM 2DYPA 5CP7A 4HWEH 3KPMB 3A6OA 4WUUB 2R1YA 3TVMB 1N26A 4LSVL 3GSNH 1UEYA 3VFSA 5C0AA 3KYKH 1PZ5B 4WI2A 5AZEH 3VXMD 5IMMA 4MZ3A 1AI1H 5L88L 3KLDA 5D7SH 4PLKD 5GISL 4YHZL 1D5XB 2IMNA 1T2QH 4Z95L 1CTOA 1NAMB 4PGEA 4P2OA 2OTPA 4NP4H 3T2OA 1YYMH 5E8PB 1EXUB 3U0WH 4X7SL 1M6OA 4QOKE 5E5UB 4P2QA 3HNVH 5I1KH 5IK3B 2BSRB 3ETBF 5ID0B 3OG6B 3PHQA 4U1NA 1D5BA 4UAOB 4ZTOH 2F53D 4XMPH 4PJDE 4PJ8C 1DLHB 1DVFD 2XG5A 5INCB 1UWXH 3B9KD 2O93L 4GQ9H 3IFLL 5GHWL 3P77A 4FTVB 2J5LB 2QQLL 4QT5B 2YSSB 3RL1B 3FT4A 5IJVB 2DM2A 3MRLA 1EH9A 4EVNA 1PYWB 1KIPB 2Z9TA 4GRMB 4QGYA 4XAKE 3CZFA 1VENA 3MC0A 3OL2A 3TJEH 5HGBB 5FUZL 4FXGB 1NGZB 4X7EC 1YMMB 4JHBA 4QYOB 4WFFE 1G0DA 3AY4A 4NC0B 2O26U 1Z9MA 5JHLH 3FO9A 3FB5A 4RISL 1NGYB 3AB0C 3OAYH 1DBKL 2VO5A 1QYGH 4GG6B 5DXWA 2Y6SC 5HHOE 4Z76B 5HHPA 2W65B 4LSQL 3LKRB 3WXWL 3S7GA 2IBZX 1CDGA 4C83B 4JCMA 2EO1A 3LSOA 3SQOL 1WITA 3S88L 4YBLC 5GRUH 3IDJA 2YEZA 5F71A 4XNYL 4FQ2H 2DQJH 1Q94A 1MREH 4Q0XL 4PTUA 1IEHA 4JANA 4FFYL 4E9LA 3H3PH 4JFXB 4G8EA 2NXZC 4CVXB 4RMWA 2GY5A 4J3TA 2AKRA 5KN5A 1CE6A 4WTWA 2PTTB 3L5IA 1CE1L 2NY7L 1LVEA 3R4DA 4KXZI 3VG9C 2VLJA 4R2GC 3SDXF 5MEOB 1KN2L 5EO1A 1P1ZA 4B41A 3LZFL 4OT1L 4PJ5B 1QRKA 3CFEB 2OL3H 3L3DB 4PV8A 4U6TA 4YIQB 3QNYA 3ZKNC 5D2NE 5EBWB 4KRPD 5HVGB 1ORSB 1QLRB 4N8CH 2XNAB 3OJDB 5IMOB 1ZVSB 3EGSB 1OAYL 4L9LB 4HIHA 2DYPB 3F12A 4FQ1L 4WW2A 2I24N 3KPRD 4G8FB 3RNKB 1UJ3C 4NO0B 4UU9A 1KEGL 3S3JA 5DGQA 1RURH 4HGKC 2EDDA 3MV7A 1NFKA 4CU7A 2CDEB 3U46B 3MZGB 2EH8L 3KNBA 2P5WB 1OWWA 2DBJA 3BISA 1C5BL 3U4AA 4ZUSA 2VQ1A 5DC4B 1UM6H 2DLHA 3W0WD 1D5XA 4QNPF 1G7QA 3GSXA 4G8GE 2VN4A 5F1NA 3OKDA 3X3FL 2XXCB 3HC3H 1XF3B 3G6JF 1U8OB 3EDEA 1S9KC 4LL9A 3MBED 1P4IL 2AEPL 3MRGA 4NN6C 2R1YB 4PG9A 4WV1B 3S36H 3RU8L 3LKPB 4YHLL 4I2XB 3ULUH 4I13B 4H8WL 1CGSL 5SWSD 3ROLB 1U92A 1RULL 3JWDC 3C8DA 5BOPA 5MHSE 2IPKA 1JI2A 1KTDA 3MCLL 4ODVH 5DRWB 3RI5K 2YC1A 4ZFGH 5JIHA 3C09C 4XP4L 3HMWH 4TPRH 4KAQL 4ELMB 3S98A 5MI0B 5KZCD 2WINA 3HZKA 5FFLA 4OGYH 3QQNA 5EIIB 2WM0A 3WHE1 4BA8A 5KSVA 1JF1A 5AUMA 3PV6A 5E1AB 2ICWI 5H37H 2VL5A 3VRIB 2IAMC 4N0FB 3FB5B 4X4XB 3MV9D 3JV5A 3MODH 5C0CE 2V17L 3EBAA 3CPLA 5GRXG 5LQBH 1R6VA 1LP9F 5I76B 4AENB 2Z35B 3C5ZD 2X05A 5F3HB 4U1KB 3D0LB 3PJSA 2V7NA 3WS3B 5DR5L 4R7DB 2ZSWA 5DQJB 5CS7A 1MI5B 4E41E 3BIKA 4P4KA 1S9YA 3KPOB 1BJMA 3MO1A 3QA3A 2XYCA 4JGJA 1YNKH 4JFZH 4Y5YA 2ZOLB 2Y72A 3QNXB 1G9NL 5DSCB 1QNZH 1W72L 4KVCH 3ARFC 3QXVA 1FNGA 1IFHL 5HHQA 1JPGA 1HWHB 4KKLC 4R4FL 4XB7A 1AGCA 5E4EC 1B3JA 1X9QA 3IDIA 2CKBH 4HUUB 4M1CD 2OSLA 3Q48A 5IB1A 1I7RB 4ELME 2X4PB 4N0CC 2GJ6D 5DMKA 4K07A 4HUVA 4BQ6A 3L3DA 4MD4B 1RJZA 4OFPA 3UJIL 4NHUB 1CBVH 1CFTA 1F90L 2QR0A 5HPMA 3IJHA 1KJMA 2D0GA 4LCUA 3BPCA 5I2IB 5HDLA 4XMKH 1T21B 3RP1A 1LHZA 4PRBB 4UU9B 1HXYA 1A6ZA 4LOUC 4JO1H 4DGYL 4OM0H 1KG0A 4HJ0D 2WV3A 2GSIB 2AJUL 1DDHA 1NCCL 3W0WA 1PZ5A 1DP0A 1OT1A 3G5ZB 2X89D 3VW3H 1G7LB 1SEQH 3LQZA 1HNGA 1MNUL 1I1AC 2D7OA 3L7EB 4XRCA 2JTDA 4XNUH 3IVKB 3ECBA 3KPMA 5FUCE 5DO2D 4POZC 4CL7A 4OZFB 4LLWA 1JK8B 2E6JA 1UQSA 4NZUL 4NKIH 1CXFA 4PLJD 3CFBB 3MA7B 3EJZC 1DBMH 4M3JA 4P3DA 5BRZA 1ULVA 3VXRD 2HFGH 3FOMA 2AK1L 1PEWA 5DJYA 1LO2H 3BP5A 4JDZB 4KROD 3DXAA 4LU5L 3EYSL 1DLHA 1A7NH 2P5ED 5EU4B 1ETZB 1CFQA 2OTWB 5KS9E 1EJOL 4RCAA 4X80H 2C4XA 4DKAA 5I8KH 3MO1B 2BSRA 4JG1L 2ZPKL 3VMOA 1JPSL 2YK1L 2ZOLA 4JR9H 4GRMA 4LLQB 3ULVE 1EXUA 2X1OA 4O9HH 2OJZL 2FD6L 3SDXA 2B1HL 4FTVA 1HILA 4F3FB 4JQXC 4OJFL 1B0WA 3ROOB 2FECI 1K8DB 3V8CA 1T1ZB 2OZ4A 1NC4A 3ORJA 4EXPX 3S4SB 3AS0A 4H88L 2A6JB 3QFJB 5GRZA 3KWWA 5D71L 3MRRA 3WO4C 2GI7A 1S3KL 4JVPA 1CFVL 5KW9L 3K74B 3BKCH 2I60L 4OCWH 1P2CA 3FMGH 4DW2L 3U2SB 2QEJA 3JXAA 5IIEA 1QFUH 4YHOH 2ZCKH 4DKDC 4HXBH 1TETH 4XNZB 3WN5C 2EH7L 3AMKA 4P2RA 5HVHC 4F15B 4M1GH 4RGMC 4LHUB 5DHVH 4U3CA 1KCRH 3CU1A 4AEIL 4EI6B 2NY0C 1FFPA 3RDTB 3EYQD 2AJ3B 4N8PA 1OHQA 3S37H 1IAII 4FQXA 3TNNB 3MUGA 3OR6B 4JFDD 1JE6A 5D1ZB 5FYKL 1IC4L 4NQCB 4UT7H 1INQA 4HXBL 3DYMA 2VXQH 4N8VA 2I9LA 5E9DB 2NY0B 4IIQC 4HIXH 3ULSB 1NLBL 1QFUL 2ZUQC 3ARFB 1A14H 1MVFA 3BFOA 2FH6A 1I9EA 1A3RL 1A7BA 4MSWB 4OCWL 3T0BA 1HHIA 1NGQH 1WT5C 3HE7A 3MROA 4HH8A 4K9EC 4N0UB 3BKCL 4XNZC 3IDNA 3QDJE 5DT1L 2B7DT 1FL5B 2C1OA 1EUTA 3B83A 5TPWL 3WEXB 1D9KC 2Y36H 2PKDA 1JHLH 1DUZB 3NZHL 1CD1A 5DA4A 2R4RH 3BUYB 4P2OD 1I7UA 5D7KD 3WO4B 3GSOA 3QI9C 3AMLA 5JPMA 4LCWD 3T0ED 2FR4A 3A6BL 2FGZA 1U2CA 3C9NB 1T22B 3FCTA 4O9HL 3RGVD 4BFIB 1S78C 3OKDB 3W2DH 4YE4L 1LK3L 1LK2A 2XICA 5IGXL 1HOCA 1OCWH 1BOYA 1WZLA 1N4XH 1U8PB 4MJID 3BQUA 3C09B 4J3UA 3D48R 4QNPE 3UXFA 5C0FB 2NY4D 3VXUB 2H6PA 1IEAB 5GS0D 3OAUL 4UT9H 3GRWL 3QUXC 4N9GB 1DEEA 5T1MA 1A3LH 5EOTA 2NW2A 3ME0A 3QIUD 3T2QA 1U3ZA 3MCKA 1X5GA 1QFPA 5D9SA 3O45A 5I18H 3QCVL 3MBEC 4RDQG 4P4RB 2R69L 5ETUB 3JZ7A 5I17A 3BZ4B 5ILTL 4WV1A 1NCCH 4X4XA 4NRXB 2WAHA 3MRDA 3GSNA 1CR9H 4NFDA 4YPGA 1FFPB 4O5LL 3G5XB 1EHLL 5AAWA 3QCTL 1ZLVK 1AR2A 5SWQA 5DWUH 4YFLI 3MLWL 4LKXA 3HUJE 1AJ7L 2VLRD 1BAFH 1S8DA 3F5WB 2VR5A 4PFEA 5IQ9B 4ODBD 4PJAE 4XMKL 1CLCA 3MGTB 2H2PD 2FEDC 1XF5A 4OZIA 3OXSA 3LQAC 5ITBL 1K8DA 2P8MB 1FG2B 2MKWA 1PLGH 2ADGA 4P2RB 2HFTA 2RIKA 3KPPB 3RY6A 1A1OA 1OGTB 4YBHA 4AG4H 5CP3H 3PHOB 4R96A 5CJ8A 3JWDH 4ZUWB 1J12A 3ARGD 2AJSL 3BUYA 3VGFA 4AENA 3RVUC 4M8QA 2BVYA 4P9HC 1BPVA 3LH2L 1DL7H 1QUNA 2ATKA 1MPAL 5KSAA 1BREA 3DSFH 5KANI 5I30L 1VFAA 4M43L 2W59A 3VGAC 4BFGA 5EZJB 4O4YH 3C6LB 5CBEA 1YJDL 4FQLL 3QO1A 3HS0A 4WHTB 1QRNA 5F8QC 4P46D 1G6RL 3TO4D 2IH3B 1IGYB 4XCNA 1JNLL 1AQDA 5D7IB 3CC5B 4OI7A 1RPQA 4AQ1B 2CIKA 3TH4T 3MMEB 2HN7B 1JPTH 1MUJB 5C0CB 3UBXG 1I8KA 4RAVA 4NRZB 4XWGH 5DD6A 4PGCA 5ANME 5ACZA 5HD8D 1NFIB 3EIFA 4MAYD 3LVEA 2IANA 1A7PH 2GSIA 4U1GB 3K80A 4UBDC 1KTKE 1U6AH 1L9NA 1HH9A 1I3UA 5SWZA 1N3NA 5IW6A 5D70H 3D85D 4RMSA 5MEQA 4P48A 4XPAL 5GIRA 5F1OB 1VSCA 4G5ZH 1RHHB 2ZKHL 1I4FB 3PV7A 5EUOE 1VGEH 3NVQA 4NCC1 5BRZD 1OGAB 3MCLH 4ODVL 3E6FA 2APWA 1Y18B 2DQGL 2ZKHH 5F6IB 1CGSH 3O3EA 4XPAH 1FSKC 4IRZH 4PJ8D 3LHPH 4UAOC 5BQ7B 4I8DA 4HUWB 4FXKA 1OT2A 3UBXA 3HC3L 1H3VA 4K71B 3OXSB 4DTGL 3CZJA 4LLQA 4YHMH 5C0BB 1I3GL 1K5NA 5DLML 1QBBA 3IKCB 5IVXA 1LO3L 4Z7NE 3OGCB 4HH9B 4HS6B 4F7MB 2R23A 1DTUA 4PLKC 5B39G 4CAGA 4RAUA 3ARUA 1P4LA 2MTPA 4PRHD 3K1KC 2VLRA 2X4SB 3HPLA 2O61B 3S4SA 4NBZB 1QFWH 2Q76A 4QHUA 4ODSH 5AUMB 5IHZB 2EDBA 1CVSC 4WNQB 2YPVH 1L7IL 1K8IA 1KJVB 1UA6H 4QRQB 1JGLH 3L3IB 3ARQA 4GW1A 2OL3L 5ICYB 4RA0C 5CZXD 1ZT1A 4BK4A 3X12B 5J0BA 1OTUD 4GRLC 1KTLB 1EEQA 3MV01 2CXKA 4IRJB 4UT6H 1KN2H 5F7DA 4KTEL 1FNSL 3GSWB 4G7VL 3ZL4L 4UOW1 5EO1B 2R1WA 1FO0B 1HSAB 4PJXE 1GGIH 2IG2H 4K9EL 5IG7B 4KHXL 1D9KA 2BY0A 2KDGA 1U9KA 3TP4A 4W6YB 4JZNA 5D7JB 1RJLB 4NN5C 4KGLA 4OGAC 5F44A 3IB4A 1BZ9A 4DGVH 1INQB 5I1GL 2NXYC 3FQRB 3H3PL 3O4OB 4ZSOB 4ZFZB 1MREL 4Q0XH 1YMHB 4EUPB 4OGXL 3UYPA 2XKNB 5DHVB 4F7EA 3W9DB 2EXYC 4K7PH 3CXHK 5E1HB 4PRID 1MEXL 3I6LE 4GBXC 3FB7A 5H2BA 4AJ0A 1FAKT 3GMQA 5E4IA 1CICB 2OZ4H 2EKSA 5ILTH 1QSED 2RBLA 5IK3A 1U3YA 3QZWG 3AVEA 4GKNA 3FN0H 3IS1X 4MNQE 5I18L 4G6KL 4LPTA 3DUUA 4XNXL 1S7TB 3HE7D 3O2WL 1A3LL 1OTTC 4UT9L 1KB5H 4L8CA 4NDMB 3T08A 6FABH 5D2LB 4Q2ZB 5C0IA 3V6ZA 1MLCA 5HYSG 4U1LB 5E8DH 1P7QB 4XMPL 2C4FU 4FQXC 1J87A 4ODUB 5D1XC 4P57A 4MA8H 2EE9A 3PWVB 1MSPA 4X4MA 5E70A 4ENEC 1BOGB 4MMXC 1NANH 1IGFH 5J12B 4XCFL 5C3LD 3OKNB 2FLRT 2IFFH 2C7UA 1VB9A 1RHHA 5CIPA 1XEDA 5TJWK 3PF2A 4KRMB 1NMCB 1VADB 1TVHB 2O5XL 1JZ3A 3O2DH 3B2UD 3HR6A 3GSWA 3KLSA 4XPTL 5F7HA 5HVFB 3CH1A 2WUCL 2YKLH 1KUMA 3O2VL 5C0JB 2UWEB 2Y06H 3WFHA 1P84J 3D0LA 3PJSB 1LO4L 4PBXA 3MR9B 4MNQD 4ZNEA 1XGYH 2HRPH 3BSZH 3MREB 2H2SC 1Y0LA 3BH9A 4FQJH 4JFXA 5ADOL 2J1KA 4JDTL 4MS8C 1LDSA 1MFCL 5D1ZC 3GMPA 3TBWB 5KVGH 3UTSA 2WZPD 1WZMA 5F7EL 4LF3B 2V9RA 4UDTA 1KNOB 3E3QC 1ZT4B 3HNSH 5IKCA 1TDQA 4JFEE 4QT5A 3PP4H 2VLJD 1YZZA 5T3XD 2CSPA 5DZLA 3GSNB 2YS4A 4TSBH 2LU4A 2N7AA 5FM4A 4M48L 2BNRE 3NPZB 2X4QB 1KFAH 1TZHA 1JPFA 3LN5A 4B7IA 2QKIA 4MD4A 4XWOD 3BW9A 1TETL 2W9LA 5FYJH 4XVTH 1NCUA 2AEQL 3HKFA 1HCVA 4M7JH 4M7LL 3S36X 3PDOB 2V5MA 4Y4FD 4DW2H 3AREC 5HHOA 5ESQB 5JXAH 2DQEL 1NKRA 5FCUL 3RVVC 2I60H 4NNYB 4ZUWA 4TQEH 1JFQL 5JPNB 5LGJA 4JY4A 4L8CB 1PKOA 1IQDA 3STLA 4Q2ZA 3QJHB 1AP2B 1CDHA 3WHE0 1AGBB 3P0VH 4NQSB 4DKFH 2Q87A 3IXAB 4HLZH 3NA4A 5DJAA 3SJVD 4HFUH 2ATKB 3WKMH 3X13A 1CICA 1EHNA 3CVHA 4JHWL 4HPOL 3V4PH 5C09B 3KJ4B 1GVIA 1IEBB 4L9DA 1U58B 5IMLB 2YHGA 5EBMA 3I3DA 1E4WH 2X4OA 4KI5C 4Z7QF 3SO5A 1JF1B 3BKMH 1JNJA 4ODHL 1C5DB 2VLKB 3HR5A 4AEHH 3LRGA 5F1KC 4ZOCA 3QWOB 2A1WL 5F88B 4NKQB 3WLBA 1Z9LA 2XTJB 2DLFH 4X80L 2FJHB 1G7MB 2EICA 4JQXA 3ZE2F 4OCXH 3TYFB 3DV6A 3KDMA 5DRWA 4WUKL 4FZEL 4QRRD 3WNNA 2AQ1A 3FTGA 4RNRB 3P4MA 3MLZH 1NMAL 4E5XB 3LMJH 3EFDH 4YHKH 4BQ8A 3WNKA 3LQAL 4OD2A 1I1AB 2FR4B 5IM7A 5CZVH 1MFDH 3QUMA 3ELAT 4D0DA 3DUUB 4KK9C 1NC2A 1IAIH 2X70B 3B6SB 1BD2A 1DQJA 2VWEC 3K8LA 5ADPH 3SDYH 1HH9B 5JNYB 3GIZH 1MNUH 2NW3B 1EVUA 4MLIA 1FDLL 2FYYB 2WWMD 3AREA 3TA3A 1W0WA 4OF5A 3LS5H 2BVOB 2P8LB 5T1LB 1V3LA 5F9JA 4L4TB 1SVCP 4NQTA 4PRPE 2Y07L 3O3BB 4PS4L 3G5YA 5E9DE 4GRWF 5JUEL 3L5XH 4UIMB 1IGCL 4U1SB 2XZQL 3I2CL 4FXKB 3UBXB 1UKQA 1XIWB 2DBLL 1U8OA 5IJKA 1NUNB 4ONHB 2ZUUA 4HMDA 5GJTH 4QRRE 4X6EA 1JPGB 3HFMH 4TUKL 1J7VR 2AXFA 3T0XA 4U49A 4ONFH 1CI5A 3AS1A 5M7QA 3BH8B 1WEJH 4JREB 5FCSH 1U3HD 4M7KL 3VFUB 4UDUB 4TRPL 3VH8G 3HRZB 3VXQB 2X1WL 3JSSA 3WJJC 2F74A 1AGBA 4P5MA 3MRBA 5J6HA 2SEBB 5FK9A 2CD0A 5AEAA 1FAIL 5I1HH 2XN9E 5F21B 3FAWA 3FOLB 4Q7DA 3X14A 5IHZA 3P11L 2DWEB 2WLZA 4RGNC 4L4VE 3ARBA 3HPLB 4L4JA 1YECH 2F53E 4KVCL 3H9SD 1A6TB 3T2NL 4G43B 2DQHH 2F8OA 2VZ1A 1LILA 3SE3C 3X11B 4CVZA 4QHKI 2R2BA 4HWUA 1WWCA 4WY7L 5EBGA 4ZDHA 3FZUC 1A22B 3VDBA 4LNVA 5B3NA 1HZHL 2VXUH 5EFIA 1HI6B 4HWBL 3MLSL 3TZVD 3O6KH 3SDCC 3ZKXC 3TN0D 4RQQA 3PP3H 1R3JA 3VCLA 2FX8L 3ZO0A 2EE6A 3QWRD 4R4NC 2R1WB 5CSBA 2QBWA 2KQNA 5DFTA 3MFFB 4N5EC 1XGQB 5C86A 5GS3A 1OP3K 3QXDA 5CJQL 3UTOA 4XC3L 2LTQB 4APQD 5MEPA 2IALB 4S1RL 2EC9U 1EO8H 4I77L 2NTFB 5EC1B 1B4JH 1RZKC 5EZOH 2XN9B 1IQDB 5AD0A 3HG1A 4OGYL 1QR1A 2E8ZA 4HEPG 4FFZL 4XP4H 1B0GA 5F9JB 1FORL 1MJ8L 4Y7MA 3WIIL 1KSRA 4R26H 2W60B 4HKBA 4PJBF 3QEQD 3J7HA 2OL3B 1MF2L 3C08L 3ISWA 4AH2A 3MRQB 5EOCH 3HI1A 3RU8H 2E7HA 2AEPH 1UACL 4YJZL 4D0DB 2CRIA 4KVNL 1RD6A 2APBA 5JW4N 3FQTA 4FQIH 3BHBB 4HIEB 2Q3ZA 4LSPH 1EFXD 4CVUA 5F6HJ 3NMEA 5D2LA 3UTPD 5E2VH 3VXPA 3VWJA 4NRXA 3L1OH 3KAAA 3NFPB 4NN7B 1C16B 4Z7WE 4NO5B 4ELKB 2LAAA 5T3XL 3IYLW 4DUVA 2AXGA 1QBLL 4XPHL 3LQZB 2ITDA 4JN2B 4Y4HB 1ADQA 3MLRH 4LVHB 4YGAB 3F5WA 3GJFK 1TNNA 4WFHD 3TIDB 3O3DB 1HHGB 3WBDA 1MQKH 1T2JA 4ZNCD 3IDYC 1BD2D 3SKOB 1RIVL 5EZLA 3GNML 3PP3K 1ZLUK 2BJMH 3UTTB 1J0IA 5FYLE 4RIRA 1TQBB 4CJ0A 4LARL 1E4JA 2DLIA 3SE8L 1VCAA 1NSNL 5D7KE 4WWKA 4G9DB 4G6AC 1NL0H 3UTSB 2YWYA 1RIUH 1CL7L 4MXWL 4HLJA 5HY9B 4MA1C 5HXMA 4C59B 1VADA 1BBDL 5KOMC 3VFOA 4TVPD 2A77L 5EPMB 5BO1L 1ZGLA 2BVUA 3HN3A 1Q0YH 3HLAB 4PJDA 1CU4L 3STZB 2UWEA 3WFHB 1BP3B 1OARL 1JTPA 3U1SH 3WFCH 2ILLA 2NXZB 4GQPH 2DS4A 4JKPL 5LBSH 5ENWA 1YNTA 4ONGH 1YY8B 3CXHJ 1I1YB 1MFNA 3QIBC 2F15A 4LEOA 2NY7H 4MVBC 2C9AA 4KI5F 3SE9H 4FTVE 3WUZA 1NLDL 4YDKL 4PY7B 1B0RA 2EDKA 2YUVA 4LAQH 1IBGH 2YPKB 2P8PB 2EXWD 1YEGH 3U1SL 4J6RH 2XACC 3QI9A 1KJ3H 5F7DB 1FPTL 4HUNB 3SQOH 1FLRH 3AB0B 4X0KB 3ARBB 1A5FL 4IDJH 4U1KA 3QXWA 5JPMB 2X9WA 3LKQA 1CZ8L 2ZSWB 1CL7H 1KYOJ 3DUHA 3GI9L 5MP6L 3TYGL 5SWZD 1P84K 3G9AB 3SHSA 5HJ3B 4H0HB 2VITA 3OSKA 3BESR 4MWFB 3DMMC 3FQRA 2JF1A 3W9EA 5B8CB 1FVDB 1J0JA 3RX8A 2VDLH 3CCHA 1N64L 5DHVA 3RKDD 2VZ3A 5K9KA 1I7TA 1AE6H 4XXCA 3K2UL 4EI5B 1Q1JL 4NQUA 5IEHB 5IB2A 2AJYH 3N9GH 1O7SA 2NY2C 2RJMA 2QQLH 3V4UL 5T3XH 3T8XB 3U0PA 1X5ZA 3C8HA 3WO3B 1S7UB 1MJUH 3KPSB 4OF0A 4ZO7A 1NFDE 2VLJE 4KMQA 3TBTA 5JMRA 3U48A 3RVTD 3NCEB 3F7RA 1ES0A 5FGBA 4WEBH 5AAMA 3QWQB 2JKXA 5DD3L 4U6HA 3TPKA 1E27B 5T5NF 1W72B 1H3WM 5FECB 3VFRA 1BQHA 4LMQI 4WO4D 5I1KL 3ZKMD 4JJ5B 4X7SH 4XBPA 1GJIA 1QHPA 2X89A 1D3CA 3RWHA 1NCAH 4OLWH 3GSUB 2VLKA 3ZZ1A 2FX9L 1T2QL 4JRYB 4UQ2B 4Z95H 5EOCL 4Y5XC 1FN4A 4YHZH 4LMQE 5CIPH 1MF2H 4K7FA 3I50L 2GW5A 4KI1A 4BZ2L 5D7SL 2HVJB 4RX4A 1ZGLM 2JB5H 5E94A 3EYOA 4R26L 5FKPB 3GSNL 4EN3D 3PNWA 4J4PC 4WGVB 4LDLB 3TBSA 4GOSA 4WJ5A 3HC0B 1B4JL 5EZOL 2I07A 1AR1C 2R1XB 3PHSA 5JNYA 4QY8B 2P5EA 4D0CB 1B2WL 1EO8L 1Q9WB 1AKJA 4S1RH 3A6CH 2LU3A 1C8PA 3DI2B 3WUWA 2Y1VA 3G9VA 3NFPA 4GW1B 1IGTA 1ND0A 5GRVK 5IMKB 1BBJB 1O0VA 5A3IC 3PWUB 5KVFH 1FNFA 2ATPB 3DUSA 1KC5H 3IAQA 5C1MB 5K59F 1C12A 5KSUA 2VISA 3LSOB 3ULVC 3LOWA 2EC8A 4FFVD 4AK1A 3CVHL 4Z0XA 5CINH 2WWKO 1BJ1J 4WHYG 4JRYE 4I9WD 4U6VH 5GZOC 1P1ZB 1CFNB 4J8RB 5IB3A 5IBTL 5DDHA 1CD0A 3DTXB 2DQHL 2NY3D 4LSTL 5DUBB 1EERB 3QIWB 5I16A 2YMXH 1K6QH 1ZT4A 3TC9A 2HMIC 2IH1B 1Q38A 3D9AL 4YBQD 2HT2C 2E5EA 1I9IL 4X5XB 4R90L 1FAIH 1XH3B 3N1PC 4OZHF 5FM5O 2VZTA 4KK6C 1MUJA 5C0CA 1T04A 4HCRA 1WWWX 2BZDA 3FB8A 2PYFA 5DD6B 3RVWD 5ACZB 5C0AD 4PJAA 4M7KH 3KWWB 4RMRA 1NCBH 1UXWB 3CSYB 2HLFD 3TBYB 3H7LA 2YZ1A 1RSFA 4OUUB 3DV4B 4ORZC 2VE6A 5KSAC 2GT9A 1ZA6B 4GRWE 4PJXF 3VG0L 3LKOB 2Q7NA 5DK0A 4NQEE 2QADD 1QSFD 3X17A 3PHOA 3CIQA 2GFBB 5E2UH 5E95B 1OWRM 4OLXL 5E56A 4YDIL 1BJ1H 5BJTA 5DD5H 2ZJSL 1TCMA 3MOBL 3OZ9L 4JQVC 1JP5A 5F6HI 4MA7H 4YXLL 4NC1E 4PY8I 4BUGA 4JM2C 1B4RA 5SWSA 3RX7A 1P7QA 3OBAA 3G6DH 4NKMB 3IDMB 4U1JA 1FDLH 4XCEB 4PJFB 4N1HB 2Z31C 1OAZL 5C0DA 1Q9OA 3QUYC 1IGYA 3VWKD 5CBAB 1MAML 3L95A 5CZVL 4JRXE 1F8TL 3M17B 3RZCA 2QJDA 4HFWA 5K9JH 1BBJA 1I8MA 1D5BB 4ZFFB 4QXGL 3LQAH 1FN4B 3KPTA 3DUSB 4XP6H 3B3IB 2HT3C 3MV9A 3MLZL 3S35L 1XGPA 4FNLH 4YFLF 3IDUA 4WUKH 4Y4KA 1XGUB 4PJHE 3EZJB 2O5ZH 3HNTH 3FFDA 3OKLA 5JW4M 4I18C 3DRTA 2DLFL 5IJKC 4L3CB 3DXAD 1U8LB 4U1HA 4XI5D 4OLXH 1YYLH 5IP4A 3X3GH 4NO2B 4L3EB 3SE3A 3O8XC 1YQVL 5DQJA 5I16B 1EV2E 4CGTA 5C0RL 4O58H 2XA8H 1KCLA 3WXVL 3T4AB 5I0DA 4JHWH 3OKKA 3DOSA 4KDWA 3QAZC 4HFUL 4UTBH 4WCYL 1BIIA 3QEUB 2P5WE 1YMHA 3QCUL 5I76A 1AD0A 1BVLA 2PTVA 4KMTH 2EDYA 3KJ4C 5C0ND 1A6VL 2LQRA 5JW4Q 3TBVB 3VFOB 3UBXI 2UVFA 4NBYB 2QSQA 1J10A 1PSKH 4JRXB 3JV0A 2GCYA 5CHNB 1R5IA 2YD1A 3MNZA 5DYOA 3V5DA 2DMCA 3NH7L 3TO2A 4PJBE 4J12A 3MRHB 4LPUA 5IBTH 2FX7H 4XVTL 2ITCA 3MRMB 3MXVL 3BZ4A 1KPVA 3MRNA 5I8EA 2BNQD 3HUJF 3STZA 4QOKD 3CVHH 3F12B 1IMHC 3IRPX 3X14B 3CSGA 4LP5A 3Q5TA 1V7NH 3GMOB 4ZFOL 4X99B 3SQBA 3CSPA 3WNLA 4XHQA 1CDJA 2H41A 5J6GA 4ZUSB 4P9ML 3FO2A 5JORB 4HW6A 3QIWA 4XMLL 2GSGA 3O8XB 1N6QL 3QDHA 1JN6A 4XPBL 4XI5C 3KGRA 2FBJH 3F6LA 1D5ZA 3DJ9A 1QEWB 3MJ7A 3MLPA 1I8MB 3TIEB 1NBZB 4ODTL 2PXYC 5EO0B 5CGYD 5SX4H 15C8H 2ARJB 4L4VD 4LSSL 3VWJC 5A2IH 2EIDA 4ZXBD 2Y06L 5KG9A 1ZVHA 4U0RC 3INUL 4NOBA 3QQ9C 5IUSA 4BUHA 1U93B 4LBEB 3I50H 1FIGL 4NKMA 5E6ZA 3HTLX 2LV4A 2O5XH 4I0PC 1XIWC 3C2SA 1A2YA 1T89A 3IJSB 2V9TA 3RPKA 4K7PY 1UKTA 7FABL 1ES0B 3UJTL 2ADFH 2NY2B 1Q9LA 5CLTA 3I84A 1BJ8A 1KCVL 4DZBA 3BGAA 4L1HA 3T8XA 1BFSA 4JM2D 4R7NB 3KLHC 1QKZH 2BC4A 2HVKA 4QRUB 1IM9B 2VZSA 2YD8A 4U6YB 5IEHA 4XCCL 2NMSA 2MJWA 4PJ9B 2ZUVA 3U7WH 3RPIA 25C8H 3BQUD 4XXDB 4JFYB 4QO1A 4KQ4H 5ICXA 3HAEA 2RHEA 3VFTA 1G9MC 1HHJA 2QADC 4U3HA 1H8SA 4LCCC 4GS7B 4G6KH 1LP9E 2VXTH 3AUVA 5L0QB 3VFRB 4Z8FH 4JO3L 2P42B 3ESVF 4KJQD 3CXDH 1QA9B 4X6DF 3TYGH 4PGBB 1OLLA 3U2SA 2VNCA 3RVWC 2AI0L 5D2NB 3NIFF 1KEMH 1WQVT 4AIXA 1RZ7L 4Y4KB 1WFNA 3WJLC 4GG8A 3MRBB 5J6HB 1MEXH 1OGAA 4M5YL 3U9PL 5HGAA 4HMEA 1U8LA 4UOW0 5TFSH 1IC1A 4YBQC 3CDCA 2QKIB 4PYGA 1MLBA 5I73C 1JGEA 1IBGL 1DANU 3NACL 2DAVA 4GBXB 3TBSB 1CVRA 1NLDH 3SE9L 3OG4B 3X11A 4DGVL 4EBQL 2DIAA 3QQ4B 5GZOD 1NFDB 3VXME 2M2DA 2DN7A 1C12B 3AFLA 3O4OC 1TJHL 4Q9BA 4YHYB 5B38G 5ICZB 2XTLA 3VXUE 4UMGA 3WLBB 2LABA 4G7VH 3ZL4H 3PG2A 3BGMB 5F7UA 2NY1C 4L29B 2HWZH 4UT6L 1CG9B 5BO1H 4Q9CA 5TQ2L 5CEZE 4KRLB 4LRNH 3UPAA 1KT2A 3R06B 3PQYD 3SE8H 2DM4A 4KQ3L 2GSGB 3O8XA 1YNLL 1MFAH 3TT1L 3HUJA 2YPVL 4LCWA 3SO3B 4OUUA 1LNUA 4H1LH 1JUFB 5FUOH 5L2KD 1ACYH 2DQTL 1LEKB 4RBPH 1G1YA 4OZIE 4P59H 1QBLH 4XPHH 4PJHB 1YEKL 1J1OH 2IAND 1CIUA 1PY4A 2DLTA 5TE4H 4ZAKD 1AGDA 1L0QA 2P49B 5C9KA 1G1CA 3O41A 1OD9A 2AABL 3VXMB 4PREB 1G9NC 1F3DH 2XZAH 2EYRA 2X70A 1D5ZB 2I9TB 2B2XH 3P0YH 5KVMC 5EOTB 5C08B 2YPLA 2DIBA 4EDWL 1JZ5A 5FOBA 5HYSA 4KH2A 1NMCC 1ZLSL 2JK5A 1J5OL 3ILQC 4JQIL 2DQGH 4JFFE 4F58H 4H5SB 3WL9A 3VD5A 1MJ8H 1DVFB 1VGEL 2L0DA 1HXMB 4YPGB 5DJ6B 2D03L 4NRYA 1O5DT 1DEEB 2EO9A 4FTVD 3PWJA 1S7QB 4U7MA 3ZTJG 4MA3B 4NNPH 3IU3B 4DVRH 3T3PF 1NGPH 4EKXA 5A1AA 2C5DC 4GXVL 2AXFB 2HKHH 4UILL 1ZEAL 1MHCB 2IANE 5F7MC 1YMMD 1A7PL 1DBBL 5IW1B 2RAMA 1NJ9B 1YUHB 3BMVA 1YEJL 2UVEA 4OAWA 3HI5L 1XGTA 5EB9A 1I3RB 1SBSH 2IC2A 3GDBA 2HJLB 5SWZE 5E94B 2FX8H 1IAKB 4NUGL 2HG5B 1QLEL 1NUDA 1UXSB 5KSBE 1ZA3B 1AD0B 2WW8A 4HWBH 2G5RA 3QUMB 3C6SA 5I9QB 2B5IC 2I26N 3GHBH 3TNMB 8CGTA 2D9CA 3TBVA 1BLNB 3DLQR 4JFDA 5BW7A 3RHWF 4PJFE 5IQ7L 1ORSA 1QLRA 4MVBD 4NQCA 4NZRL 3L3OB 3N85H 1IKNA 3UCRA 1Y6MR 5HBBA 1D7FA 3T3MF 3IDXH 5H35A 2OP4H 1WTGT 4K23L 1GGUA 4UIKL 4M43H 1Q0XH 4QXWA 3DRQA 2AJSH 3RVXD 4XCNB 5J89A 2XWTB 5CHNA 2Y9RT 5CFHA 1ED3B 43C9A 5GS1C 1OAQL 2VQ1B 1LEIA 4MJ5B 4LPVA 4X9FA 1MHHB 3GSXB 1PLGL 4DVBA 4MXVE 4XGZB 1CYGA 3OX8A 4PJ5D 3E2HC 3ARGA 3QFJE 3TBWA 2KQMA 1OSZB 3NABH 3O0RH 4H1LG 4B50A 3C9NA 4Y1AD 4KRPB 3KYOA 2DBLH 4MD0B 2KZ1B 2D31B 1AGFB 3FOLA 3MLWH 3MTRA 2OMBA 1VERA 3HZYA 2Y07H 4PS4H 2AV1B 3V0WL 5EO0A 1HE7A 3O4LB 4L4VA 3QRFM 1CR9L 4FQQA 1NBYA 4XNQA 3MLUH 4OF7A 3LN5B 5D6DC 2P5WD 5JW3H 2A9NH 1YMME 1MCQA 3OWEA 5GGVL 2EYRB 2WBJC 3SDYL 3HRPA 4JO4L 5F93C 1X5KA 4IOFD 4N90E 3KYNA 4Y2DA 1QSFA 1ZT7B 1JGUL 3ALXA 3HE6D 1N0XL 3OKEB 5EULV 5MEQB 1U91B 1GGBH 1C5CH 5D7LE 2F5BL 3U7YH 5JOFB 3UEZA 3LMJL 5GJSL 2F54E 4X7FC 3D69B 4D3CH 1JGVL 2FL5B 4JHZA 1I1RA 3LEVL 4YK4C 4OF6A 32C2B 4OCNC 1Y18A 4Q6YA 5SWSB 4FZEH 5INCA 1N4XL 1BGXL 5CD5D 2ENYA 1OCWL 3P2TA 3JWOL 3IFNH 3QHZL 1X3DA 3CFCH 4P5KB 5B38A 5BVPH 1GPOH 3MCKB 3RPIB 5F6IC 3SOBL 5DHXB 5ICXB 3MLXH 4U2ZA 5KZCB 2O61A 5CSGA 1IC7H 1MOEA 4M6OH 3WYRA 1NEZA 1BFVL 1IM9A 4U6YA 5I6XB 1DLFH 4CN1A 2APFA 2PTTA 4XP9H 4GRWB 3WKML 3DRQB 3NPSB 2ZOKA 3MV9B 4AL8H 3TN0C 1DQDH 1KLGB 4NT6B 1LDPH 2A0LD 2VMFA 3NCJH 1H15B 4K8RL 1RUKL 5L6YL 1C1EH 3QP3A 5JZ7C 1MCWM 3AS2A 4HT1L 4K8RD 1EFQA 4IRSC 4C83A 4LCIH 4LEOB 2PF6A 2IGFH 2X40A 4OZGA 5KOVC 1NGQL 2VAAA 4L3EA 5B3JF 4PGBA 3DURA 1MI5D 1S9XA 2VC2L 2B1AH 3BWAB 1NGXB 5DUBA 2AEQH 4JZNB 4C55A 3FO9B 5DFVD 5FYJL 3B9AA 1FG2A 2Q86B 2YN3A 1FYTA 1G9ML 4WDIA 3T77A 1QRNB 5F7FA 5F7WC 4PJ7E 4LIQE 5T3ZE 5IF0B 4ZFZA 3DROB 5DJZB 5DMGD 4F8TA 4PGZA 4QRPE 3AGVA 3RWGB 5TDOA 1QSVA 5F89B 3OKOB 5FHAL 4U1SA 43CAA 1YQ2A 5TGBA 3C6LC 4MDJB 2EIBA 2HT4C 5H2BB 2GJ6B 3GMQB 3WJJA 5KVGL 4XTRC 1YC7A 3UTQB 4JDTH 3O6FD 4W68A 3F62A 3MV8E 3WN5B 2IGFL 1ITBB 4WU5B 3SDDA 2EDXA 1QD0A 5IV2A 1OP5K 5F3BB 5L6YH 1SJEB 4Q6IB 4MJ5A 2WUCH 1V7MH 1I4FA 4XPTH 1QSZA 4DVBB 3TJHC 1UKSA 4MB3A 4XP9L 4A2LA 3OMZA 1OOAA 1UZ6E 1EPFA 2LU7A 5D1QA 3SDAA 1WV7T 1MRFL 4X7CC 5IHUL 1RAMA 1DQLH 1A9EB 2BNRA 1T1XA 3GM0A 1WTLA 4PGDA 3DO7B 3THML 4G43A 1L6XA 4XCFH 4CVZB 1RZJC 3RWHB 3MLXL 4JR9L 2P7TB 2R2BB 3UTZB 3GB7B 2W9EH 6CGTA 3V6FB 3QHFL 1A4JA 1GPOL 4JPIA 1KPUA 3RGVA 4N1CA 5DC0A 4J1UA 4OFYD 1LEKA 4M93C 4C56B 3PWUA 1A6PA 3VXRB 2EYSA 2X41A 1Z6JT 1H0DB 3VFPA 6FABL 3FFDB 5GJSH 4RZCA 3VA2C 1E6JL 4R3SA 2I5YL 1C5CL 1U8JB 4Z7NF 4XNXH 4KI5D 2P5EB 5K9QI 5FF6B 4X6FA 1I7ZA 2X4NB 3Q0HA 1FVDA 1M7DA 2FATH 4QLRA 5CMAB 4JO4H 1OF2A 1EGJA 1GC1H 2VRAA 5D2LF 3IU3A 1JWMB 1K8IB 4PG9B 4D9QE 3SPVA 1GZQA 1MCLA 2DL2A 4ZOAA 2QSCL 4JO1L 4DGYH 4H5SA 4QHNA 5F89A 1AO7B 2YXMA 3U4EB 2EE2A 2V6HA 2R0ZH 5ISZD 5TGBB 4OV5A 4F9LA 4NN5B 4OLEA 4PRNA 2GKIA 2AK4E 1QO3A 2P43B 1M05A 1DANT 1MFBH 3C6SB 5I8OH 5I1GH 4RGOH 5F8RC 2P46B 2VLKE 5D7IF 2FDBP 3FN9A 1S7VA 2RFXA 3QUMH 2IEPA 4IRJC 1JMXA 2X2YA 3CFKB 4KJWC 4FZ8H 4GRLB 3UDWC 3CMGA 3A67L 3BAEH 1GGIL 2GFBA 1HQRA 4OIIH 4YHIB 5L7XH 3G6AB 1TCRA 3OHXB 3T0EE 4U1IA 3WUWG 4LGSB 1MCDA 3BZDA 5DRXA 1X4YA 4I0CC 1K4CA 1KXVC 5TF0A 4PJFF 5SX5H 2NZ9C 3RDTD 4JPVH 1KIRA 3MNWA 2OP4L 3DV4A 4PRPA 4JFDB 1W72H 5D1ZD 4Q58C 2MFNA 3WDIA 2VLLB 3PDOA 4NQCD 2J8OA 4AZ8A 4M6MH 4KK8D 1TZIB 2H2SD 4JFHD 5DUML 5E9DD 4HPYH 1BQLL 2JCCE 5HYJD 4XNMA 1N59A 4OLUL 3DROA 5DJZA 1MCWW 2R4SL 3Q6FB 5MENA 4KFZC 1IZJA 3H8NA 3LS4L 4PRBA 5IVOA 4QCIA 3GO1L 3IXAA 2JCCF 1ADQH 2CLZB 3QNZA 3P4OA 5LQBL 4X7TB 3U4BH 1MLCB 2V17H 5ECJE 5JDSA 4HUVB 5EU4A 4P2OB 4FQQB 4XNQB 4DTGH 5J1AA 4LCWB 3KJ6H 2WANA 1OSZA 2VR4A 3LHPL 3ECBB 2F53A 5I8CB 3RGVB 3NPSC 2JJTC 2HJKB 1G7MA 4NQDD 3OKMB 4LLWB 1T04B 4ZFGL 1A64A 4NDMA 5KTEH 4QGTA 5GSRB 5D1QD 3O4LA 3VMNA 2IPUK 3BIAX 1WT5A 3HE7C 3ULUL 1DDHB 1DBAL 3VXUD 1U8JA 3B2VH 2JCCB 4JZJC 2XQYG 1P4IH 5J7CC 4NQEA 1RUPL 2X42A 1N5YL 5CILL 1G0XA 3LAFA 1A7QL 3T1FB 1ZVYA 3T4YB 4AQOA 4OCMC 1MCEA 3QEUA 2UUDH 2XZZA 3LPWA 4X6EB 3ROLA 1C5BH 5IVZB 4U1IB 2W0PA 4OQTA 3D69A 1WBZB 3PWLB 2GTWB 4G7YH 1EBAA 1FZMA 4HJJL 2V5SA 5JMOC 4BYHA 4PR5A 4F7PB 4LQFH 5IESH 5DEZA 1N5AA 4ZMAT 1KXQE 2FZ3A 5HYJE 4PRHA 1KBGL 4PRIE 2VLLA 1BFOB 3OR7B 2JELL 3O6LH 1EK3A 1JWMA 1YNLH 2VL4A 4F9PC 4MJ6B 3VMPA 4O4YL 2IPUG 3MGAA 1UH3A 1A1NA 3MOQA 2QHLA 3GBMH 2DWDA 4HS3A 5FYLL 1A9BA 1OPGL 2HWZL 3I3EA 4ETYA 1SYSA 2BHZA 2V2TB 4OV5B 2BCKA 2ICWB 4LHUA 3U30C 5HI5D 3TNMA 5C6TH 5FGCB 3FJTA 1IT9H 2R29H 2F5AH 4IHOB 4YWGH 5EU3B 2C3XA 5FYKE 4EBQH 1FYTD 1GYAA 3C6LD 5MHSD 4RFEA 1F4XL 3L7FA 3RY5A 1WIOA 3TIEA 1VEMA 4Z7WB 1G7IA 1OD7A 5MENB 1C5DA 3HR5B 5I0ZA 1HHIB 2VYRE 1FNLA 5TFSL 4P46B 3S88H 1R0AL 5DWUL 1QZ1A 5IMMB 5K9OA 2IADA 5BVJA 1WCBB 1EHLH 3QDMB 1KEML 4O51A 3O3EB 1SY6L 2LVEA 3X13B 5D1ZA 4NYLA 4GAJL 4NGHH 5I1EL 4A6YL 5C0CD 1Y6NR 2PN5A 4Z7OE 3CXDL 3CVIL 3VFNB 5I9QC 1LE5B 3VXSB 5C07A 4JO3H 5IEKA 3QCVH 3G6JA 3MLYL 3S5LB 3EDJA 1F3JA 5EU6D 4MSWA 1T22A 4LDEB 1U36A 3T1FA 3T4YA 5JZ7D 5BV7B 4Q97A 4H20L 5E24E 2VSCA 5IFHH 2HYMA 3QWOA 5F88A 2C1PB 1IGJA 1MRDH 4XB8A 2FBOJ 2XA3A 1OW0A 3VJ6B 3PWNB 1QLFA 3D85B 4E0RA 1NDGB 2DJUA 1CCZA 3TEUA 5DUPH 1YEEL 3BN3B 1VACA 4E5XA 3VXTB 5KANG 4S11A 1UZ8B 5HHME 2BX5A 5C6PB 1OGAD 5I75B 2WINB 2R2HB 4HIIA 3Q1SL 2HFFA 1G7PB 2ESVA 2ITDB 2GK0B 1OM3H 3PGDB 2PW2B 3BJLA 4PJ8B 5DEFB 5D8JH 2HAZA 1D5IL 4W6WB 4H25A 4ZQKA 4KKAC 2N4IA 2FECL 4U4BA 1ACZA 1C16A 3NBNA 2DWDB 2FJGA 2D4FA 2P8MA 3PGFL 2P8LA 4GLRH 1DQMH 4HQQL 4EQ2A 5AZEL 4Z6AT 2W0FB 3KYKL 1IQWL 1E6OL 1FRGL 1AY1H 4HC1H 3VXSE 4JVUA 1JHLL 4HULB 2ZUQB 3ZDZE 3L5HA 5EU6E 4GBXA 1JHKL 1U41A 1HHGA 2OR7A 1PG7X 4PRHB 5ESAA 4LPCA 3TV3L 4Y5YC 2FBJL 2M26A 4F37K 3LIZL 1MFEL 4M03A 1SJHB 3D0VA 1YY8A 2A83B 1NFDA 4RIRB 1F42A 1RZJH 1ZK9A 1NEZB 1ZTXH 3VGAB 2Y7QA 2J6EH 4J3WA 4UT7L 2G2RB 4JN1H 3WFBL 1ZHLA 1IC4H 1OLZA 2VDRL 2NZ9D 2ZCHL 3OKYA 4U3XA 3JTTA 2A6DB 2R0WH 4HS3B 1ZGLB 5C70A 2H45A 2HH0H 3ZDYE 5HI5C 1UG9A 1W0YT 3MA9L 4WI8A 1K85A 2X9YA 3FQNB 3MV7E 3VFTB 4YHIA 2G5BB 12E8L 4IRJD 3SE4C 5T3ZL 3N1QC 2CJUH 3MXVH 1HINL 4PV9A 3OTTA 1FFNA 1TENA 5FGRA 4G8GA 3U36B 2OQJB 3CFKA 4YHOL 2H2PC 3U9UB 4DN4H 1P9MA 1A6WH 1A7OL 4TN9A 3NH7H 4WTXA 1GC1C 4HUKB 3GBNH 2H8PB 5KS9B 1SVZA 1FVEA 5D71H 1OGAE 3VFMA 3G5VA 5I1IL 3S96B 3QUZB 1A6VH 1K4DA 2AJ3A 3RL2A 3QIBA 1QPPA 2NX5A 3MNWB 1MCHA 1NMBL 1ZV5A 2JJTA 1UWEH 1YN7A 4OJFH 2VABB 3LKNB 2HN7A 5IWLC 1YEIL 2XA8L 4PJHF 4ALAH 1FBIH 1X4ZA 2DI8A 1LP9B 4OZFA 4Y2DD 2YK1H 4KK5C 1CDCA 3OAZK 3HZMB 3IFOB 5GGRY 3MV7D 1MCRA 5I8KL 1FCCA 4KV5E 1PJ9A 3PHQB 4KJPD 1EJOH 3ZYIA 3HNTL 3VGHA 2DJ4A 1J1XH 1V3MA 2EZ0D 2HJKA 2OTUB 2R0LH 2V2WB 3B43A 3IS0X 1DN2A 5BZDA 5ID1B 5DHYA 3DX7B 4QXGH 3RJQB 4NKIL 2BMKA 2NYYC 3FT2B 5EOCJ 3DX6A 1I9RL 1MAMH 1P7QD 2CK0L 4MB5A 2XY2A 3ARRA 2JJSC 4YDLB 3T0EC 3V7AE 2I07B 3GK8L 4QRPD 1EVTC 5FKAA 4C57C 4D0CA 1LK2B 3VW3L 2A6KB 3GFUA 3G6DL 4PJBB 1UJ3A 3L6FA 2VWEE 2OCFD 5D72H 2H6PB 2EYSB 5BXFA 4YXLH 2DTMH 4IRJA 4NQED 1DEDA 3PV6B 4N9OB 2A38A 1T7WA 3SGEH 4YDIH 3S4SG 1UVQA 4MCZB 4J3SA 3WHXB 4MNQB 2VR9A 2D7QA 4KWUA 3VRLF 4IIQB 3WD5H 3QEQE 3QDGE 5FA3A 4D9LH 4MHHG 2CGRL 1T7XA 5AYUH 1HYSC 4ZAKC 5C0BA 5BV7L 1FVEB 3VFMB 1UWEL 3IDIB 2XWTA 5DTFB 3RDTC 1RFDH 1H9VA 1H3PL 2CKBL 4IMLB 4MAUH 3GJFB 5FHBL 2VLJB 2X4TB 1WUNT 1ZANH 4IMKC 1UYWL 4EZMA 3TZVA 1LE9A 2EEBA 4PJ5A 4N0RA 4ELMF 1MHCA 4MJ6A 2BSTB 3GIVA 3DHJA 4C4KO 4HAGA 1G9NH 1XCTA 1YNKL 1T66C 4ETQB 4NHUA 1S7WA 2WWKT 3MROB 4IRSB 4OQ1A 5L2JB 2FJHA 2BCKB 2ICWA 3MUHL 2FO4B 5F9OH 5CINL 3HE6A 5DRZA 4P9HL 5ALCL 9CGTA 3MA9H 2K7PA 2XKNA 1T83C 3HI6L 1SM3L 4JFFB 1GXEA 2V2TA 5IB2B 2R0WL 1YN7B 1QFOA 2VLME 2P5WA 1NGWA 3QFDB 2Z8WC 3Q6GH 4S10A 2FO1A 2CPCA 3TBTB 5D7JA 5JQ6L 1N7MH 2F19H 4UQ3A 1B2WH 2EKSB 4ODWA 2NW3A 5E2TH 5C09D 4K3EH 3TV3H 4ZO8A 3MA7A 1A6ZB 5BJTB 4IJ3C 5IB5A 4PJBA 3QAZB 1HOCB 2F58H 3L95B 2VLKD 4L8SA 1FRGH 3H9ZA 4HC1L 4MJIA 1FZKA 1V8HA 2K3TA 3R8BB 4D2NA 5D2NC 2HTLD 2XTJD 5D6CB 3UO1L 4HQQH 2VABA 2CLZA 1RHFA 2YRZA 4I4WA 4QRRB 4H8WH 3T0DA 3FRPG 2PUQT 1FNAA 5GGQL 1NCAL 4JM4H 3QRGH 2E7CA 4I18B 1OM3L 2EYTB 4K94H 1I1AD 3HUJB 3HC0A 4U1HB 1EO5A 2BRQA 5IMOA 3FOMB 3BDBA 2EIEA 3SDXB 5CLWA 1MJUL 1UGNA 1UM6L 2OTUA 1XGPB 5FYKD 3ZSTA 2AP2A 2Q86A 2EH8H 3GMLA 3N9GL 4W6XB 1XGUA 1CT8A 4AMKL 1Q1JH 3ULUD 3WLWC 1T1ZA 4Z0BH 1S8DB 4HBCH 1N64H 2VDLL 5C0JA 4ESKA 1T03H 4DEPC 5DVLA 3MR9A 5DJ2A 5E5MA 4ZQKB 3I6LD 4XPFL 1OQOA 1XIWD 4I0PD 3ROOA 3REWB 1T4KA 4IRSA 1RIHL 4A6YH 3EYUL 1YY9C 4N0CD 4KPHL 3V8OA 5HYSB 1TVHA 3LB6D 3L3KB 1W8OA 4NWUH 3BT2L 4N0YL 4ONOA 3G08B 1CXLA 2PXYD 1R0AH 2K9UA 5CJXA 4KKLD 3BP4B 3O9WD 3PUCA 4WHYH 4UINL 4OSUH 5KSAB 1NGWB 1FJ1B 1P2CB 3QFDA 1X6NA 5GGTA 3HA0A 1J9CT 4LAQL 1BQUA 1TVBB 1T1YB 1U8IB 3ULUF 2APXA 4DQOH 4F37F 4YDKH 1IE5A 1CE1H 3S34H 1UXWA 3CSYA 4OZHE 4UQ3B 4Z7WF 2A9ML 3DTXA 2NTFA 2F5AL 1CXEA 1WVZA 2R29L 1ZA6A 4UDTB 2AJXL 1PY9A 3O3AB 3HG1B 2GUOB 2DLEA 4X83A 1X5HA 1OARH 4L8SB 4TUJB 1CD1B 3EAKA 1DN0B 1ODAA 1QBAA 4K8RC 3LRSB 4ZPTA 2ORBH 2W60A 2ADJB 2B0SL 3WXWH 3TZVB 2CDFB 3GBML 3TN0B 2KZWA 3ZYZA 1JGDB 2R56L 4L3EE 3EOTH 1EAPA 4OFKA 5CD3A 2OXGA 1U8MB 2VE6B 4NM4L 2FCBA 2MWCA 1TITA 3QNXA 4LLVB 2R8SL 2VDOH 4WFHE 3D2UA 4P23A 2DL9A 3GNMH 2R2CA 2X4NA 5MI0C 4APQB 5JLZA 3HZVB 4PJ7A 1YC8A 4P3CL 4QF1B 4HBCL 3PWPD 2Q6WB 4BH8B 5C0NC 2NY5C 1U8KA 3NAAL 5A2FA 1V3JA 3GSOB 4OD3L 3ZKQD 2J6EA 5C9JA 1GZQB 2OSLB 5GHWH 2RB8A 1WCBA 5E5RB 3NA9L 5FYLD 4CVWA 3VXUA 4U1JB 4X6FB 3D18B 3QEQB 2VQUA 2UZIL 1GZPB 4LSPL 2XOTA 4OKDA 2FRGP 4M4PA 3D25A 3RUGA 4JM4L 4IOFC 1DQQA 1NCNA 1D5MA 5JTWA 3MV8B 3R0NA 4DZBB 1K5NB 5DK2A 1EFXB 5GISH 1UCTA 3D85A 1AI1L 3V5HB 1FC2D 3V4VH 4Y1AE 4Y19E 3F7YA 3RWFB 5I71C 1BZQK 2BMKB 4ZPVA 2IJ0C 1UJ3B 1DFBH 2OM5A 5ENWB 4L4TA 2J8UB 1KLUB 2GITB 1JYNA 4I5BA 2XIDA 4PLOB 1RU9H 3KPQB 2HP4A 2HFFB 4DN3H 3RBGA 2P7TA 1ZWIA 3UTZA 1XF1A 4NPYB 5ID0A 1PG7H 4I77H 4KRPC 1T89C 5IQ9A 3L3IA 1BD2B 3SE4A 5HVWA 3WHXA 3L6FB 3E2HB 2YPKA 3U4BL 3UTTD 1P4BH 3IF1B 4GH7B 4KC3B 4X9BA 5IT2H 4JPWH 1JI1A 1BVLB 4R2GB 1KXTB 3BEWB 4MGXA 2QSVA 5DEGB 1QTYT 4WFEE 3RVXC 2R4SH 4FXGA 4IIQA 3CFIC 3SDCA 4PTUB 5DUMH 4POUB 1XIWA 5D96C 4BJLA 1HDMB 4R97C 4WWID 2NXZD 1LO5A 3MV11 4KKCC 1JHTB 4EJ1C 4G6JH 1HSBA 2Y7QB 4L5FH 2EDFA 3EO1A 3MRNB 5GGVY 1OAXL 3W0WE 3NIGF 2W38A 1ZANL 3VFUA 1H5BC 4NC2B 5I66B 2Y23A 5GZNC 3C2AL 5A2LH 5T5NG 1L0XA 3NGBB 5L7XL 3QG7L 4PGCB 1M1SA 5LG1A 3HC4L 3V6OA 2JIXB 4FZ8L 5C71A 2Z91A 3QEGL 2FH8A 2YRPA 3VI4E 5J6GB 5TE7L 4TOYH 4TUKH 5DJ8B 4HG4K 1MVUA 5TH2A 4D9LL 2OQJA 5ELIA 2IQ9H 5I8OL 5SWZB 4M5ZH 5JOEA 4TTDC 1L4IA 3OV6A 2MOVA 3DXAE 5E99L 5MEPB 3WFDH 2VDPL 4AEEA 2RCSH 2XZQH 4QF1A 3GGWB 5KS9A 3K4DA 3BKJL 4LRIA 2DQDL 2EDEA 4X4YB 2ARJA 5JUEH 3L5WA 2GIYA 4NQSA 3MACL 5T1DH 1QACA 4PG2A 3S35X 1R3JB 1PGRB 1BHGA 3VCLB 1G6VK 2E7LA 4LGPB 2Z4QA 4PJ9A 2M1KA 3ILQD 3ZHKA 2DOCA 3QDAA 4WJ5B 3I02A 3KXFD 2QL1A 4YZFE 1KJ2H 3KPSD 4F7PA 2I9LB 5ADPL 2XWBA 3KS0J 2FATL 1T0NB 1P53A 1VEPA 3CGTA 5MENE 3PE9A 4EN3C 5D6CA 4YZFF 3W39A 2FNBA 3WDHA 4U0RB 2R0LL 4JRYD 2B4CH 3EYFA 4ZXBC 3TH3T 5AG8A 3VWJB 3VXPB 2F8XC 1J1XL 1IILE 1EEZB 1BVKA 2ICWJ 5DHYB 3ZHDA 4PJ7F 5T3XE 1OQXA 2A1WH 3BZEB 1XF3A 4WHCA 4AEHL 4ZTPH 3QHFH 1UXSA 1YEFH 4CN6A 5LWYH 4LHJB 4I18A 1BZ7A 1FGNL 4PBWD 5EOQL 3BHBA 2IH1A 1EEYA 1DQLL 1U8QA 1R5VA 1YMMA 4QYOA 1YUHA 3GMLB 3ZHLA 2HTKC 2A6DA 4PY7A 4R6UA 4LIQH 3BP7A 5J9PB 1V7ML 3O4LE 3P0VL 1H8OA 1YPZA 5T1KD 2EECA 3RKDC 3SGJC 1RI8A 4I3RH 3G5YB 1RV6X 5GS0L 5I1IH 1ZA3A 4R7DA 3HAEG 1CQKA 4JB9L 3CDYA 1NBQA 5CUSL 3QUYA 1MI5A 4LHQB 1I85A 2VZOA 3DMMB 2ZP0T 2NW2B 3O9WA 2EDHA 1CWVA 1WICA 1A7OH 2LFGA 4X8JB 4TTDD 4JZOA 4JPKH 5IHBA 3VFNA 3ZKXB 3MPCA 2CMRL 1JYXA 1NUGA 2CJUL 3PDDA 3BH8A 5T3ZH 4ZO6A 2J2ZA 5EIQA 2NY3B 4PBVC 1B0RB 4JJHA 2ED9A 3G5XA 2E7BA 1UT9A 4XBEL 1OAKL 2V7NB 5DQDL 5B39B 1EGJL 4YGVB 5A40E 5IVXF 4TSBL 4X9IA 1DZBA 2APTA 4V2BA 1H5BB 1VPOL 4U2YA 3GSRB 2VDRH 4JN1L 3IDGA 3MXWH 3WFBH 1K3IA 4S0SD 1CDYA 4KTYA 2ZSVA 2QR0B 1TQCC 3OX8B 4ZSOA 5C0DB 1A6TA 2BSTA 3GIVB 1M05B 2VC2H 1M7IB 3P9WB 4FS0A 3REVA 2MCPH 4KKCD 1KELL 2VZVA 1VEOA 3DO3A 5HGDB 3LIZH 4I2XE 3LEXB 5FB8A 1BMGA 1XGYL 2HRPL 1Z2KA 4PB0H 4NJAH 4HT1H 3VJ6A 4IEFB 1QSFB 2D7NA 4E0RB 4TUOB 1F2XK 1R3LB 1JGDA 3LB6C 2KPNA 3MRJB 1YY9D 2PO6B 3QEHB 4FG6D 4R9HA 2YWZA 4IHOA 1IRAY 1GIGL 4KUCF 2FIRT 4RMVA 4AT6B 5HHXH 4Q9RL 3BKYH 1G6RB 1BOGA 1QG3A 5BCAA 2VXSL 4K2UL 3PNWB 4ZNEE 3L7FB 4IBLT 2EE3A 3H9HA 2D0FA 2B39A 4NO0A 1IGFL 1F6AA 3T0WA 2IPTH 4HUWA 3ULUC 1WBYA 4LASH 3ZE0F 2NLJB 4K55A 1DSFL 5E8DL 4KY1H 4DK6A 4PY8J 4J3VA 1IGTB 1ND0B 4RFOL 1YPZB 1UWXK 3MV8A 4JRWA 4NN7C 4OAWB 5I19H 4WW2C 4D3CL 4Z7UF 1WBXB 3BP6B 3OGOE 5I1JH 3QNZB 2X09A 2F5BH 1AHWB 4CBPA 5D1XA 3HI1B 4H20H 3O2WH 3U7AA 1JGUH 1RZKL 1X7QB 1UVQB 4MCZA 1C08B 4MQSB 3MQIA 1RVFL 3TWCH 4G9FE 1T7YA 5I74C 3CFBA 1VA9A 1JRHH 3BPLB 2ZNXA 5IB4A 5ABDE 5DJYB 1JPST 4L3ED 4G8GB 4GAJH 4NGHL 4O02L 4J3OC 5BZWA 5I1EH 3DURB 4UNUA 4JDZA 2AW2A 2YC1B 3MLUL 5HGHA 4IDLA 4U7SA 5F96H 4KK6D 4NHCL 4MNHA 2DQUH 1BVKB 2QQKL 2GITA 2BXYA 3NCMA 1MWAB 4HKXB 3MRIB 4ZPVB 3B5TA 2ESVB 5EO9B 4DZ8A 4X6BA 4L3AA 1IARB 3BN9C 4OGXH 5DEGA 1WAAA 4LLYB 5JW5A 4F7TA 4J2XA 2XTJE 3PIQA 5GGRB 4MJ2A 4APQC 3OKOA 5HDQH 3RAJH 1S9XB 2ZWLT 3GKWL 5J13C 2MSPA 3VD4A 1B6DA 5ALBL 3BP7B 4RAHA 4Q74A 2YUXA 1VGKA 3H42H 1NC4B 1NEZG 2WK2A 4KHXH 1JHTA 3STLB 4PLNC 3O6FA 2A6JA 1K4DB 5JDJA 2DQFA 3SKJL 5IVZA 4KI5E 3LRHA 5B3JE 1FNSH 1HHKB 5JPNA 5LGJB 1H3GA 1OPGH 2GQHA 2BNQB 5EU6A 4QOKB 5A3ID 1GOGA 3FAXA 1GOHA 4HUUA 3IDXL 4Z77B 5TE6L 5HHOD 5BZDB 2HTKD 2Q76B 4QHUB 1HSBB 4CKVX 5ID1A 4Y19D 1BEYH 1UA6L 2Z91B 4M7LT 4JVWA 5EUOA 4C56E 3JV4A 3OF6D 4RMTA 5K93A 1ORQB 2G60L 1KBGH 1AGCB 4ODSL 4RGND 4P3WA 5DURB 4WVRA 3O8XD 5TH2B 1BD2E 2NTSP 1J0HA 2NNAA 3BPLC 1GAFL 1J0YA 3FQNA 3EUUA 1T21A 2CKBA 1A6AA 1RUAL 4NUGH 3JWOC 3HZYB 3GGWA 1AO7E 3VI4F 1RJZB 2H1PL 1IKFH 4JG0L 4L4VB 4PV9B 3GZKA 2OL3A 5HPMB 4ZXBB 3UTTE 4GW5A 1NBYB 1LO3H 1YEJH 5E9DA 5DLMH 3T0EA 1A7QH 1I3GH 1BF2A 1NDMB 1G7LA 4F57H 4NNPL 4XRCB 4JFQB 3TF7C 3HZVA 1I7ZB 4IRZL 4PJ7B 3B2VL 4NNXA 5EA0H 3SDAD 3EJYC 4LSDA 2VLRE 5JOFA 3O6ML 3E3QE 4QXUL 2NX5E 4JEGB 2NY2D 4CRPA 1EIBA 3CFJA 4YDJB 3V5KA 5FGCE 4HJGA 1HCFX 1K9TA 4LFHD 4EOWL 2WWMC 1J5OH 4JM2B 3FB7B 2FB4L 4N9GA 4R3SB 1IM9D 3EKCA 4G5ZL 3MJ8A 1NC2D 5D1XB 2GAZB 5EA0L 3O3DA 5D70L 4KK9D 4OTXL 4ZAKA 4F57L 1FLTX 1WC7A 3QUXA 4UB0H 4JJ5A 2XG4A 5CEZH 3S5LA 1L6ZA 2YD5A 3JUZA 5DI8B 4LSUL 3ILPB 3LN9A 2CIIA 2HRLA 4QHMB 1QSEE 3KLAB 1GCFA 4IOIB 4X7DC 3QDME 1J0ZA 2FLBT 5I15H 3FQWA 1NAKL 2SEBA 5HHNA 1BECA 4HCRL 5CEXA 4BM7A 4Y0GA 2HTLC 2XTJC 1S7SB 4S1DC 5L9DL 2ZUWA 3VXQA 5GZND 1I8LC 1GAFH 1C08A 1ACYL 2DQTH 3JTSA 1JNLH 3MJGX 2X4UA 5T1KA 3DRTB 4OLUH 4P99A 1BQLH 1JPFB 2G60H 5IFAH 1U0QA 4FQLH 4MB4A 1I1CA 1INEL 1AKJB 4PJIA 2WMPA 2G9HA 1JN6B 4LRNL 4X6CA 2GUOA 5E8OA 3T4AA 3I9GL 5LCVL 4JY6A 1DL7L 3QUZC 3MRIA 3DMMA 3HCVB 4Z7VE 4OIIL 2IF7A 4GW5B 1TJHH 5EZIL 4MNQA 2EIZA 1TQBC 4AYFA 2AXHA 3CX5J 5ITBH 3FFCB 1EAPB 2CRMA 3MNZB 4PJGF 3B9VA 2YPLD 4XWOC 4NO3A 4N8VB 4OCSL 3UJJH 2ZUSA 5KSBB 4YGVA 1TJIH 5DJ0A 5AG9A 5IV2B 3FRPA 4JPIB 4M5YH 5L2KB 2BDNL 4WFFD 5DZNA 5CZKA 1QBMH 2VDML 1OB1A 5F96L 4WI6A 5C07D 5DA0B 4Y8AA 2IANB 1S7QA 3ARWA 4LCYB 4LBEA 4ZAKB 3EO9H 1C7TA 4PGDB 4HIEA 1QFWI 3U36A 3IU4L 3MUJA 1AQDB 5ESQA 4JFPA 4WO4C 5C08D 5E6IB 1XGTB 3T3PE 5FDYA 1UFUA 5K33A 1I9JL 3QJHA 3MRQA 4OGZA 3L3KA 4ZUVA 4GUPB 1KCVH 1KLUA 1J86A 5HGAB 1IAOA 1CDBA 3BGFB 3VD3A 5C8JA 3GRWA 4JFEA 3UJTH 5IW6B 1RMFH 4KV5F 1U58A 3U0TB 3ARYA 1CLYH 3THMH 2Q8BL 4N5ED 2VXSH 4K2UH 1MRFH 3W82A 1N6UA 1AGEB 5HHXL 4NCDA 2NYYD 5C07E 3F58L 2QHRL 4S2SB 3G6JE 2BVQA 3MNVB 3SDCD 3DSNA 1HH6A 5D7IE 3MJ8B 1WIUA 1T3FA 3V6BR 4Z0XB 3GUTB 1CD8A 3ARSA 3C60C 3BE1H 5MEOA 4PB0L 1U8IA 5DT1H 5IBUG 1I1AA 4UUJA 4HGWB 3ZT7A 5D7LD 5EO9A 1A3RH 4XPBH 3ZSSA 4Y2DC 3C5ZA 3QQ3B 1IGMH 3MRDB 1BIHA 4LSRH 4P9MH 3QISA 4MNHB 1F97A 5IBUB 1SY6A 5IFJA 3FB6B 1UEMA 3AU1A 2P24A 5FHAH 1V7NL 4BQ9A 3QYCA 3O3UN 2QLVB 4NOFA 2BVOA 2DQCL 2AV1A 3MYZA 4XBEH 5DQDH 3O9WC 1OB1B 3MGTA 1U3HC 4OLYH 4Z9KB 1MCKA 3O2DA 1G9MH 5DJ2B 4M1GL 2NXYD 2Q8AL 1MJ7L 4WGWB 2CMRH 5C7XL 1T20B 3CK0H 3NIGE 3WE6A 3UPCA 3SKMB 4HBQA 3STBA 1SJXA 4GSDH 3RWCB 2XZCH 4DFIA 2C3WA 4EUPA 4XAKD 1SEBB 5KW9H 4XNMB 2DTSA 5LAXA 5CAYB 2BERA 5CUSH 4M8QB 3IDYB 1DR9A 4Y1AB 1CLOL 1MCOL 3GJFH 4H88H 4I3RL 2P44B 4OUOA 4IMLA 5DK2B 4KMTL 1DQDL 1T1YA 2BSED 4UTBL 3RJDA 2H9GB 1UB6A 1AXTH 3DETD 4X7TA 4OZHA 2B1HH 3EFFB 3O4LD 3QO1B 4G80B 4LCYA 3Q5YA 5D93C 2BOBB 1G7HB 4M6OL 1X6LA 3PL6B 3GJEB 5EOQH 2YD6A 1M7IA 1FGNH 5T3ZD 4GKNB 3VFGL 3RUGB 3DPBA 3X3GL 2F8VA 3TESA 1W72A 2ZPKH 5FECA 5BVPL 3LY6A 4KJYB 4NZJA 1XR8A 3B3IA 4X5LA 3N0PB 3HE6B 3NFNA 5DRZB 4HXAL 2PYED 1B6UA 3K1DA 4S1SH 3VWKA 4KHTL 3S35H 3MZTA 2OX5A 2BY3A 4YO0B 4YEFA 2HFGL 4S1QH 1DQTA 1GGBL 1A2YB 1G6RA 1DVFA 5F3HA 4LLVA 3S8WA 5EU7C 3QXDB 2DKSA 4X6DA 4LLUB 2ID5A 4JRYA 3PGDA 5FYJU 2GAZA 1BLNA 4JFOB 4QHLA 3T0VA 1R5VB 2A9NL 1WC7B 3CNKA 4HJGB 2BRRL 1REIA 2QV2A 1NBVL 1VFOA 2E27H 1LO0H 3MYJA 2ADIB 4NQXB 2DQIH 2GTWA 3IETA 5FO9A 1FIEA 3BKJH 3MOBH 5E0QA 2ZJSH 3I6GA 3TT3L 2KUTA 5E99H 3WFDL 4I48B 5BV7C 2OK0L 2GJ6A 5LVEA 3ILPA 4XAWL 5ISZA 2IQ9L 5BS0D 3VG0H 4OM1H 3UTQA 4U1GC 2PYEE 4H1LB 3GMRA 4J23A 1OP5H 2E3VA 4HWBA 5CEXB 4OFDA 2BSSB 1KJVA 4YX2L 4D8PB 1P4LB 4Y1AA 1G7IB 2HJLA 4FP8H 2NY5H 3FO0L 1J88A 5GRJH 3EDFA 4JLRA 1KN4H 4Y16C 3MRFB 5IOPB 1KTLA 1QRND 1N8ZA 4HMCA 4HKJA 3G5VB 1AIFA 1P69B 5E1AA 1UB6B 5SWSE 1BM3L 1QPXA 1ED3A 4LEXH 2RQ8A 43C9B 1WSST 2AERT 2FEEI 3CMOL 5FM8A 5E5MB 1HYSD 1YEHH 5AWNL 3QQ4A 1QHOA 2Q1EA 5FB8B 2A2QT 1T4KB 4U6VL 3BYYA 4YXHL 1XR8B 4PGJA 2D7TH 5J1SC 3O6FB 5EPMA 1TZHB 4Y2OA 3RL2B 4JDVA 3FHQA 2LAGB 4KZEL 3QG6A 3MV9E 4KJWD 5C0BE 2R9HD 3QXAB 3SGEI 1PKQE 1P4BL 1MHHA 3MODL 3R06A 1SYVB 4P2CG 1CFQB 2JE8A 2COQA 3UZQA 4UILH 2XQBL 3E6HA 4MJ4A 4Z5RA 3JV4B 4LK4A 3SGKA 3EO1B 3RWEB 4YDLC 1Q9LB 2ENSA 4JY5L 4XH2B 5SV3A 3OB0H 2VH5H 4YHPA 4GMTH 4RWYH 3HMWL 1DFBL 2D03H 3TYFA 1GGYA 3RZCB 2DDQH 5EC2B 1SMOA 4OLVH 4G6FD 5I1LB 4JQIH 2ZUYA 3HMXH 4KGJA 4LKCA 2EZ0C 3WNPA 4C56D 4ZXBA 5DJ8A 1Q9OB 4O2CA 4XXDA 2Y4SA 32C2A 4JFHE 3LKQB 4PJGB 4KJPC 1F13A 3LV3B 4NWTH 4UV4L 4WWKD 5HDBE 1F3DJ 2XKUA 3BUTA 4UV7H 2PW2A 4C58B 4I0KA 5DD3H 2YOCA 4BFBD 2A6KA 2AABH 3U79A 3SY0A 5GS0C 3QSKB 2E9BA 3ZDXF 1XZ0B 3VFVA 4DAGH 4ERSL 1JYWA 1AGEA 5CCKH 5KVDL 4FABH 2WIIB 1MWAA 1KCSH 4S2SA 5CEYB 4HKZA 3NAAH 5C8JB 1AQKH 5CWSB 2VDQL 3F7PC 5FUOL 3RTQB 4F7TB 1AO7D 2R0KL 5ESAB 5ISZB 1EAJA 4YNYA 3MREA 4X5WB 3DI3B 3H0TB 4GKSA 1FV1A 3ARED 4LLAA 4XBPB 1L9MA 2UZYB 3ES6B 4HUXB 3QI9D 5JQHC 5ACMA 2MHAB 1NCDH 3CH1B 3GI9H 3Q6FA 4DOHB 1UM5H 1HIMH 4DKEH 1L7TL 5TQ2H 1IL1A 1A5FH 4IDJL 4Q6IC 2NZIA 3IDNB 1PX3A 1D9KD 4LVNB 3V6OC 4QCIB 3V5HA 2R9HC 1FLRL 4NIKB 4GRLD 1HNFA 1R5IB 1TTUA 3QXAA 1IGIL 4J6RL 1MCPL 4CDHA 4PD4J 2NY6B 3VH8A 5TDPB 1G0YR 2AJXH 5E6YA 4H1LA 2OJEB 1KIQA 1Q9WA 5JO5B 3WV0A 3LEXA 4UNVA 4GO6B 4O2EB 3FO2B 5EBLA 1RK0A 3OB8A 5TQ0L 4MS8D 2DQJL 2XQYK 1MCFA 4JKPH 5GS2H 4OZ4A 1HN1A 1J8HB 3PQYA 3QJFB 4DUXA 1WBYB 5HYJB 5TDNB 1BQHG 1U93A 1Q0YL 3BT2H 2B4CC 4DCQA 1E28A 4LSQH 1U8PA 2A77H 5TDOB 1WIPA 3QHTC 5DFVC 4MXWH 4NQVB 1IEAA 3B2UC 1V5JA 3EYUH 1NSNH 3FFCA 1S5IL 5DJAB 1RIHH 4LARH 3UZVB 3M45A 4NUJA 4KKAD 4Z8FL 4XPFH 4FRWA 1LP9A 2E7MA 4JKMA 4WRLA 5GSVA 2VXTL 3P0GB 3DX9A 4G42B 5EU5A 4PJCF 1FFOA 2QQNL 4PP2B 4KQ4L 5KS9F 1T5WB 2EDWA 3ZTNL 5EUKA 4FQXD 3P30H 3U7WL 5I75C 4U0QB 5CCKL 2WLYA 4NQDB 5D5ME 4J1UB 4FMFA 1HXMA 4JFYA 1XGQA 1RK1B 3GM8A 4ZSOE 3GMMA 1XCQA 3OPZL 8FABB