2F5BH

Crystal structure of fab' from the hiv-1 neutralizing antibody 2f5 in complex with its gp41 epitope
Total Genus 45
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
45
sequence length
235
structure length
231
Chain Sequence
RITLKESGPPLVKPTQTLTLTCSFSGFSLSDFGVGVGWIRQPPGKALEWLAIIYSDDDKRYSPSLNTRLTITKDTSKNQVVLVMTRVSPVDTATYFCAHRRGPTTLFGVPIARGPVNAMDVWGQGITVTISSTSTKGPSVFPLAPSAGGAAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYTCNVNHKPSNTKVDKRVEPKSC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystallographic definition of the epitope promiscuity of the broadly neutralizing anti-human immunodeficiency virus type 1 antibody 2F5: vaccine design implications.
pubmed doi rcsb
molecule tags Immunoglobulin
molecule keywords PROTEIN (ANTIBODY 2F5 (LIGHT CHAIN))
total genus 45
structure length 231
sequence length 235
ec nomenclature
pdb deposition date 1999-04-09
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2f5bH02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2f5bH01
2HYMA 3GBNL 4JQXC 3P9LB 5HGBA 2DL2A 1S9WB 1VGKB 2DQFA 4HDIB 4NQDB 1QFHA 3FO2B 1UENA 4RGOH 1A1NB 1WFUA 4R4FH 2ILLA 5I9QC 4E0RA 3EOBA 4KROC 4XCFH 5KZCB 4OM1L 3S5LG 4MLIA 2IANB 1NCAL 4PJ8D 1AXSB 3P9MA 4L3CB 5JHDB 1YQVH 3EJYD 1YMHA 3EDEA 5E99H 2WIMA 3VGAB 4QRUA 4PJHF 3QDJD 3G5ZB 5KVDL 1BF8A 2HT2D 3H3BC 1RIHL 4PJ7E 1A3RH 2FWOB 2VXQH 3FT4A 3IDMB 3LV3B 1I1AA 4ONGL 1P2CA 5I1GL 5EN2B 3EYUL 4ZFOB 4EOWL 1YEKL 4L8DB 5E7FA 1DQDL 4CW1B 4PJDF 3LH2H 5L8LB 4WDIB 3BKCL 5D7KD 4LNRB 3S35X 3DBXA 2H1PL 1FN4B 3MCKB 3MYJB 3OG4B 2D31B 1FNAA 3O2DA 4TSAH 4Y19E 1PLGL 1SBBA 3ZYZA 3GSRB 2WLYA 1T7XA 2DTMH 3K4ZA 1FGVH 1ITCA 1QPXA 3MYZA 1EX0A 5ISZB 3X17A 1RJYA 5CIPH 3RWDA 4TVPH 5GZOC 1U8PA 2E6JA 4WTWA 3QHFL 1C5DA 1RQ5A 5LXGL 3DSFL 1I3UA 3VCLA 2YN3A 1BBJA 2KQNA 4EIGB 1DQLH 2E7HA 1BM3H 1KJVB 2OR7A 4S0TD 3UYRL 3U46B 5E8DL 4FN0A 4CW1A 2WMPA 5D1QD 4O51B 3AY4C 1XGTA 4M7KL 1D5IL 2J4WH 1SY6A 3T0XA 1AR1C 1L6ZA 3KPSE 1Y0LA 5F7YC 3LDBB 1VA9A 2EKSB 4O4YH 4G8IB 1CR9H 1QA9A 2BJML 3FFCA 2QADC 5T3XH 5E4EB 3BQUB 2VH5H 1MHCA 5SWQB 4PJEF 3QP3A 5IWLC 1JZ2A 2IANA 5F3BB 4G7YL 1RUQL 4TSCL 4FABH 3RNQB 1KJ3H 2FD6L 3CDGB 5MENA 1F4HA 3V6OE 3F6LA 1RUMH 5FB8B 4N8VA 5IOPA 2A74A 4W6YB 1JPTH 3MV7D 4JFPB 2W0KA 2WBJA 2PETA 4QF1B 1CD8A 1T04B 4QRSB 3CFEB 1PD6A 4R4ND 4UILL 1BFTA 1F42A 2A6KA 4HG4J 3BE1H 4NZRH 3TFKC 1DUYA 4X5WA 5CIPA 4P59H 4MJ2A 4YUEH 3BXNA 1FZJB 1JK8A 4BQ6A 4LPWA 3ZKSD 5JMOC 1R3HB 2Z92B 3MV9D 5ID0B 1IBGL 3X13B 4K2UH 1K9TA 4GLRI 2FECI 2HJLB 1ORSA 1DBJL 4FFZL 5KS9F 1CG9B 4W81A 1GVIA 4Q2ZA 4XNZC 3DXAB 3MUZ1 2WAHA 2G9HB 4JRXD 2F53A 1JWSA 2J8UA 3HE7C 3PWUB 4LSDA 5F9DC 1L6XA 4GBXB 5EFIB 3GSVB 3VGBA 3I6KB 2W65A 3GKWH 4ZO6A 2QSQA 4PJGE 4ALAH 5I71B 1OQOA 1RZGB 4FQ1H 1L9NA 1FO0L 1QRND 2CMRL 4KROD 4YWGL 3HAEB 3INUH 1MLCA 1HH9B 2DYPA 4ZS7H 4BH7A 1NAMB 1KULA 5F6HI 5F96L 1QQDB 1A7RH 1RZKL 2EDFA 4H8WH 4EN3B 3VXRD 3VU2A 3EIFA 3GB7A 3MNVA 2DI8A 3TWCL 3W39A 1QO3B 1FG2B 3ULUF 4PJ5E 4KDTC 2W0FA 4D9RD 1KBGL 1U58B 1F3RB 1DBAH 4V1DD 5HI4C 1G7IA 1BJ1J 5F6IC 1ACYL 4JO1L 2XTJB 1M71B 4ZUTA 4OUOA 1RD6A 3RAJH 3ARUA 1QKZL 2O5XH 3TVMC 3O11A 4FFWD 3T4AA 4W4OA 1UXSA 1NGWB 2D0HA 1QNZL 2B0SH 4FP8H 1LMKA 1OP3H 4LQ1A 1D7FA 4P4KC 1NAKL 3QRFM 4U1KA 4YHKL 4PREB 1PG7H 1RZJC 4U6XA 4YXLL 3U0TA 5F93C 3MCG1 1KIQA 3TVMD 1REIA 4O2FB 4JRYB 5FYKU 2EC9U 5IT2L 4GS7B 2ZJSH 4PLKC 3E6FA 4N90E 2ZSVB 4EEEA 2VIRB 3QQNA 3WIFB 3G6JB 4C57C 5L0QB 1RIUL 3BESR 5TFSH 3E1F1 3G5VB 5JO5A 2ARJA 1IGCL 3QEGH 1MWAA 3NCJH 5ADPL 5DMKB 1WTLA 4NJAH 2DQCH 1NBQA 4HC1A 3SGJC 3MV9A 3PWNA 3LPWA 4FQCH 4GRWB 5HYQB 5ICZB 4DVBA 4R2GB 1UA6H 2DM4A 3W81A 1WT5A 1X4ZA 3KVQA 1CBVH 4M7LL 4JQVA 2GK2A 4YXKH 2F74A 3OHXA 3BRDA 1OAYL 2DF3A 4OAWA 3KYOA 2DQHH 1EBAA 1JI2A 2EDLA 1ED3A 5ESVA 4Y2DB 3T0EC 2ATPB 1R3KB 1EO8L 3BN3B 3OB8A 1YPZA 1N7ML 3DSFH 4OLYL 3DX7A 2J88L 1OSPL 5ITBH 3TCLA 3S5LB 3JTSB 1EFXA 3EYOA 4KTEH 4J1UB 2WUBH 3O81A 4IJ3B 1LP9E 4NWTH 5CILH 3ELAT 2RIKA 5GZNC 1BVLB 3KPOB 3U0WL 3QYCA 3MMEB 2Z9TA 2IAMB 1NGYB 2L7UA 1UB5A 5JUEH 5F7NC 1T0MA 5DJAA 2B39A 4JPKL 1RIUH 4Y4FA 4CJ1A 2LU3A 2LV4A 5C0EA 3KJ6L 1A7NL 4HEME 2XOTA 3D69A 5JW4M 3H9YA 4R4BA 1A7PL 3BP4A 1U8QA 1T5XA 1A1OB 1WISA 4NFDA 5JQHC 1LO2H 3RTQC 3EHBC 3RGVD 4PGJA 1HCFX 2VLJD 3MRMA 5JW3H 3D0VA 2RGSA 5FIEA 1IFHH 1LILA 2ZUQB 4G7VH 3OJDB 4RGNB 4ZUUA 3N1FC 1DVFD 5IEKB 3B9DA 1BF2A 2F5AH 2J8UF 4DKFH 7CGTA 5KS9E 2D7OA 3HB3D 2BY0A 2BRRL 1FVEA 2VQUA 1GGCL 5I0ZA 3WS6A 4NNXA 1MIEH 1T1WA 3TCXA 4RFOH 2G75B 3P4MB 1F2QA 3PWVA 1K8DB 4L4VA 1JMXA 1KIRB 4X9HA 1LK3L 4ODXA 2VISA 5C0JA 3DUUA 3L6FA 1XGRA 1KYOJ 3RNKA 2PKDA 2YKLH 3BEVA 1NCTA 3DWTA 1UZ6E 1AXIB 1ZVSB 5DJXB 3FJTA 3MXVH 1WIPA 2ZNXA 5FHBL 2R2HA 3PV6B 1C5BH 2I9TB 3W5NA 2DDQH 35C8H 2NY5H 4J3UA 4MA1C 1DLHA 4U1KB 4DCQB 2DKMA 2P8LB 1MFNA 5C8JB 3EFFA 3S96A 1RUKH 2DQTL 2XKNA 2AJSL 3WFCL 5FYKH 4Z6AT 4ZUTB 5D1ZA 1B3JA 5IK3A 1CFTA 3DI3B 4Y1AE 1I8KB 2V7NA 4XC1L 4PJIE 1N3NA 2EH8L 4JY5H 4G42B 5I30H 3CX5J 4IOFC 1QHPA 1NLBH 1ZE3C 3PXHA 2E9JA 5C0EB 4ZXBC 1X7QA 3PV7A 2R4RL 2UWEA 3MO1B 4KAQL 3DX8B 4ZSOB 2EXYC 5E8EA 5B38G 3VXRB 5F3HB 3U82B 3T65A 1AGBB 2AXGA 1LP9B 5DS8A 5KOVC 4PY7A 5JDJA 4F8TA 1L0YA 4U2ZA 5I1EL 1AGCA 4S0SD 3QUMA 2Y5EA 5HXMA 3BN9C 1JNHB 5DZNA 3WN5B 1OTSD 5CP7A 4HGWB 4M43H 1A6TB 5KAQG 5C0CB 3TBYA 3U4EA 4FFVC 5C0RL 4NUGH 3WLWC 3LAFA 1WCQA 5ALCL 2J8UB 3SO5A 1MCEA 3C6LA 4HAGA 4JZJC 1INQB 4WUKL 4RRPG 3K81A 4M48H 2EDDA 1PSKL 1DE4B 4O5LL 4PGCA 3AREC 2H9GB 3W9DA 1E6JH 3HAEG 4P2YA 3REWB 3QQ9C 3KYOB 2GK0B 3BP6B 5ID0A 1II4E 4Z7QE 4HS8L 4Y5XB 3RPIA 3C6SA 4AL8H 3QUZB 1DBML 1KFAH 1F02I 3QUXC 5DMGD 4PJFB 3EDFA 4HD9A 1HHIB 2APBA 1WAAA 2ATKB 1ZLSH 5F44A 3RIFK 2DDQL 3LQMA 2X4SA 3QCTL 2HLFD 4QRTB 5IBTH 3BPLC 5ESQA 4L3EE 4FFYL 4XCNB 2GTZB 1NBZA 4BJLA 4EVNB 1CXKA 2Z4QB 4OZHA 1YEDA 3QI9D 4Y5YC 1A1OA 4G8GE 3R4DA 5J6GA 2H9GA 3O6KL 3BP5B 2GI7A 1NMBL 3RRQA 3CFBA 3WKMH 4U1HB 1DEDA 4YAQA 4GMTH 3DVGB 8FABB 3EFDL 2ZSWB 3G9VA 5D6DC 1M05B 3QIUB 3HPLA 1S9XB 4TOYH 1CU4L 1QEWA 1PKOA 3DX9B 5F9JA 4NQED 4TVPL 4CU8A 4MAUL 3QR2A 5C0IB 4G8FA 4PD4J 4JM4L 1EZVX 5JMRA 4M61A 2LAGB 3OKMB 2VERN 1QSFA 1LP9A 3G5YB 3QDMB 2LABA 4JKWA 5IVNA 5J12B 1T0PB 1EEQA 2DLGA 2PW1A 5H8DA 3GSNA 3K8MA 3F8UB 3P40A 3IU3B 1U2HA 1OAXH 1XGTB 1OP5K 3BPNC 5EBGA 1TZIB 4X4ME 2GJZB 5HYJA 3CDFA 1HDMB 1QP1A 1T2QL 1ED3B 5ESVB 1RIHH 5EUOE 4LDLB 3VD3A 1P84J 4JB9H 1WITA 3M17B 5F7WC 4JHZA 3QDHA 3MROA 1U9KA 5FYJE 3SDCD 5FOBB 5J06A 1T80A 4X7FC 4ZAKD 4MMZC 1WWAX 5ICZA 2CUMA 4DCQA 1QQDA 4R96A 5F7UA 4XP4H 3P0YH 3GSRA 1R0AL 2VE6A 4RDQG 1MLBB 3MYJA 3O8XC 2A6DA 5HD8C 4Z0BL 3A6BH 4NQCA 5JZ7D 1OAQH 1M1SA 1AO7E 1MJJA 3MBEA 1KPVB 4OLVL 5D4QA 4KRPB 1QUNA 3SKUD 3CFJB 2FBOJ 5LGJA 3BRGC 1A6ZB 5GSRB 1J1PH 4M03A 3GIVB 1CQKA 4GQ9H 4U0RB 5KN5A 2YPKA 3P4MA 1BHGA 5FHAH 2X4QA 2XV6B 3SDCB 5D7JA 2R23B 3U4BL 2GYSA 3GJEA 5EU6E 2ICWB 3ROOB 5GRJH 2EE6A 1P9MA 2HJLA 2VL4A 2P47B 5LGKA 4AEHL 4XPGL 1RJZB 1IM9A 1YYMH 3X3GH 4H5SA 4U33A 1P5UA 5E94B 1WVZA 3U0PA 3RZCD 4WGVB 1H5BA 4JHWL 4WY7L 1KFAL 5GZOD 1H5BC 2VLLB 2XN9A 3SN6N 2FR4A 5JPMA 2BVEA 1W8OA 3FZUD 4YEEA 1UWXH 3WXVL 5DFWH 1A6UH 4O5LH 3RIAF 4HKBA 5C70A 5IFAL 1H15A 5DR5H 4Z7NF 4XMPL 3E6HA 2WBJB 1NEZA 1MRCL 3KLAA 4PJ5A 1P69B 5DJDA 4OFIA 4PBWD 4UUJB 5F8RC 1RY7B 2IPTL 5FCUH 3THMH 4M1CC 3GSNH 1LO0H 3E3QE 1MVFA 5L8JB 2WUCH 4AK1A 2EICA 3NPZB 5A3ID 4KRPD 1VENA 2EEDA 3O4LB 4K3EH 1P7KB 3PL6C 4XT1C 1T20B 2PO6C 1SJVA 5T33H 1FJ1B 1UXWA 4RGMC 4BZ1L 4XXDB 4DGVL 4FQLH 4HS6B 4U6HA 4QXGL 5IMLA 4Z95L 1KCSH 4AQOA 3FRPA 1T7ZA 4GKSB 1CFBA 3DXAA 3V9FA 5E2JA 3BKJH 5D1XC 1G0YR 1R3KA 1X5GA 4NQCB 3L1OH 3N0PB 3QG6A 3RZCB 4PLOB 2JCCA 5DHVA 5HYSB 2Q8BL 4RNRA 2ZNWA 4FMKA 1GJIA 4WFGD 4B50A 1DCLA 3BDBA 3HLAA 3MC0A 4X80L 5KSVA 1ZT1B 3QDJB 4BQBA 5BXFB 4IMKC 2V2WA 3PQYB 3OG6B 4LFHD 3NAAL 1GCFA 2P5EE 3BPOB 1MWAB 5DMKA 3QFJE 1FNHA 2BNUA 5FA4A 1UJ3C 3NBNA 5HYJB 4ETQB 4BK5A 2BVPB 5D93B 1F4YH 2Z8RA 1OARL 1F4AA 1QRNA 3AU1B 3DTXA 2B1AL 3Q6FA 4UNVA 1HXMA 3OJVC 1F4XH 5TE7L 3RVVD 1T2XA 3ULVC 1GHFH 4FHBD 1G7HA 4YHIB 4JJHA 1JPGB 5DJ0A 1KNOA 2NX5D 1JI1A 4P5MB 3UTSD 1YEFH 5FYJD 1KB9K 1F58H 5I1LA 4G8FB 3MXVL 5LQBL 4X9GA 5GGVL 1TTFA 1XGUA 1DUZA 1NGWA 4JRXE 3OXRB 4M1DH 2VZSA 5JW4Q 1EH9A 3OKOA 5E6YA 4UILH 1A1NA 4MX7B 3U6RB 5F9WC 1VKXA 4U31A 1AIFA 2CDGB 5KSAD 2WW8A 1TENA 4QCIA 5FXCH 5GQBA 4M1GL 5KG9B 4ELKB 4HV8A 4JFOA 3QDMD 3JV0A 1P1ZA 4I2XA 4RSVA 1KC5H 4XP5L 1QSFD 5J7CC 5ITFA 3PWLB 4DK6A 1FFOA 4X9BA 5EU7E 2VUOA 2H8PA 2DWEB 4KK6D 4HGKC 3L3KB 5H2BA 1LGVA 3RWJA 2LQRA 5F70A 4OGAC 1CIUA 1PKQA 4LF3A 5F1NA 1JZ7A 2QBWA 1INQA 1F4XL 4MQXC 4HJJL 3MLXH 4L8DA 3RVXD 2HVJB 5E08L 4RFNC 3O45B 1A64A 3GK8L 3SKNB 2FL5B 1DQQB 1ZA3A 3LPFA 2GJ6E 1N64H 4RGMB 4OGYH 2MQ0A 4Q9QH 1A6TA 3I9GL 5E5RB 1BQUA 2BVUA 4LRIA 5KSUB 2EDKA 4RBPK 5DS8B 5KSBB 5FGBA 1TJHL 4QWWC 3BDXA 4OSUL 3OAZH 1AFVL 4E5XB 5IB1B 4IDJL 4JO3H 1OB1B 4HWZB 3LKNA 4JKMA 3IAPA 2WIIA 5AAMA 3MJ6A 3AAZB 4AY0A 3FZUC 3L1OL 5CD5D 5CLTA 3UBXG 4LHQB 3MODL 5MERB 3BKMH 5HGBB 1T04A 2HA1A 1TZGL 1U3HB 1JV5A 3NABH 1MUJB 5K9OB 3LVEA 3QO1A 1KCLA 4NO0B 1IAMA 2OMNA 2VLLA 3EFFB 3S96B 4F57H 2APVA 4CN1A 4HKXA 3C9NB 3RNQA 5BS0D 5D2NC 1CT8A 1DUZB 2OJZH 3LEVH 3OJMB 4XI5C 2ZJSL 4LCIL 2A1WL 2RFXB 2R0WL 3MRNB 1RJZA 4F7MB 1G6RA 1B90A 1HXYA 3BN9D 4J4PA 2Y36L 4LDEB 5TDNA 3BIKB 5ENWB 2A6IB 4Z7VE 2C3HA 3VFUB 1KEGL 4GH7B 2GTWA 5DRWB 2QEJA 4LHUD 5L9DL 4PJCA 2VLJE 5K9KA 3AU1A 1KLFA 2ZCHH 2AK4E 3RTQD 1CXIA 4XPFL 3HUJB 3QEHB 5D93C 4PLNC 2E5EA 3C08L 4N8VG 3VJ6A 1DBAL 3BP5A 4OLEA 1DBBL 1OP3K 3C09B 3VXSB 3BP7A 1YEDB 3QIBD 3SHSA 2ADIB 5LVEA 4J3TA 1L0QA 5TQ2L 5HHME 4MXWL 2W60B 3WFEL 4L8BB 4FG6C 1FG9C 3RFZC 1T66C 3FQWB 1B4RA 4JJ5B 1DVFB 3KDMA 4PJIF 3AB0C 4BM7A 4X6CB 3PHOA 3MGAA 3KS0J 2MPAL 4O2CA 4OIIL 1U91B 1S78D 3P77B 3MCKA 1FN4A 1MRFH 3DV4B 3RU8L 2UVFA 4LNRA 4BSWB 4POZD 2P4AB 4KTEL 5B38B 3MJ8B 2BCKA 4KUZH 2OTWB 3IDJA 4ENEC 5E2UL 3RKPA 2R0LH 2C26A 4YHLL 5BRZB 2CXKA 3ULUH 5F7DA 2FNBA 1TJHH 1MCWM 3O2WL 1EFXD 2FJFB 1OOAA 1D9KA 4LHUA 2HN7B 1EJOL 2N7AA 4RFEB 2VZ1A 5E8OA 3VD4A 3T1WA 4OV5B 4GRWH 3BH8A 3T4YB 3MSPA 3IVKB 3QXAA 3HFMH 2IF7A 1I75A 3JTSA 1F3DH 2NW3A 3QIUA 4R26L 2XICA 4S1SH 4MVBD 3DX6A 4U1HA 1FVDA 2ADGA 1BZ7A 4Z76B 1AJ7L 5IJVB 1FCCA 1NLDL 5JIPA 2W9EH 4ZFOL 8CGTA 5HYSG 5ESAB 3OKKB 4ZODA 1GGCH 4K3GA 2A9NL 4X7SL 3G9AB 3MUGB 3DGGB 4J3XA 4Y2DC 3T0EB 1JMZA 4S11A 4Y5XA 3RPIB 3ZKXC 3HZKA 2VDOL 2B1HL 2DWDA 1IFHL 3REWA 4ONOA 4B7LA 5FK9B 5FM5M 4ZYKB 2V5YA 5K9QG 3W9DB 3MA7B 3BUYA 3G08B 1OGTB 2I5YH 5J3HC 3ZE2E 1BEYL 4XHJC 1IRAY 1HHKA 2AQ3A 4YHYC 4Z5RB 1CTNA 3GSOA 5DHYB 3UPCA 1FZKB 4KRLB 4OZIA 3OGOE 3RGVB 1KJ3L 4YGVA 1HEZA 6FABH 2IMMA 3O6KH 1U95B 1T1ZB 2HWZH 1IGTA 1MWAL 2YUVA 5MI0B 4Z7QF 1EA9C 1GC1C 2VWEE 2XG4A 3NPSB 5FK9A 4J7RA 4ZYKA 1RAMA 2VE6B 1SBSL 4D0BB 5CJ5A 1E4XH 1HINH 2VLKE 2DQGL 3RVTC 2F8XC 4JLRA 1TPXC 4Z7WF 4GW4B 2IWGA 1T66D 3MNWB 4JQIH 1CD1B 2W9LA 4JZNA 4NCC2 4F3FB 1PSKH 1IQWL 4G6FD 4PR5B 4PV9B 3QXUA 3S3SA 1I9IH 3BP4B 4FQ1L 3NACL 4D0CA 1PZUB 4M6MH 4G6MH 4ODTL 1X5YA 3RPKA 3V6ZA 3BKYL 2HFTA 4OZFH 4HMCA 1KIUA 2VO5A 1TVDA 4XMLH 3D2UB 3TIDB 3OTTA 2EKJA 5KVDH 1ZA6B 1HH9A 4BH7B 3CC5A 1F4WH 1BBDL 4PJDE 3PV6A 1PG7W 5DTFB 5ISZD 1YY9C 4OZIF 4EN3C 1S7WB 2A83B 3LKOA 2OK0L 3S35L 4IM8A 4WGWB 1QEWB 4OV6F 5EC2A 2PCPA 1EO7A 1IM3A 3HC3L 4UOJA 5CEXB 4M5ZL 2FO4A 2I24N 8FABA 5KVMC 1MCJA 4N0CC 3CFBB 3VXSE 5I71C 3DMMD 2AJVL 3FHAA 1C12B 4IIQA 1CDCA 1X4XA 4CBPA 4HG4K 3B2UD 1CXLA 1Q94A 2EIZB 1IQDB 3LKQA 1S7QB 4U1SA 2DQEH 3BT2H 4WU7A 1RUQH 3P2TA 3HRPA 4NC1C 1QNZH 5CWSA 4XAKE 4S1QH 4LAJH 4WFED 4NP4H 1WFOA 3UBXB 2HTKC 4M1GH 4QRSA 4XNUH 4QRPA 4UQ3B 1I4FB 5DMIH 5F9AC 1VEOA 4GW1B 1KJ2L 3DI2B 3PXJA 5JZ7C 4JFPA 4NKOB 3C6LB 4XRCB 1X5FA 4XCYA 5FF6A 3VG0L 4NFBA 1WWCA 2GFBA 1KGCE 4RRPA 4P2QE 2F5BH 5C0BA 3WIIL 4I0PB 4JVUA 1ZEAH 4PJXF 3PIQB 1NDMA 1AHWA 1A9BA 1RUPL 2MWCA 3CVHA 1JTOA 4KPHL 3CNKA 5T1LA 1A3LL 1ZOXA 4MJIA 4MS8C 4XMKL 5GISL 3FFCB 1JPSH 4M62L 2NY1C 4WEUD 3UPAA 4QEGA 1J8HB 2VN7A 3D0LB 1IC5H 3I50H 5JW4R 1GSMA 3DMMB 4HXAH 3T4AB 4ONFH 3C2AL 3GO1H 3DX7B 4OBSA 3IU4L 2CUHA 5I1HL 2IG2H 3QRGH 4PJBF 5B38A 1B2WL 1YC8A 1TVHA 3VFTA 4APQA 3WFDL 3QJHB 5FO8B 3Q6GH 3HHRB 4L1DA 3LIZH 4QHKJ 4NDMB 2XQBL 4H0IA 3CFKA 4HZLB 2CDEA 2OM5A 2AEWA 3MV8B 3I75A 1HHHB 4M5ZH 4AEHH 4OFYA 1X5ZA 4BZ2H 3HS0B 3ZT5A 2DS4A 2X1QA 3S34L 1INDL 5A3IC 2FJGA 3N85L 2UUDH 1Z0NA 3DUSB 3PQYD 3U79A 5CGYD 1KYOK 3BD3A 2NZ9C 5DD3L 5BZDA 1A14L 1UWGL 2PO6D 4NZTH 3OBAA 3SOBL 3L5XH 3LQZA 2YUXA 3MRFB 4E41A 1VCAA 3RGHA 5JOPE 2IQ9L 3QNYA 4MJ4A 4MA7L 3I6GA 1HILA 3MJ9A 1UCBH 4KJPD 4QKXB 2PF6A 1ZHBB 2QQQA 2FEDD 4DEPB 3RVVC 5DRXA 2I26N 2IPKB 3FMGH 2HH0L 2VLKD 3KXFB 3FT2A 2BSRB 2DMBA 3BUYB 3RWJB 4XBGA 3U0TB 1U8IA 4PREA 1UQSB 4KQ4H 2RFXA 2FCBA 2R8SH 3BHBA 1WJ3A 4OCXH 4PP1C 5KVFL 3MUGA 3KNBB 4NO0A 3VRJB 1XGYL 4XXCA 4CDGC 2Z31A 5L88H 1ODAA 4GMTL 2DD8L 5CSBA 5ANMB 3D18B 5FDWA 3PABA 3TV3H 3QI9B 3PP4L 3ULVD 1WEJH 2IH1B 4OD3H 2YMXL 5C0BD 4MX7A 3D39D 2DKSA 3TH4T 1SMOA 1I1CA 5LWYL 1JZ3A 5DYOA 4PB9H 3B9KA 1XCTB 5FYLD 4HJGB 3T2NH 4MXVE 1QD0A 1OTUD 1WC7B 1G9NC 2WV3A 2EEAA 2VDQL 3S98A 3FQRA 3MOAL 4M93C 2EEBA 3BVNA 3VRIB 4XAWH 1Q9LB 4X6CF 1U92A 5BRZA 4CU7A 5CLWA 2V5SA 5FUCE 4U6YB 4DW2H 5EBMB 5JW5B 3F7VB 4KK9D 4ORGA 1U93A 3FONA 4KKNA 4C83B 1ZHLA 3Q6FB 2FX9H 3DV6B 2OTWA 2Q7NA 3OKDB 4C4KO 4XNZB 3GMLA 4JPVH 4BSWA 4CVXB 3W11C 4JPWH 5F89A 5F7LB 3HE6B 4WFHE 3RUGF 1T21A 2VDRH 5I1EH 2VKWA 4GRLA 4Y8DC 4GRLC 4PUBL 3MUHL 3STZB 3EOAA 3TBVB 2EC8A 3SDXB 4NKMB 4Y4HA 5C0AA 6CGTA 2A6KB 2L4OA 3LS4L 1I7RA 1WQVT 4WI8A 2IPUK 5IJKC 2ZCKL 3L3OB 4ELMA 3L3JA 4KZEH 1Q0YL 1G9MH 1N6UA 1EGJL 1AIFB 2CDGA 2NY3C 5BW7A 4M93B 4N68A 5D70L 5JQ6H 4PJ7B 3QHTC 3KPRA 1JUFB 2G2RB 1J5OL 1EO8H 5IJKA 1A4KA 2GY7B 2NXZC 3QHZH 3U7YL 5I73C 1VADB 4JFHE 4JFFB 5EC1A 4ZG1A 2J8OA 4G80B 1KXTB 2ARWA 4P5KB 4QRPD 2ZP0T 4Y7MA 4ZXBB 2ZKHH 1PZ5A 1DSFL 1FORL 1G84A 4FZEH 2FX8H 3D25B 4Q0XL 2F19H 4M3JA 2LVCA 3GJFB 4FMFA 4XHQA 1ZEAL 3BGFC 1G7HB 4FQCL 2HMIC 1Y0LB 2OXGA 2G2RA 4J8RA 5CZVL 4HKXB 1B88A 1JUFA 2YD3A 1LK3H 1G0DA 5ERWB 3CDYA 4LKCB 3KR3L 2EYRB 4U05A 3QUKA 1CXFA 1HSAA 1DFBH 4WCYL 5DK0A 4MNGE 1PX3A 2CKBA 1T4KB 35C8L 3AB0B 1FC1A 2IALB 1SMAA 1U8LB 2R1XA 2JIXB 1IKNC 3HLAB 4S1DD 2BNRB 2HLAA 1UJ3B 3H7BB 3IDXL 3QB7C 3TBTB 1T22A 2EXWD 1FC2D 5EUOA 5FEBA 5BQ7A 1A22B 3C60D 3HAEA 1UVQB 3TZVB 4OFPA 4X4MA 3R0MA 4YHKH 3VMPA 1P7HL 4XH2B 3DBXB 4PTTA 4CVXA 3RWCB 5J11B 3VGFA 3MRQB 5DHXB 3PUCA 1ZXQA 4NWUH 2I60H 2J4WL 5GGTA 5CGMA 5CJOH 4K3JL 2IPUG 1I8LC 3NTCH 4HUXA 1U93B 4C83A 3F12A 2R4RH 4HIEA 1TFHA 4PJBA 4OCYH 1RFDL 1I9JH 4FQXC 3QDGE 3BH9B 4HWBA 4A6YA 2B2XL 2H2PD 3H9HA 2XXMB 3IFPA 1S7VB 1CICD 1EMTH 4X6FA 2H6PB 4NKDB 1CS6A 4FG6D 3FQRB 4OIBA 1MLBA 1MJ8H 2FBJH 5D6DA 5EWIH 5F7KC 5JHDA 1XCTA 2VB5A 3SDXE 1I3RB 2EYSB 3HNVH 4FQXA 2DWEA 5DVMA 2O5ZL 4KI5C 5CEYB 1B4JL 2DBLL 1RVFH 3D87B 1KN2H 5HHQB 1ETZB 4GKNA 2E9WA 3IDUA 1CF8L 4KMLB 4GRMB 1EEZA 1ES0B 1ZLUK 4GXUM 1JRHI 4N9GB 5GS2D 2MCG1 1A6WH 1AGFA 3QXDA 5J3HD 5I17A 5BV7C 3LRSB 4EIZC 5J1AA 3PABB 1QR4A 2NY6D 3FB5B 1GIGL 4P2OB 4FQIH 4I77H 5IOPB 5CILL 5DRNA 4O9HH 3IU3A 2A77L 3F7QA 4AM0B 2QV2A 1DEEA 2Y07L 4PTUB 1JGDB 3VWKD 3I50L 3WL9A 3QAZC 1U8IB 5GRXG 2P24A 1MIMH 1A4JA 2R1YB 2R2BA 1BGXH 3C6LC 4C54A 5B39A 4EN3D 4F9LA 1HIMH 2BXZA 1TQBC 1C5BL 2BSRA 3TVMA 4XCFL 1A6PA 5IQ9A 3VXTA 5DRZB 1X5XA 4WEMB 3MLSL 1JPST 1I9IL 1FL6A 1S9XA 4LLVA 4YK4C 3W0WD 3IJYA 3SDXF 3REVA 1M05A 3SY0B 2ZSWA 1H9VA 4PJ7A 4HCRH 3BYTA 4YAQB 3MLRL 5LGJB 5C3TA 2NXZD 2A6JB 1BQHA 3UJIH 1QPPA 1EHNA 3GBNH 3RY6A 2Y6SD 4ETQA 3AS3A 1BEYH 1EGJA 3C87A 5CZKA 4E41B 3B8SA 1J1OL 1IGIL 7FABL 3SBWA 2WNGA 2OYPA 3IDXH 2WP3T 4PJXA 2V2XB 4UU9A 3VA6A 1KTDB 4XVJL 1BZ9A 5EOTB 2EIBA 5TH2B 3MLSH 4IRSD 4P23A 1A21A 5FO7A 3UZVB 4AEFA 4RWYH 3UTPE 1XF5A 3KXFE 2XN9D 1T21B 4XP9L 4POZC 1I7ZB 3N50A 3STBA 3QG6B 3CUPB 4LL9A 4G6JL 3UTOA 1AHWC 1YEHH 4LAQL 2DYPD 4UNTA 2X1PA 4HPYH 4IMLA 1CGUA 3TJEH 4TYUA 4RMQA 5IW1A 3V4VL 3FONB 3LN4B 1FNFA 1PG7X 5EBMA 3SDDC 2IH3B 1T0NB 5CJ8A 3HFML 5D7JD 4RDQF 1TJIH 5H94A 5J57B 1U42A 3OF6A 5BVPL 1ULVA 1WFTA 1NMAL 4AH2B 4LMQE 3SCMA 25C8L 4WWKB 3T3PF 1KB5B 2VDLH 3B9VA 3JUYA 4KROB 4Y4FC 5DEGB 5D2NB 3F58H 5I9QB 4XP6H 3VMOA 2PR4L 1OD9A 4QGYA 2QQNH 1QSEB 3TA3D 5DUMH 3F7PC 1Q0YH 5L7XH 1W8NA 4Z0XA 4GBXD 1UM4L 3T77B 4QXGH 4YWGH 3RL1B 5BVPH 5K9QI 4KFZC 5FUZH 3H9SD 4XC3L 1A0QH 4M7LH 5F21B 3MR9A 3L9RA 4OLWL 4YHLH 1R3LB 4OLXH 4U3CA 4WWKD 4CRPA 1IAKA 1DLHB 4HC1H 2NY0D 1HQ4A 1WCBB 5IVZB 5GSVB 4M6OH 1N6QH 3U7WH 3MRLA 4ZS6D 3MA9H 3K4DA 1X4YA 5A16A 5D7IF 2VUYA 1ERNA 3BGAA 4ESKA 2UZXB 4WUUE 4EI6B 5C3LD 2QHLA 2B5IC 2CO7B 1I7UA 3DRQA 2V5RA 3FTGB 3IFNL 3R1GL 1K8DA 1J1OH 3V2AR 1NBVH 2PO6B 5EO9B 1IILE 3OAZK 15C8H 4FXGB 1F11A 4XVSL 1JNHA 1RZJL 2Z31C 4DZ8B 1QBAA 1WBYB 4XGZB 3RKDC 4LARL 4YO0A 4UOW0 3FN9A 2DM2A 1NL0L 2AJZB 3TIEB 3EO1A 2MTPA 2A1WH 2R2CA 3LEVL 1AC6A 1S3KH 1T2JA 4I3GA 4JFEB 3O4OB 1G9NL 1KENL 5ICYB 1N4XH 3IETA 5FM8A 3WLBB 3KPLA 1TVBA 5IWLA 2C9AA 5F7FA 5GGUA 5LGHH 2ICCA 3UYPA 4YIQB 4DKAA 3GZKA 4MWFB 5IB5A 5KVGH 4F3FA 1W2KT 3PL6A 3OKLB 4UQ2B 4MAYA 1KN4H 1M4KA 1M7XA 1Q9OB 2W07A 4OSUH 3TIEA 4OF0A 5FKPA 2ZCKH 5EBLB 4FFZH 1XZ0B 1ZGLB 4P5TB 2XZAH 1NJ9A 2CIKA 3MNZA 4TTGA 2BVTA 2NW2A 4KKLC 1YNLL 3NN8A 3HKFA 5DUML 4NYLB 4LLDB 2C4FU 3SEPA 1NFKA 1LEIB 5LXGH 4ZFZA 1BJMA 4NKOA 3QDAA 1D5ZA 3MX0A 4OCMC 1FDLL 3MOBH 1KJ2A 4XBPA 5DWUH 1HI6A 4IIQC 5HVWA 1H3PL 5GHWL 4NN6B 1CICA 2ITCB 4K2UL 3H8NA 4X6DB 5I8KH 2CLRA 1F45A 1S9YB 1T89C 5IB3B 3BSZL 4BKLB 2XN9E 4L1HA 3GIZL 5B3JF 3LHPL 4QOKE 2VLRD 4PJFA 2XXCB 5DA4A 1LE9B 4P59L 4MQSB 4OGXH 5HJ3B 2GAZA 5I16A 5CINL 3FFDA 3NCMA 3OKKA 2Q8AL 3WO4C 4WI4A 5DHVH 5ILTH 4M4RA 4TTDC 3OAUH 1Z0MA 1KJ2B 3D69B 4WU5A 3S6CA 3BPNB 5D7IE 5LCVH 1U3JA 4MD5A 3MXWH 3GJFK 2VAAB 1NGQL 5ALBH 2WUCL 3VXUB 4XMPH 4JFEE 1KB5A 5J9PA 3PQYE 5A2KH 1JPSL 2SEBA 2DOCA 3ULUC 4OZ4B 4WFEE 3MBXH 3MRCB 3RDTA 5I66B 5B8CC 1IAIL 2NTSP 5GS1B 2X4OA 2XPGA 4NZDA 4AJ0A 4J1UA 2AXGB 2C3WA 3T65B 4MJ6A 3SGDI 2R0WH 4GKZB 1P7QB 4NKQB 4MQTB 2UWEB 3MO1A 2FGZA 3PHQB 4KMQA 4S1DC 3OKLA 3T0ED 2IFFH 2BMKA 4O9HL 5BRZD 3P9WB 4CN6A 4M7ZC 1FE8L 1A7OH 1YEGL 2B4CH 4MAYD 5D2LB 4R90L 2AK1H 5BV7B 3IXTA 3CAFA 4AEIH 3L5HA 3RY4A 1A6WL 3QCVL 1DSFH 5T1DH 4OM0H 5JA8B 4QHNB 3W39B 4ODHH 1BGXL 1NC4D 3MNWA 5EB9A 1NDGA 5C7XH 4X99B 5FYJH 2X89D 5KVFH 3S7GA 1B4JH 1UH2A 3QUXB 3HZVB 4WI5A 4QTHB 1CXEA 1MCFA 2WWMD 4BKLA 3STLA 1MFBL 3TPKA 1PFCA 2ITCA 2DYPB 4R8WL 4HT1H 4KMTL 4LLWA 4P9MH 4GG6E 3CDCA 3HMWL 4KY1H 3TLRA 1MQ8A 4I1NB 1W72B 1NKRA 2ENSA 4YHNB 1J87A 4MDJB 3MRPA 1XIWC 3V6OA 1BQHB 5DURD 4OJFH 1UWXK 1S7UB 3LEXA 5FKAA 4D3CL 3V5DB 2Y25A 3DJ9A 3CGTA 4U1MA 2JJVA 1JWSB 2G75A 1EAPB 5IG7A 4J12A 5GS3A 3FB6B 5L2KB 3HNVL 1SJEB 1MAJA 2JKXA 5CMAA 1G6RB 1MNUH 1N0XL 1A4JB 2NMSA 3QZWG 2Y5TA 2WANA 4PG9B 4AT6B 3MLUL 5E00B 2XNAB 1YYLH 1OTTD 1UXSB 5HHMB 4W70A 3SQOL 2NNAA 2ZOLA 4N8PA 1MCPL 5CHNA 3BD4A 2E7BA 3B5GA 5DUBA 5I8OH 1G6VK 3VD5A 2IADB 4JG0H 2AEPL 1QSZA 2C3XA 4NBYB 1T5XB 1EVUA 5T33L 4R4BB 5FGRA 3VGHA 3WLBA 3C5JB 1BVKB 2YPVH 3JWOH 2A74B 5FB8A 1MI5A 3T2NL 4EQ3A 2QSVA 3L5WA 3FQXA 1ROWA 3RWEB 5BJTB 5HVHC 1I3GL 2BOCB 5T1DL 4OFYD 4Q58C 1H3VA 4FFYH 4UOW1 5I8OL 1WBYA 4XGZA 1MWAH 2GITA 2FJHB 1XF2B 4DKFL 4PJDA 3NCYP 3QEUB 1LK2B 1NCDH 1T3FB 1BWMA 1FFNB 4HKZA 2FH8A 1EFXB 1OQXA 4G5ZL 2VLKB 4LQFL 3BDYH 3Q2CA 3UCRA 1AGDA 1NCUA 2YEZA 2G9HA 4HXBL 4WI9A 2Q20A 2DJUA 2BCKB 3Q0HA 4Q2ZB 4GAJH 1CG9A 4BSJA 2VC2L 3KJ6H 3A6CL 1SEBA 1YEJH 1Z9MA 3B9AA 1EUTA 4JDZA 1U8NB 1IAKB 1TETH 1E0OB 1JWUA 4MD4A 5CZXD 2BNQD 4TRPL 1JK8B 4RZCA 2OK0H 1ZVYA 2IQ9H 3GSWB 2GT9A 5DK2B 4NNYA 2GHWB 3HNSL 5EO1A 5HYQA 3HCVA 5E2TL 4KK5C 3FOMB 3AVEA 1A1MB 1JL8A 4DGYH 1BQLL 3CU7A 3CFEA 3D5OF 4ZNEE 2AJVH 1EVTC 3I02B 3VFSA 4BQ8A 2J6EA 1NUNB 1TNNA 4Y8AA 4DGIH 4OCRH 1MAML 3BRFA 1WLHA 2P5ED 4UBDC 4JPKH 3OKOB 5K9KB 3BYYA 4YDVB 1OT2A 4HUWA 1R5WB 3S37H 1XGPA 1IGJB 2FEDC 3F5WA 2JF1A 2EH8H 3ZKND 2ADJB 2YA0A 3NACH 3I84A 2FIKA 4QTIL 5CAYB 4LPVA 3RHWK 4WV1B 2WZPD 3LSOB 1DBKH 2OZ4H 5ICXA 4P9ML 3QQ9D 4XB8A 4YXHH 4BZ2L 1G6RL 4JRWA 4P57A 1YJDH 4WI2A 5C0DA 3VFWB 2R4SH 2HLFC 3EYSH 2F53D 5KVEH 1S7SA 2ZUXA 4PRID 4A2MA 4MAUH 4LCCA 2XWTA 4C4KT 1HYRC 1QBMH 4Z7UE 1R5WA 3GMPB 3MJ7A 3JWNC 1IAIH 1P4IL 3KLHD 3U9PL 1N5YH 5B8CA 3F65A 4HXAL 2CKBH 1H3UA 3U83A 4U1NA 2HWZL 3RU8H 1EO5A 3A67H 4V1DB 1KENH 4X98B 1IC1A 4GG8B 1KEMH 4OFDA 1CGSH 1UB6B 3WUWG 1EHLL 4JFZL 2GKIA 4P2RD 3SDXA 1F3JA 1HH6B 2YKLL 3VFOB 4CADA 1MFDL 4M6NH 4FQXB 1ZLUH 1MCIA 5JORB 5D71H 3KPMB 3WO4B 5T3ZH 4QHLA 5EG6C 2BC4B 3KYAA 3WJJA 1DQML 2WWMC 3G5XB 2W91A 5BV7L 1GRWA 2YK1H 4GG6A 3ZTJH 2MOVA 4KJQC 2ZG3A 3T0DA 4G43A 1UZ8B 4UZGA 1A5FL 3TO4C 4O00A 4P2CG 4GS7C 3QFJB 4HIXH 1I8MB 2FJHA 4POYA 1XF2A 1U6AL 4XH2A 4ZD3L 5IMOA 1BPVA 3HE6D 4P4RA 5D6CB 5IHUH 1I8LA 4XPAL 2R1YA 4QHLB 4H1LH 5H37G 1MRDL 3Q3GB 5C0GA 5JORA 1G7PB 1JGDA 3SJVA 4MDIA 4X7SH 4XPTH 3O4LD 4HF5H 4RGNC 3HMXA 4QXTB 3VGAC 3HZYA 4DJMA 4S2SA 1R5IA 4G8GD 4IS6A 3ULUD 2FEEI 3P9LA 4M43L 4OZHE 4NQXB 1HSAB 1MH5A 2RAMA 1F4WL 4IRZL 2R15A 3GMPA 3H3PH 4PYGA 2Q86A 2CSPA 4NPYB 2XWTB 4PV8B 4QHKI 4WHYG 4KZDH 4PJ9B 3WD5H 1G7PA 3WFZA 1MY7A 2NY5C 3FOLA 2J2ZA 1P4BH 5GGSY 4FFWC 5JDSA 2G5BA 2QHRL 2I07B 4CVWA 2PXYA 5HYEA 4HFUH 4UT7L 4KKBD 2VRAA 4CU6A 1BQHG 2X1OA 4WV1C 2DQGH 3PGFL 5HI4D 1XF3B 3WCYA 1NFIA 3F5WB 3V4VH 2IGFL 1XCQA 1EJ6A 5FKAB 1QRNB 4UDUB 3I6GB 3CSYA 1A7QL 1MFCH 3U46A 4YX2L 3UZQA 1NMBH 3RUGA 1SBSH 5GZND 2A73A 4LLWB 1K6QH 4D9QE 5BQ7B 4KTDH 1A2YB 2ZUSA 4G7YH 3HE6C 4M3KB 4U1JA 4I9WE 5IBTL 4D9LH 4Y4FD 4DZBB 2VXUH 4FQ2H 4NUJB 1S8DA 2GJJA 2I5YL 1D3CA 2Z8VC 4NZRL 1E4WH 3GMRB 4KK5D 1P9MC 2IALA 4NRYA 2MKWA 2NY6C 3NIDF 3TJEL 4JDZB 2XTJD 1ZVHA 3GHBL 4KKCC 3O9WB 4HPYL 4BUGA 4YHPB 4HZLA 1Z9OA 5BRZE 3HE6A 1G9MC 2ICWJ 4MQXD 2EO1A 1S78C 5DVLA 3G6JF 4QRRE 3QUKB 1E4KC 2NY7H 3WN5C 2V5MA 4F57L 4LNVA 1B0RB 4LBEA 4XC3H 5HY9A 4HCRA 1UZ6F 1Z3GH 4ENED 3RWFB 3PJSA 3VFVB 3MJ9H 2VLKA 3DURB 3VD7A 3DPBA 4FQ2L 5TDPA 2F5AL 4LSPH 4JZOA 1S7SB 2WINB 1KCKA 5IW6A 1HYSC 1Z2KA 5EZJB 3HNTL 1P7KA 3U7WL 4UTAL 3O4LA 3V0VB 1FNGB 3ZDYF 1YA5A 4I0PA 2FIKB 4NQTA 2N1KA 5HHOE 1FGVL 3PHSA 1NFDE 2I9LA 4E0RB 3T2QA 1YDPB 4XCYB 3KPNA 1NMAH 4Z7UB 3NZHL 2KPNA 1UEMA 2OSLA 5EZOL 1J05A 2DM3A 4OGAD 1GGIL 5FGCB 2E6QA 5HI3D 5TGBA 3I02A 1EFQA 4NNPL 4NGHL 1Z5LB 4MB3A 4MA1B 3WDJA 4BZYA 5FGSA 2KL6A 2AV1A 2NLJB 1UM5H 4NZJA 4QRTA 4OFKA 2BVOA 4OB5L 3N1QC 1FZOB 2CR3A 3GSWA 3ZKMC 4EI5A 1RUKL 4PRNA 2FGWH 2XWBA 3HI1B 4LRNH 3NH7H 3O6FC 1S7QA 2QSCL 5DT1H 1NUDA 1CICB 2FBJL 2GK0A 3QQ3A 4GG6F 2X6MA 4WUUA 2P5EB 1BD2B 1P84K 1C12A 5L2KA 4PGCB 5EIIA 3C5SB 5HHXH 4NNPH 5KVGL 3H6JA 2D7TH 2QQLL 5TFSL 2AK1L 2MHAA 1G7MB 1OGAE 4H88L 3EHBD 3RGVC 4WO4D 1JTTA 2DLFL 4LCWA 3ZHLA 1EEYA 3OF6D 1AO7A 1A6ZA 5GSRA 5ID1A 4N0YH 2R1WA 4G8GB 4F8QA 1CLOH 4IOIA 3LZFH 3BGMA 4K3EL 2NX5E 4XPFH 3QUMB 4Q7DA 3WSQH 1W0VA 3MRIB 4RWYL 3UBXI 4Y5VC 2ED9A 2FD6H 4LLQB 5AYUH 3QUML 3TO4A 1NAMH 4HIXL 3BWAA 2PYFA 4OZFG 1ZT7B 3DUSA 4XVSH 1HH6A 2GY5A 4CADB 3NA9L 4D9LL 2YPLA 4O2EB 4RMTA 2VH5L 3FO1B 4H26A 1HIML 4H25B 3QPQC 3QFJD 3UJTL 2ZUVA 3LKSA 4TNWK 4UT9H 2CDEB 2CK0L 1CGVA 5BV7H 4D0DB 5GXBB 4Y4KC 4L4VD 4ONHA 2HJKA 4FQXD 2EDYA 2GUOB 2BMKB 1KCVL 4IJ3C 1P7QA 5C07A 4HWBL 2BY1A 1RULH 1TZGH 4PJHB 4OIAA 2O5YL 3IRZA 4OF6A 1V7MH 5E5MA 1CFVH 3WIHL 3OKEA 4X83A 5C6WH 5EOQL 1A9EA 3VRLF 3DHMA 4EXPX 1CFNA 2C3VB 4P2QA 3ZDXE 3UYRH 2VZTA 4NWTL 5C86A 1U95A 3NH7L 3LKPA 4RISL 4UINH 4HS3B 2C4XA 2EYTB 1O7VA 1AFVH 5DWUL 5J9PB 3GKWL 3JWOL 1MCLA 3N9GL 2E9BA 3ALPA 1CK0L 1PLGH 3EYQC 2DLIA 4I77L 3DVGA 2J8UE 1ADQL 1I7UB 1T1WB 5AYQA 2HFFB 3QNZB 3HR6A 4NN5B 4JANB 3CFCH 1GGYA 1F13A 3TN0A 5FECB 1YJDL 1OD7A 4J3SA 4EOWH 2ZKHL 2P5EA 1T7YA 5CCKL 4QHMB 2YOCA 1IM9D 4PJEB 3UTQB 2DBLH 1R3LA 1SEQH 3MREB 1OL0A 2AJUH 1CFQA 4FQJL 4X4YB 2VLME 4ALAL 4CGTA 4DQOL 3VXRE 2VLJB 2VDNL 5IHZB 3SDAD 4PUBH 4URTB 5IB3A 1YC7A 3U2SA 4EBQH 1UKQA 3QXWA 5BO1L 1Y18B 1YQVL 3MV8A 4JEGB 3ZE2F 1PEWA 4JM2C 1ZS8B 5IMKB 2ADGB 5DXWA 2HJFA 2Q76B 1ZT4A 3CLEL 5DEGA 1LEIA 4KGLA 3DMMA 4MGXA 1NCAH 3AXLB 4LCCC 5IFAH 1QFPA 4MJ6B 5DJ2A 2ERJC 3T0BA 1S3KL 4KMTH 4U3XA 3WN5A 1H8SA 4N0RA 2XTJE 4P5TA 1BOGB 4P2RB 4ZFFA 4KTYA 4PY7B 3ZYIA 3P0VH 5IW6B 1MCOL 2X70B 4G9FE 1MFDH 4H20H 4M6NL 4XNXH 3BZEA 4FQPA 2FX9L 3ARRA 4NSKB 5DUPH 3IAQA 3WXWH 2BSTB 3K74B 3IDIB 4RA0C 3WNKA 4NOBA 4RAVB 4F9PC 2YK1L 3WBDA 2EC9T 2NY2D 3BPOC 3O3AB 1GXEA 5C71A 1IEBA 3DVNB 4YHPA 5BOPA 3WFBH 3MODH 2NY1D 1AP2A 1UACH 3P4OB 1VFMA 3RI5F 3MLTA 2AKRB 3TBSB 4U49A 3T0VA 3VXUE 3T0EE 4PG9A 4AT6A 1JWMB 1IQDA 2ICEA 5GRZA 1GH7A 4L4JA 4YO0B 3PGDA 3SGJA 4OB5H 5SX4H 4BK4A 1I85C 4L3EB 3AMLA 4PJEE 4MZ3A 2KQMA 2X05A 3MRBB 3SE4C 2FECL 1CDUA 3BGMB 3DIFB 1GGBH 3R06A 3KWWB 1D5ZB 4QHUB 2OL3A 1J5OH 1V7NL 4BYHA 1NCWL 2PTVA 5L88L 3HRZA 1AE6H 1Q1JL 4K3HA 5SWSE 2LU4A 2R39A 2OR9H 3NCBB 2J5LC 1SJHB 1X6LA 5KW9H 4MDJA 4ZUWA 4MS8D 4ZOAA 4MHHI 4RCAA 3IDNB 3P3YA 4LSUL 5E5MB 2P24B 4C56D 2D7PA 5EBLA 1JWMA 2ICEB 3STLB 4PJ9A 4GRWE 4NZUL 3X14B 5KSAB 3CXDL 4YUEL 3P4NA 5IIEA 1ZHKA 1P6AB 3GK8H 1IZKA 2DL9A 2VQ1B 4QRPE 1ADQA 2OL3H 3TGXA 5I30L 2PYEA 3WEXB 5EU6B 3MBED 5L2JA 4YH6A 2AXHA 4BFIA 1FSKB 2OR9L 4PB0H 5GRYA 3B9EA 5J1SC 4HEPG 1OTSC 5SX4I 1NSNL 2XKUA 1ETZA 3GB7B 4JAMA 4Y4HD 2YPLB 4O2EA 1WZMA 1YDPA 5D2NA 1J0IA 3ARDB 4PRDA 1PGRB 3BZEB 1CQYA 2BK8A 1MHHB 3BIBX 1NCDL 5KSBA 2VITA 4QRQA 5DURB 4P2RA 4LSVL 4PYHA 3QIWB 1T5WB 1HWGB 3QDGD 4KPHH 4KTDL 3WUWA 2K7PA 4Z7UF 1FE8H 2DLEA 1I1YB 5C09B 4JZOB 1CGWA 3K1KC 1AGEB 3O0RL 1A7QH 4X4XB 3SBWC 5CKAA 5D72L 4RMRA 2HJFB 4U3HA 4CMHC 4UT9L 5DLMH 4LF3B 4O58L 5F1NB 1GAFH 3ZMRA 1S5IH 3GMQA 4G8EA 3TZVC 4WUUB 4LSVH 1KLUB 1T22B 2EH7L 4QXUL 2XZQL 2EXYD 1BZQK 4CVZA 1OAQL 1W0WB 1Y6MR 1E28B 5JA9A 3L7EA 4LEXH 4PJIA 5EO0B 2V2XA 3T0WA 3MV9B 2AV1B 2Q8BH 3B3IB 1MCCA 4UIKL 1QFUH 4XP4L 2AK4A 4U1NB 3TP4A 5KOMC 3L5IA 4QTIH 1RZFH 3QEQD 3DVFA 2OSLB 2V7HB 4OD2A 3QEQA 5EOCL 3DLQR 1KSRA 1L9MA 1I1AD 1A6AB 4H8WC 12E8H 3UMTA 3F7YB 1YECH 4N8CH 5F72S 5SWQA 3JUZA 4WHCA 3WV0A 1FO0A 1F8TL 4X8XA 3ZL4L 1JVKA 2LTQB 1OWRM 5KSBE 4RBPH 4ZXBA 1H3PH 2FJFA 2B7DT 4PJFE 4PP1D 1I3VA 1AY1L 4HWNA 3S36L 3C6LD 3TT3L 1A4KB 4NPYA 4WI7A 2V6HA 1IGJA 1K5NA 5HY9B 3IDJB 1FYTA 1A5FH 1B0RA 1KB9J 4P2OA 1QLRB 1XH3B 4KKLD 2F54E 1CZ8H 4EUPB 4PGEB 5GRVL 4G6AD 4YPGA 3WFHB 4NWUL 4R2GD 1NCNA 1DANT 4XP6L 3ZTNH 3ECBB 2FX7L 1JGVL 4LIQH 4X7TA 4LSUH 2DIAA 5B4MD 3IFLH 2F9BT 4XNMA 1SHMA 1IE5A 1IMHC 5T3ZL 1ZT1A 1GC1H 3QDJA 2UVEA 4MDIB 4RZCB 2CKNA 3QDGA 5J1TC 3SE8L 4Y5XC 3EO1B 4PJ9D 3RHWF 4LLQA 4HPOL 4XMKH 4NHUA 5GISH 1W0VB 5DQDH 2B5IB 4MD0B 1SEBB 4GXVL 3D48R 4KUCD 1IKNA 5I8EB 1QRKA 2CLVA 1EPFA 6FABL 2MCPH 4JQIL 1OAKH 4OCWH 3WXWL 4GBXA 3IDMA 3OAYK 4WRLA 3U9PH 2G60H 5T1LD 4IOFD 5C92A 4P3CL 1T20A 4WJ5A 4XPHH 2DJ4A 1FH5L 1HYSD 2I07A 1BD2A 2E27H 2F19L 5HDLA 3MLZH 1NQBA 5EUOB 1AXSA 4L3CA 5KZCD 5FOJA 4XVTL 1D6VL 3H7BA 1J0ZA 3L9RB 4HHAB 4QT5B 3C60C 1YPZE 3FN0L 3MGTB 3MRKB 4WO4B 2IQAB 4X5WB 4XTRC 5DI8B 2UZIH 5JTWA 4DUXA 3DECA 5IR1B 3QJFB 1BBDH 4JRYE 4XVUD 5B3NA 5KG9A 3KXFD 3LRSA 1FNSL 4B7IA 5EIQA 2CPCA 5HVHB 4QLRA 2EYRA 2WIIB 4LKCA 4QXTA 3LKNB 4MXVF 3HC3H 4KV5F 2BNQE 3SQBA 4Z7UA 4WO4A 4J8RB 3G04A 4QT5A 1UWGH 3LHPH 4UT7H 4ZTPL 4LCCB 4XCEB 2BZDA 1HZHL 1UJTA 3NCYS 1DZBA 3UO1L 4BSVA 3TNMB 3BMWA 1HKLL 3CSBA 5SWSD 2YBRB 5E6IB 3SE3A 4WV1A 3GJEB 3BO8A 5HGHA 2VQTA 1CGXA 5DJ0B 4YC2C 4PJAF 4Q9BA 1DQQA 3U30C 4GT7A 4FQIL 5C09E 2W0PA 3QIUC 3KPRB 5EZIL 2AJSH 3NPSC 4YHZL 3M45A 4JY6A 3GO1L 3VFSB 4JREB 3SE3C 1VGEL 1W72A 2YA1A 5T3ZE 1YEEH 3FAXA 4NHUB 3LQZB 3CMGA 2EDOA 2OBGA 5BXFA 5IBLC 2BFVH 3QDGB 4P2QD 4C59B 2F5BL 4PB9L 2JJTA 3MZGB 1AD0A 4RNRB 5TE6H 1DBMH 3S9DB 2QSTA 3N9GH 3VXMA 5HHVH 1OGAD 1DN0B 3EFDH 1OAUH 3CXHK 4F37F 2D7QA 4TPRL 4EUPA 1N2RB 3ARGD 1TZIA 1UWEL 4YLQT 3TZVD 1BFSA 4UDUA 3I3EA 4BH8A 3V6FA 1XCQB 4KVCH 4A6YL 1NKOA 1S7XA 1J12A 2BNQA 4AENB 5I1DB 3TM6A 1A7PH 2O61A 1Q9LA 4MCYB 1IARB 3DHJA 3I6LE 5EOCJ 1NCCL 5HDQH 1WC7A 1LEGA 4UV4L 5BO1H 1QLFA 1L0XA 3O6LH 3P9MB 3LRHA 3VWKA 2XFXA 2OQJB 1A6AA 4W4NA 3FQXB 3GIZH 2DKUA 3OR6A 2VAAA 1ITBB 5EZLA 4YDVA 1PVHA 2L0DA 3FB7B 4K94C 4TSBH 4JGJA 3U36A 3MRDB 3IS1X 4Z77B 1F5WA 5D1ZC 4PRHA 3WJLC 4ZAKA 2WUBL 2AK4B 2FSEB 2V2TA 5CJQH 3VWJA 2VDKL 4NQDD 3UBXA 5FDWB 1MELA 1ADQH 5CWSB 1H3XA 1S9VB 5A40E 1N7MH 4PBXA 2QADD 2IQAA 3L5XL 2VSCA 3K4AA 1Q8MA 2VDLL 3D3VD 4N5EC 2WM0A 3U0PB 4KXZI 3QUZA 4H5SB 4WW2C 4FOMA 1I3RA 3G6DL 1GGUA 1U8NA 3VI4F 1LO3H 1Q94B 4WHDA 3T04D 3Q3GA 1EJOH 3C8HA 5IMOB 3RZCA 5E56A 1HI6B 4N5ED 4NCDA 3QIUD 1KPUA 4G6ML 3ROOA 1FLRH 2EDRA 1Q9KA 3KLHC 5BZWB 4CL7A 3FCTB 3EO9H 1NEZG 4WHTB 4L9LA 5JLZA 3TF7C 3VFPA 1RHHB 5KS9B 4HZAA 2O93L 3CFJA 4RGNE 4LFHG 5A2IH 5E99L 3MRFA 3V4PH 2A6DB 2X9WA 3TYFA 4IHOB 3PGDB 4P48A 3IKCA 3QG7L 2ED8A 2XA8L 2YRPA 2EDJA 5JXEC 3VFNA 3R8BB 3ARDA 1Y6KR 1FL3B 1E4XI 1F6AA 4J6RH 5AYUL 2QKIB 2D4FA 1CE6B 5D7LE 1GZPA 1X6NA 1OW0A 4PJGB 4Y5VA 1DBBH 4MWFA 4OI7A 2WQRA 4JN2B 3NCEB 3TPUB 5DK0B 1HDMA 4PGEA 4A6YH 3EDDA 3KYNB 4JZNB 5D1ZB 4EXKA 3SPVB 5FAAA 2XN9B 3GHEL 4OI8A 4MAYC 4GW4A 2V9QA 3KNBA 3C5ZC 4NSKA 1D6EA 3U1SL 3VXOA 1DQMH 4KVCL 4NKIH 1OAUL 2P45B 4ERSL 1K6QL 5EUKB 3T8XB 4H0GA 1RZ8B 3BW9B 3PNWB 1CR9L 4NC1E 4PD4K 3W82A 3W9EA 1UWEH 3KXFA 4JFFA 4PP2A 5EC1B 4OUUA 3HG1B 1GYAA 2EIEA 4Q9RH 4Y1AD 3QULB 2AXFA 1FYTD 3HUJF 3T3PE 3O9WC 3CSPA 1IAII 1XGPB 4PJFF 5FF6B 5D8JH 5H35B 4YHOL 2J88H 3IDGB 1UM5L 3SE9L 4R26H 4ZNCD 5TE4H 2JELL 5KBNC 4L3EA 5A16B 4DUWA 2QHRH 5I19H 2Y72A 3ZE0F 3UAJD 4ZQKB 2W1NA 5GGVY 5IVXB 1UYWH 3UP1A 1AD9A 3O41A 1VGEH 5T5FH 3GUTA 4OF3A 3V7MA 5DJYA 1RU9L 3EOAB 1BFOB 2IGFH 3OKNA 5ESAA 3NCFB 1UKTA 4F2MB 1X5HA 1NCBL 3MV8E 4XCCH 1QSEA 4K3DL 3TT1L 4R0LB 2GEEA 5IGXL 1B6UA 1N4XL 3Q48A 4FQLL 4HX1B 2XY2A 5TF0A 1OWWA 1WFNA 5FA3B 3SGEI 4NHCL 3ULSA 1JGUL 1WUNT 2VDPH 5GS1A 1LHZA 5E4EC 3KAAA 4LEXL 1VFAB 2YS4A 5C0AE 3S3PA 1WBXA 1TNMA 3SJVD 1EMTL 3LDBC 2EO9A 1JFQL 4JN1H 1KELH 2HFEB 2IH3A 2PTUA 4PRDB 5FUOH 4Z95H 4KJPC 2MKLC 1HN1A 4R0LA 2GUOA 1F6FB 1KXVC 3PP3H 2VC2H 3QA3A 1ZS8A 3MCLL 5IMKA 1WWWX 4KRMB 3FQTB 3ZO0A 4YR6A 4TPRH 2IBGA 4K7PL 2Z4QA 4OZHB 3FFCD 4XPAH 3L5JA 1TITA 5IMMA 3P4NB 1HE7A 2YRLA 1U8OA 3GI8L 5CUSH 2XKNB 4LHUG 2OCFD 4JLRB 1RI8A 4WU7B 5F7HA 2P8LA 3MREA 4U1SB 2BERA 3TO4B 1MCKA 4UU9B 3UTTA 4AIZB 3ZSTA 1RUPH 2ADIA 1OAZH 1AQDA 1P4LA 5DSCB 3INUL 2AK4D 4FQHA 1MIML 1VSCA 1EBPA 3PP4H 3IXAA 4WCYH 4MSWA 5GIRA 3BI9X 2M2DA 4JQVC 1K3ZA 5I1JH 3SCMD 4ZPTA 5H35A 1U8KB 4LCWB 1QBML 4HK0A 1TIUA 4Z5RA 3OL2A 3KWWA 4S1SL 1TCMA 3RQ3A 3MGOA 2XRAL 3BIKA 5ENWA 3MV11 4DN4L 1WZ1H 1QHOA 3BW9A 3W9EB 5A2JH 3VI3E 1ZGLA 25C8H 1KEML 2NX5A 4OZHF 3CZFA 1KN2L 4PJHA 1CDGA 2J7LA 5IEKA 3OB0K 5AUMA 2ZOKB 1M6OA 4D8PA 1R3IL 3W2DL 3MPCA 3NIDE 1OGAA 3MV01 3VXMD 1ZLWK 1TQBB 4FZ8H 4MNGA 3QPXH 3CFKB 4AG4L 3T08A 3ETBF 3ARSA 3ZT6A 1CFTB 3QJHA 4RAVA 2DI9A 1V7NH 4KC3B 4N1HB 5AD0A 3V95A 3WUZA 4C56E 3MV7E 2EE2A 5CJBA 4DUVA 1S5HA 2PYFB 3NIGF 2D2OA 4E41E 4XAWL 3HMWH 5EUOF 2ESVB 5I0DA 4LASL 3X3FH 1YNKH 2CLZA 4Q6YA 3TYFB 1J1XH 2P42B 4M8QB 1DQTA 2VLRB 1CVSC 3C5ZA 3WFDH 4IEFB 1JE6A 5C0BB 4JPVL 3L6FB 2IPTH 5FCUL 3THML 3FTGA 4OLUL 3DRQB 3H2WA 3HPJB 3O8XA 1KCUH 4MD5B 3GMNB 3JV6B 2EDQA 1OGTA 4JO4L 3MRQA 1GZQB 4KU1A 5EIIB 1CN4A 4PTTB 4B53A 5IF0A 4RQQB 4P5TD 2X40A 3TZVA 4JVPA 5GSVA 4X5XA 4GQ9L 3PHOB 3VFMB 5ELIA 5I1CL 4X9FA 3I2CH 1R3HA 4P3CH 3BXNB 4QNPE 4WTXA 3HI5H 5ADOH 1RUAH 1GPOH 4P46C 4HV8B 3UTSB 2A73B 4LOUD 3PE9A 3KYKL 5IJVA 4JO4H 3BZDA 1EXUB 4ZPVB 2HFFA 3QNZA 3VXME 4X6EB 1J05B 4NP4L 3IFOB 2A6JA 4HUKB 3DX6B 4G9FB 1BX2A 5HPMA 3C8KA 3IDYC 5D96B 1P4IH 4NIKB 2OQJA 2NR6C 1E27A 4P4KB 3OAUL 5CEZL 3SE8H 2D0FA 5GGTH 3E6FB 5D2NE 3CSGA 4FNLH 5DRZA 4KHTL 1N6QL 1YUHA 4IRSB 5BW7C 2P7TB 3DUHA 4EBQL 3PNWA 5C2BL 1ZHNA 5INDB 3KPTA 4HLJA 4PLKD 4F7MA 2X4RA 2DI7A 4TNVF 5F6IB 2OZ4A 4ZO9A 2EKSA 3DURA 2JJSA 3P11L 5JIHA 1P6FA 2PNDA 3D2UA 5I15L 3FO9B 4GMSL 2VL5A 4V2BA 4JFDA 2IBZX 4R4FL 5DGRA 4TNVK 1AQKH 2XRAH 3GSUA 3K0WA 1IAIM 4BZ1H 2J6EH 1LEKB 3BQUD 5DJZA 3QRGL 1XF5B 3IETB 3QWQB 5ETUA 1Q0XH 5CEYA 3RWDB 2GJ6A 4N8CL 3STZA 5E9DE 3GSNL 1A6VH 4OM0L 3IKCB 4JR9L 4ODWB 3WS3A 3WS6C 2F58H 4NN5C 5C2UB 1JNLH 3MACL 3MV8D 4K8RL 3CSYB 4N5UA 4O58H 5EPMA 3DARA 2QQKL 2Q3AA 4ODUB 1KF9B 2FL5A 1K2DB 1AI1H 1JBJA 3BDYL 3SJVE 3TO4D 3VFUA 1U92B 4JO2H 3C8DA 1H3WM 3C5SA 3RJDA 1MJUH 4YFLI 5B39B 5IP4A 4U7SA 5FCSH 2K7QA 3QAZB 3LEYH 3KPMA 5L8KB 4N1EA 2XWBB 4LLYB 1FZJA 1LNUA 5TQ2H 1MF2L 4P3DA 1ZSDA 3G6JE 1AKJB 4HS8H 5E9DD 4NRZB 4FQQA 3CFDB 2AI0L 5J6HB 2HT3D 3ARGC 2Y7QA 3RL1A 2W9DL 3GSQB 4YFDB 1OP9A 2CKBB 4NQXA 2AJ3B 1VGKA 2AVGA 4NQEE 4GUPB 3PWPE 4OD1L 3QI9A 5MP6L 3UPRA 3D18A 1EEZB 1A47A 3AAZA 5B8CB 4HWEL 1Q72H 4LP5A 3BQUC 4PS4H 3FB7A 5ALCH 2X09A 2YXMA 4QGTA 3UZEA 2C7UA 3MGTA 3OR6B 1UCBL 4JM2D 5JIKA 3T2OA 5F3BA 5DO2D 3S35H 4NZUH 4AIXA 2C1OB 3WSQL 4PJAE 4A2LA 1N0XH 1BAFL 4LCIH 4K7FB 4LRNL 4K8RD 1VADA 3QFJA 5T5FL 1A7NH 5DZOA 5E7BA 5TF1L 3SDDB 3VE0B 3V6FB 3F12B 4HUWB 1HXMB 4FZ8L 4BH8B 2F53B 3PWUA 4MXQD 1MCSA 4GSDL 3SDYH 1FL5B 4TNWF 4L8CA 1RZFL 4RMWA 4JM2B 4DOHE 1Y6NR 4LRIC 4PGZA 5FYLE 4KJYB 3WS3B 3TA3A 1X5LA 3KYMA 2ZUUA 4UTBL 3VXMB 3MOAH 1LDPL 5TPWH 4P46B 4Y88A 4JJ5A 2GW5A 3GNML 2GJ6B 4K9EL 3FQWA 2JIXA 1J8KA 3DSNA 5ITFB 1VFOA 3K46A 5FOBA 1ZANL 1KTDA 2JLLA 5FGCE 1CFVL 3WIHH 5HYSA 1MPAL 1V7ML 2JCCB 5D2LF 1RJCA 4JM2A 5TE4L 1HWHB 1MRCH 3VJ6B 2PTTB 4WUUD 5FO9A 1TVHB 3VFTB 3WIIH 1XH3A 1GAFL 3T3ME 1VKXB 4I0CC 2EE9A 4PJ8B 5CUSL 1OAYH 4P5TC 4HWUA 1JYNA 1NC2B 3U4AA 2H2SC 2IFFL 5F97E 2K9UA 3VDCA 2NY2B 2DLHA 2GTWB 2P48B 4LU5H 5DJ8A 5DRWA 1XT5A 3HZMB 5AZ2H 1HINL 5D7JC 5DQJA 3AM8C 1QSFB 3RDTC 4KK8D 3SDDD 1NPUA 4WTZA 4ZDHB 1RIVL 2X41A 1YUHB 3EJJX 3FOLB 3MRNA 2BOCA 1CDHA 2NXZB 4YHIA 2QL1A 4HW6A 2LE9A 3ARGB 2JE8A 1MI5B 4PJ8A 4U1GB 5DJ6A 1VACA 3QBTB 1NGPH 4KKCD 1KEGH 4QY8A 1NH6A 3UPRB 2DQFB 4B5EA 1OCWH 5C6TH 1AGFB 3QXDB 2B20A 3MLVH 2IADA 2GTZA 4EVNA 2PN5A 1I7RB 1ES0A 4DKDC 5JPMB 4H88H 4HQQL 2FR4B 4OLYH 3WHE1 4HC1L 2Z31B 4DVRL 1RZKH 5KSVB 3ARBA 4LVHC 3ISWA 4MD4B 3BHBB 2HG5B 1C1EL 3LD8B 2Q87A 5C6PB 3Q1SH 2Q7YB 1FBIL 3GMQB 1RURL 3BKML 3MRHB 1HNGA 3VXUD 1RU9H 2HRPL 2Z93A 4Y89A 4C56A 4YZFE 2A77H 3N1PC 3OSKA 2P44B 4IRZH 2R0LL 1KN4L 2AABH 3F7VA 4HIEB 3UTPD 1QYGL 3VW3L 4XBEL 1L7TH 3QDJE 1I1AC 1KGCD 1QG3A 4LSSH 4YPJA 4S1RH 1UXWB 5K33A 2A83A 5HI3C 1WBZA 3BVNB 2BXYA 3G5XA 3QIWA 4MD0A 1IBGH 4I5BA 2JB6B 1BD2E 2VITB 3GJFH 2X4TA 1T89A 4LCYB 3TBWB 3S88L 3VXSD 1JHTB 3SKMA 4XNQB 5GS0L 5EWIL 5EZOH 2AABL 1BIIA 1YN7A 2BSSB 5DD6B 4S10A 1MCRA 4QNPF 3E8UH 1T4KA 1YMMD 1IGCH 3GFUA 5DJZB 3TEUA 1M7DA 3C08H 4LOUC 3ZE1E 5FO8A 4OF7A 3MJ9L 4WWID 4APQB 3O4LE 4DFHA 1U8JB 1VB9A 5IKCA 1BIHA 3O3DB 5GRUL 1G7LA 2C1PB 3DXAE 3IFNH 3PHQA 3R1GH 3HMXH 3KPRD 4N9OB 5KSAA 4X0KB 4GKZA 2XNAA 3NA9H 4I18A 2Y5TB 5IT2H 4R7NA 1WZKA 4ZD3H 2P8MB 3GHEH 3GMMB 3T09A 3OKMA 2X4UB 2WP3O 5SWZE 3OKYA 3TWCH 4PGDA 4HBCH 1TPXB 2R23A 5CBEA 1YNTA 1W0YT 4YGVB 2GFBB 3VA2C 3QISA 4L4VB 2XG5A 1MVUA 5FUZL 3LEXB 4Q74A 2CQVA 4Z78A 4X6EA 1MJJB 1IJ9A 2CO6B 4NUGL 4ZPVA 5BMFH 3LMJH 2J1KA 2J8HA 1RJLB 3CH1B 3G08A 1F58L 4FQHB 1U8MB 3ES6A 4YHZH 1RMFH 1QACA 5D71L 1NBZB 3CVIH 4XBEH 3UC0L 1PYWB 5E6ID 5JR1H 1WF5A 1T03H 1FVCB 1MCWW 4M1CD 4Y4HC 4JFZH 4KJWD 1A0QL 1OTTC 1S9YA 3LKQB 4UTBH 4YXHL 1UYWL 3HS0A 4GRLB 5IGXH 2FIRT 1UM4H 3BKYH 1C16A 3FQTA 4JHAL 5ACLA 1URLA 2MQ3A 3IDIA 3JV6A 1QFWH 4PJCE 4JFDB 4L9DA 4DVRH 3L3DB 5HHNA 2BSTA 3ARED 3FO9A 3HC0B 2VXQL 3DMMC 4X8JB 4YHOH 2OR8A 3FB8A 1QFWI 1FNLA 1NGZA 5JNYB 2ITDB 2Q6WA 1MCHA 1UA6L 5CP7B 4KI5F 3QXVA 3AROA 3L7FB 4TSAL 5FYLL 4X5LA 1RUML 5T1LB 5C0IA 2HT4D 3FQNA 1LDSA 2E6PA 1AGBA 4ZTPH 1S5HB 4RIRB 2BX5A 4RX4D 3RWEA 1KCSL 2M1KA 3E3QC 2Q76A 2C4FT 1Q72L 4G9FA 3ULVL 4JPWL 1XGQA 1ORQA 1QFUL 4F7PA 5GGRA 1W72L 2NY2C 1FLTX 4WFFE 5C1MB 1SYVA 5ICYA 2VQ1A 2NYYC 3OZ9L 3OXSB 4DTGL 4HCRL 4QO1A 5CD3B 2X4SB 3MUJA 4M7KH 3ZHKA 3VRJA 1HHIA 4PJCF 3CX5K 4LSPL 5KJRL 3B2VH 2EH7H 3K2UL 3BP6A 1JHKL 4HIIB 4G7VL 4OQ1A 3WDHA 1K4CA 5IF0B 1N6VA 1JJUA 3TN0B 3UTZB 3CH1A 3CCHA 1LE5B 5EU5A 5CJXC 1ACYH 2HTLC 2VYRE 3WDIA 1FAIH 4CNIB 4YX2H 1W72H 3W0WE 5BS0E 2X4QB 2DMKA 2RCSL 3G6JA 4ODXB 1TMCB 2PCPB 4L4TE 5HGGS 2R29L 4NN6C 3EO9L 2CRZA 4YHNA 5F1KC 2VLRA 4ZFGH 5B22A 4PGDB 4FZEL 5JUEL 3QCTH 4O2FA 4WHYH 4F7TB 4YNYB 5I1KH 3CZJA 3H0TB 3V8CA 1QLEL 2FGWL 3VXNA 3PWJA 3O3DA 1CD9B 1MNUL 4ZSOE 3MRMB 1DLFL 4AMKL 1YMME 1LP9F 3IXTB 3FMGL 3O3EA 4UMGA 4Z0BH 5GGUB 1WIUA 4Z76A 5IK3B 2GJZA 4MNGB 5J4MA 3B8YA 4GAGL 5IVXF 1XR9B 4OLZL 2X10A 2ZG2A 1JZ8A 3M8OH 4WO4C 3NTCL 4H1LG 5H37H 5HYFA 4X80H 4Z7OE 2H45A 4UT6H 3VFNB 4G6KL 2YC1A 1D5BA 3GDBA 4ODBD 1B0GB 5IB4B 2AI0H 3CMOL 4NQSB 3MRCA 2HKHH 1IGFL 3IJSB 3HNTH 2VLRE 3ULVE 4CKVX 4Z8FL 4ZNEA 4LSTL 3RNKB 1XIWD 3HPLB 2HTLD 4HUUA 1ZT4B 3K8KA 2NY6B 5IW1B 1G7QB 1NFDA 1UT9A 1TJGL 1J8HD 1Q9KB 5CJOL 4CNIA 2APTA 5D1XD 4WU5B 5EU5B 2H2SD 2NY7L 1A6UL 2ZCLL 1DQJA 1MFAL 2PW2B 2G60L 2Q7YA 3QQ3B 4OKVB 1AI1L 4OAWB 4QRRB 4DWHA 2X1XR 4Y1AA 2RQ8A 2EZ0D 4TUKH 5C9JB 2ZUYA 5DJYB 1LO0L 4XAKD 3PL6D 5AZ2L 4ZUSA 4ODHL 1BZ9B 5EOTA 5KANG 3UTQA 4PJXB 5C0ND 5JXED 1OT1A 3WKML 4QHMA 4OCSH 3IGAA 5GGRB 4LK4A 2V2TB 4GKOA 4O02H 2Z91A 3I85A 4PRHB 2VOTA 4U1GC 1I9EA 4Z78B 2DD8H 2VZUA 2M26A 3KPNB 1CDYA 2WWKT 5E1AB 2Y6SC 5JPNB 2DMCA 4K7PY 4RIRA 3FQNB 4Y4KA 4KQ4L 5C09D 3MMEA 4N0FA 3ZZ1A 5CINH 2Z31D 5DGQA 5HDBF 1X5AA 5LG1A 4OFVA 2DQUH 4KHXL 2E7CA 4M7JH 4GMSH 4NM8L 3WJLA 4U6XB 5FKPB 5IM7B 4K8RC 1FO0H 1DBKL 2R0KH 2KUTA 3VXRA 3ARYA 5D7IB 3TV3L 3FB8B 4TQEH 3RWFA 3P73B 1LO2L 2EDXA 3MXWL 5E8PB 3D39A 3FRPG 1O7SA 4JB9L 5CP3H 4M8VA 3L3IA 5KW9L 1C16B 2BNUB 2V9RA 1U58A 2HRPH 4N9GA 1FG2A 1FNEB 4LASH 2YZ8A 5HHQA 3VGDA 3MNVB 3P0YL 4K07A 1C1EH 1AR2A 5A43C 3PDGA 3K7UA 3FHQA 4K71C 1LVEA 4LCYA 4DZBA 3V8OA 3RA7H 3SKJH 2WBWB 4KKBC 4ZQKA 3ILQD 3NFSL 1MREH 5C2BH 1KV3A 3RUGB 3P0GB 4IRJA 4ETYA 2X7LA 4QWWD 3IF1A 2NCMA 5CEZD 4GFTB 5MI0C 1O5DT 3QUYA 5C6TL 1J86A 4A6YB 4TOYL 3RGVA 2KZ1B 1P2CB 4PJBB 3HE7A 5EFIA 3LV3A 4XNYH 1EAJA 4HUXB 2FWOA 1HCVA 5DVOA 2IEPA 5TDOA 4JRYA 3RX8A 5JDSB 1RUAL 4RAHA 5AZEL 4UB0H 4P2OD 1RULL 4F58L 2YPLE 3QQ4B 4PRPD 4MXWH 4PRIE 1I3GH 4X0KA 3GI8H 3OJDA 4TUKL 4LARH 5I1HH 5J89A 3P0VL 3V79C 1DUYB 3DVIA 4KK6C 1J1XL 3WKNA 3ARFD 4WTZG 2OTPA 4Z0XB 2FX7H 4AIOA 3VWJD 4QCIB 1U2CA 2W0FB 1R5IB 4GRMA 4JG0L 2QKIA 2LFGA 3U6RA 3HZYB 2VAJA 2VXTH 4FQQB 5HHPB 5ERWA 3ARGA 4Y2DD 1BP3B 1JHTA 3UXFA 3TBWA 5F7MC 1YYLL 4MMXC 4FXKB 3VG0H 2VR9A 2Q8AH 4IHOA 2QR0B 2UYLA 3GBML 4Q97A 1EHAA 3BQUA 4MJID 3GM0A 3BEWB 4G6KH 4L29B 3EYOB 2ITDA 4M48L 1JPGA 2J6EL 4TULL 2W65B 3TYGL 1RHHA 3ARZA 3BKJL 3PJSB 3VFVA 3RIAK 1C7TA 3O45A 5IESH 1KT2A 4L9LB 4G43B 2DB8A 2W9EL 2CLVB 2PXYC 2Z93B 4PLJD 3BMVA 4LSTH 4Y16B 4MA3B 1IC7L 4R2GC 3RWCA 2QQNL 4L8SB 4PRPB 4MZ2A 3MTRA 4M5YL 4U6TA 1PY9A 1N5AA 3VCLB 4PGBB 1UH4A 1A7RL 4I4WB 2VDNH 3CX2A 2FHCA 3DETC 4PJ5D 4ONFL 4RISH 4UINL 4KHTH 4PRBA 4XTRD 1GGBL 2R1XB 2XY1A 4U1JB 4L8BA 2NY5L 2J3SA 1P1ZB 4I2XB 5CBAB 1FCGA 2XQYG 4NGHH 4ODTH 4YZFF 3HE7D 3VXSA 3IJHA 1BD2D 1OLZA 1FIEA 4QF1A 4QY8B 2ADFL 4YFEA 2X4NB 5KSBF 4Z77A 4WFHD 4R9HA 1H0DB 2NR6D 32C2A 3GGWA 5HHOB 2VL5B 3DYPA 1JNNL 1ZHLB 1YEIL 3W11D 4ZUVB 1ZLVK 5I76A 2V17H 4LAQH 3FT4B 4QRRD 4XXDA 3O2VH 2DQIL 4FXLA 5HGHB 2CJUL 1D5XB 3Q1SL 5C0DB 3TVMB 1LEGB 1VHPA 4F58H 5INDA 3QIBC 5F7EL 4CMMA 1E4JA 4U0QB 1YMHB 2Y06L 4N0FB 5FHBH 3LSOA 5DUPL 2XACC 4HJGA 3VG9C 4G8IA 4XCEA 1UKSA 5EORL 4AEEA 1NANH 4PTUA 3RZWA 1NL0H 4NQCD 5BVJA 1HKFA 3ARDC 2C7UB 5HHMD 4ZUVA 3RIFF 3C8KB 4GW5A 4LSRH 3VXPB 5T3XE 4UUJA 1EV2E 3QWRA 1F6LL 1HQRA 1FAIL 1KJVA 4LLAA 5D7SL 4RMVA 1N8ZA 4YDKL 3ARQA 2VXSH 5HYJE 3GBLA 3RTQA 5IBLD 2A0LD 2CIIB 5GS0D 3CFDA 2V2WB 4HWZA 2FRGP 3SE4A 1OB1A 3MRKA 5GGSB 5IVXE 1NBVL 4HHAA 3ARBC 3AS0A 1MI5E 2X4TB 3C6SB 2BDNH 1INEL 3V4UH 4WENB 5LJYH 2JB6A 1JP5A 4H1LA 3RZCC 1Z9LA 4OQTA 2Q1EA 4RQQA 3S4SA 3JV5A 1XIWA 2ICWI 3V6OC 2ESVD 2P46B 3MA9L 5ITBL 2AV7A 3GSVA 2B1HH 3GMOA 1ZHBA 4U6HB 5SV4A 3EOYG 2DQDL 4JFED 4RFNB 1HILB 3KPSD 1AGEA 5ISZE 1BECA 2IMNA 4JHAH 2MSPA 5I8EA 2OX5A 4N0UE 5C9KA 2VWEC 5IHBA 4NM4H 2UZYB 3S4SB 4NJ9H 5HDOA 1AGCB 1ZANH 5MEND 2OLDA 4IDJH 4JO3L 3MJGX 1D5BB 3OB0H 2HLAB 3ARBB 3PWLA 5HHPA 1KPRA 5I2IA 4HAFA 5D9SB 1OW0C 4X7TB 4U7KA 5CJQL 1N3NB 1AC0A 3VI4E 2AS5M 4GUPA 4GJTB 1DBJH 4HWBH 3CH8A 2MPAH 1IAOB 4ACPA 5DD0H 5D8JL 3MLXL 3OJ2C 4D2NA 2ZOKA 4KWUA 4Y19D 3H0TA 2KZWA 5FFLA 5DFVD 4WI6A 3AUVA 4HIJA 5I1LB 2NX5B 1X5IA 3BOVA 4CMMB 2AEQL 3OX8B 3RBGA 1QA9B 1YEHL 1A9BB 3CVHB 4ZUWB 3MBXL 3JBG7 5DQJB 2FHFA 5KJRH 1QOKA 4HK0B 4BUHA 3ARXA 4ZPTB 4APQD 4TSCH 4FABL 1CLYH 3NCCB 1WICA 3LY6A 1KBGH 4PJXE 3KR3H 4PJAA 4NBZB 1B9ZA 1P4LB 3MLYL 3MZTA 5SX5K 3UTTB 5T1KB 1MJ7H 5GS2H 1SVZA 1C7SA 5BZDB 1DN2A 3PQYA 2WK2A 5EORH 2AQ1A 2V9TA 15C8L 2ATKA 2B0SL 1H8OA 2AERT 4XNMB 2MFNA 4YGAB 3TN0C 3WHE0 1TQCB 3D6GA 1FNEA 5FYJU 2R9HD 3M17A 3NABL 5C08B 1TZHA 1LO3L 3ULUE 4G8EB 3JVGC 1DQJB 4FTVE 1NLBL 5FHAL 4F7PB 3QO0B 1PQZA 3D39E 3QPXL 1SY6H 3LB6C 1KT2B 4J3OC 5CEXA 3RI5K 1BLNB 1CK0H 2ZZUT 1K4DB 3FT3B 5E24E 3EZ8A 1WSST 5D7IA 5DJAB 5C0CA 3LKOB 3TJHD 3ZKMD 4QRUB 1OY3B 5DD0L 3LS4H 5DTFA 4F7CB 5DK3A 2DBJA 4R6UA 2CLZB 2P7TA 4QRQB 1GOHA 2ESVA 2SEBB 3O2WH 4NOFA 2YR3A 2C1OA 4ODVH 1RZIA 5E95B 5E8NA 1NGZB 4H0HB 3SDAA 2VLMD 2X1WL 4Y16D 3AXLA 5JPNA 1GGIH 5EZIH 5BS0A 2DQDH 5HGAA 5JQ6L 2CRIA 3QEQB 3Q5TA 1S7RB 5JOFA 3NOIA 4Y19A 2ICES 1IKFL 3NGBB 1S7TB 1YMMB 3E0GA 1I4FA 4Y5YB 4P9HL 1OAXL 2X9XA 4EDWH 5M7QA 3BISA 1MHEA 4Y4KD 5DUBB 4NC2B 4G6FB 4UTAH 4J4PC 2VLJA 5IHZA 5AEAA 3IS0X 2R0KL 3MRJB 1H5BB 5CGTA 3ZDZF 4W4OC 4ZOCA 2EIZA 5SWZD 3VDBA 3D2UD 4Z9KB 5DJCB 3AREB 5DFVC 5TDOB 4OD1H 3D3VE 4Z7WE