2FB4L

Dir primaerstruktur des kristallisierbaren monoklonalen immunoglobulins igg1 kol. ii. aminosaeuresequenz der l-kette, lambda-typ, subgruppe i (german)
Total Genus 46
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
46
sequence length
216
structure length
216
Chain Sequence
QSVLTQPPSASGTPGQRVTISCSGTSSNIGSSTVNWYQQLPGMAPKLLIYRDAMRPSGVPDRFSGSKSGASASLAIGGLQSEDETDYYCAAWDVSLNAYVFGTGTKVTVLGQPKANPTVTLFPPSSEELQANKATLVCLISDFYPGAVTVAWKADGSPVKAGVETTKPSKQSNNKYAASSYLSLTPEQWKSHRSYSCQVTHEGSTVEKTVAPTECS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The primary structure of crystallizable monoclonal immunoglobulin IgG1 Kol. II. Amino acid sequence of the L-chain, gamma-type, subgroup I
pubmed rcsb
source organism Homo sapiens
molecule tags Immunoglobulin
molecule keywords IGG1-LAMBDA KOL FAB (LIGHT CHAIN)
total genus 46
structure length 216
sequence length 216
ec nomenclature
pdb deposition date 1989-04-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
L PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2fb4L02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2fb4L01
1Q1JL 1UEYA 1KELH 3KLAB 4YDVA 1FCGA 1UZ6E 1AXTH 1YEDA 3LRSB 3X11A 3OKEA 1P2CB 4PGDA 3C9NB 2J88H 3CFDB 2EH7L 1HQ4B 4HC1A 4E41D 4ODSH 2EIZA 4WEMB 3FT4B 2VDQL 1G1CA 4LBEA 3RVXD 2R1YA 3JWDC 3GSXA 3CUPB 1JWUA 1MCBA 5F1NB 1PD6A 3G04B 3GKWL 3EGSA 3BZ4B 1ZWIA 4TTGA 1WBZA 2H32B 5ESAA 4H20H 3UYPA 2EDDA 4IMLA 3GSNB 3RUGF 2XZQH 1RUQH 2AJSL 1I4FA 1I75A 5SWZB 3BH9A 4L8CB 4QRRE 1FO0H 1LP9A 4N0YH 3ZHKA 1IGFH 3SKMA 1ZLVK 3TZVA 1PGRB 3CH8A 1U8QB 2JELH 5HPMB 3MLPA 2D31B 4KRPC 1IT9H 5DJDA 2YD1A 4HUVB 1QFUH 3OXSB 4H1LH 3O6LH 1ZT1B 12E8L 1CFSB 4KWUA 5MEPB 1KULA 3WNNA 2YRZA 3H9HA 1UADC 3UJIH 3NTCH 3TO4C 5AUMB 1DBJL 3CX5K 2FJHB 4GH7B 2ZJSL 1XF1A 1CICA 4OLUH 2IAMA 2Y5TA 1MHPL 4KH2A 3CPLB 5IF0B 2YC1A 1MCEA 3BW9B 5GRUH 1VEMA 1NUGA 4N9OB 4W4NA 3S98A 3P9MA 2DWEB 5IBTL 3HRZA 5F8RC 3IU3A 3O3AB 4TN9A 5CILH 3JUZA 1KEMH 1OAKH 4ZFZB 1IAOA 1KGCE 3DBXA 5ADOL 4HUXB 3F5WA 5C0NC 1Q0YL 3WV0A 1T7ZA 3IAGC 1KJ2L 3GM0A 3RY6A 3ZKXC 3CVHB 3QFDA 4LASH 1BOGA 1CTOA 4G8GA 5BRZA 3IXAA 3SDCC 1HXMA 3MLVL 2A6JB 3GB7A 2C4FT 2XPGB 2NW3A 5AG9A 1A2YA 3MGOA 4ZG1A 4P2OC 2CR6A 4N0CD 1V3JA 4WFFD 5C9KA 4M3JA 4P4KB 5J9PA 5I6XB 4RWYH 1ETZA 2H2PD 2BERA 1HWHB 2JK5B 2APFA 2HG5B 5HHQB 2VAAA 1D5BA 1KLFA 3O6MH 2NY3C 4OB5H 5F7FA 4OZIE 3VD9A 3VXMD 4GRLB 4NQTA 1MNUH 1RQ5A 1RMFL 3BRDA 5H35B 3GJFA 5I2IA 2QQQA 3HMWL 1T4KA 3EOAA 3O4LD 5T33H 5FECB 1P84K 2D4FA 3MRJA 4JFDE 4JVPA 2A1WH 4XT1C 1WV7T 5FUOL 2Y6SD 5JQ6L 4H5SA 5CSBA 1L6ZA 3QUXA 3KPLA 4PJIE 1J0KA 3TYGL 1T0NB 2E27H 4PJAA 5JW4Q 2GUOB 5JHLL 3P9LA 1H9VA 1MNUL 4LKXB 3FB5B 2LQRA 1GL4B 1MLBB 4RX4A 1PDKA 4ONOA 3RA7H 3MYZA 1VFBA 4U1NA 1BQSA 1N0LA 4K7PL 3SE3A 3QRGH 2DS4A 2GTWB 5TH2B 1PQZB 1GZPB 3MBEA 4IRJB 3LEVL 3BGFB 4MNGE 2DQTH 1KB9K 2X1QA 4AZ8A 1ZA6A 4NQUA 4G43A 1K8DB 2VH5H 3GHEH 1AR1D 1URLA 2WBJD 2OL3H 3BQUD 4BZ1H 2ZUQB 1FL6A 2XQBL 1AQDB 4M6NH 3F8UB 4AEIH 4F7TA 3ARBB 5H2BA 1N6QH 4O02H 4KY1H 1WWCA 4B0MM 4XCCL 4LGPB 5EDXA 1NBYA 4L4VD 5F89B 1RIUH 1KFAH 5ICXB 4Y16D 4Y16B 4ODVL 1L7IH 2NY4D 1XAUA 1X5XA 1HSAB 1NBZA 2BNQA 2P5WA 3TO4A 4UTBH 1NGXA 2DBLH 4D9RE 4CUCA 1KLUB 4KJPC 4W6YB 4PJBA 5HGDB 4NNYA 4EDXB 3KLHD 4FOMA 1N8ZA 5CEZH 1OQOA 3TBWA 3EFFB 3QH3A 4YPGA 4CDHA 2DQJL 1FGNL 5IIEA 1RU9H 2AK4A 1JIBA 4TUKH 4H0HB 5TFSH 5DMIL 1UYWH 3WIHL 2EDLA 4QYOB 2DJ4A 2DAVA 5GRWA 2XTJE 2I60L 4KRPB 4MNQB 1T2QH 4OT1L 4X7EC 4BM7A 1NAMB 2BOBB 4HWEL 4JFXA 4LLWA 5C9JB 3HZKA 2C1OB 4CVZB 1UVQB 1EEQA 4O2FA 2AJSH 4RMUA 4I48B 2B39A 3MLUL 1KB5L 2QHRH 4M8VA 2UV3A 3MOQA 4JJ5B 2A9ML 5LAXA 1U2CA 4KRMB 1IBGL 1UQSB 4QT5B 3RWEB 1QP1A 2PTUA 5EOQH 3Q0HA 4P23B 1FJ1A 1A0QH 2Z91B 4PRAB 4Y5VC 2VXQL 5D7IA 4N90E 1WFOA 3K0WA 3KPRB 5DLMH 3DO7B 3HTLX 5LXGH 4KUZH 3E6HB 4U0RC 3VWKB 4H88H 1DE4B 3N1FC 5EBLB 1CR9L 3GIVB 4NO2B 3HR6A 3QUZB 5T1LD 3NZHL 3QUZA 2WWMD 5JOFB 1G0YR 3MC0A 3MLTB 4B53A 3E6HA 1OT1A 4JQIH 3IFLL 2XKNA 5EPMB 1HKLL 1S9VA 4NZTL 4FRWA 4QKXB 5JMRA 4RISH 2IF7A 4Y4FB 2VNCA 1FJ1B 1CLYL 3VDAA 3RWEA 2QSCL 3NACL 4JPIA 3H9SA 2VLKB 4UQ3A 2BFVH 4AIXA 1C5BL 2NNAB 1LO2H 2GW5A 4JCLA 2BSED 1T5XB 4F9LA 3RL1A 2I07B 4RBPH 2IJ0C 1QO3B 1EMTH 5B8CC 5DLML 2AAVA 3O9WA 3ARGC 3OBAA 1UXSB 3HE7A 4PJ8D 4WI2A 1PBYA 4ETQB 1YEGL 5DFTA 2CLVA 4H0GA 3LAFA 1AI1L 2FJFA 2O5XL 2RCSL 4HPYL 4PRDB 3O2VL 1AR2A 3KAAA 4NN7C 4D2NA 3QXDB 5HGBB 3ECBA 5EZIH 4F57L 3MRCA 5IIEB 5I16B 5LBSL 3LHPH 4HUUB 1H0DA 3IKCA 3WIIL 4R7DB 4XXCC 5I0DA 4X0KB 1AGBB 4G7VL 3TVMB 5DRZB 5L7XH 4MGXA 2QADC 3QQ3B 3MGTB 3S5LB 3CFIC 2YN5A 4X7FC 3CFKB 4Y4HB 4LCCA 3BEVB 1X5ZA 1AJ7H 5A2IH 1Z9LA 1JUFB 4LU5H 5DYOB 2GSGA 3K2UL 3CGTA 1G6RL 1M7XA 3R0NA 2ZCLL 4O2FB 2D7NA 5D7SH 3UTTB 2EDJA 4X8XA 2VISB 4P3WA 5JIPA 2D2OA 3P30H 1ZA3B 1RIHL 1I3GH 4GRWH 4U3XA 3HNSH 3IDYC 3I84A 4ZQKB 4YXLL 5I16A 1QSZA 3IRPX 3VXSA 1KCSL 3VG9C 1NCTA 4OZHE 1MAMH 4RMQA 5JXEA 3S8WA 2HTKC 4ZFOB 4Q58C 5CGYD 3QULB 1NCBH 1SMAA 3D2UA 4JO3L 2H6PA 4JO2H 2V2XB 4AG4L 2A6IB 3OKMB 2CIKB 3TWCL 4G6KL 5IROC 1L9MA 4PJ9A 1MPAH 5TE6L 5I71C 5GS0H 3MJ6A 1OD7A 2YA2A 4RMVA 3SDCA 4F33A 3ZDZE 5CJXC 4NM4H 4PLKC 5F89A 4W6XB 3GHEL 4M1GL 3CJJA 1MEXL 2CXGA 4K55A 4DKFL 1JWSB 3T1FB 4D0BB 1ADQA 3DLQR 4XCYB 3LIZH 1D5MB 1CLCA 4XMPL 3OGOE 1F6AA 1T80A 4S1SL 2H9GB 5IEHA 3LPFA 3RI5K 3W9DB 5JZ7D 1IGMH 5IMKA 3RVUC 4F7CB 4JJHA 3B6SB 1HSBA 2OSLA 1JV5A 2UUDK 4E5XB 3FJTA 3VI4F 1NAKL 4TVSa 1CLZH 5JO5A 1KCLA 4PIRF 4XP9L 3UTZA 5FYJE 1VENA 3LN5A 4R9HA 1F6LL 4GKZA 3WIHA 4KI5F 3CH1B 3ESVF 1RZGB 2CMRL 3LN9A 4NSKB 3GB7B 3SKNB 4LHUB 1M7DB 5FGBC 3QDJA 3L6FA 2K3TA 4YBLB 3O9WC 3L6FB 1KT2A 4Y89A 2GEEA 3KPNB 4LLMA 1E28B 3FHAA 1SJHA 3QEQA 5D5MB 3VRJA 1XGUB 3VFWA 1NJ9A 4UDTA 1J18A 5D1QD 2VZ1A 1P4LA 3FOMA 1DSFL 3KYMB 1JRHH 3GSQA 4Y2DC 2ZUVA 3IDYB 3ZE0E 4PLJD 5DDHB 5JOEA 1JV5B 1OPGL 5CP7B 3P9MB 4JGJA 4N8CL 1H3XA 1XIWB 2C1PB 4RFNC 3WNMA 3QIBB 1QZ1A 2YEZB 1I9IL 5CGTA 3QWRA 2QL1A 1MCCA 4GUPB 3BPCA 4YR6B 5B4MD 1RUAH 1U8HA 2NTFA 2FL5B 3R1GL 5CUSL 3MV8D 4LAQH 3K8KA 3RU8L 2QQKH 5IW1A 4I4WB 4G8FA 2CR3A 2EE6A 2OS7A 4H1LG 4UU9A 4NCC2 4QXGL 3MO1A 4X6EB 4FQHA 3CAFA 5EO9B 4KUCD 5I1KL 1A9EA 1K8IB 1CFTB 4OM1H 3WKMH 5ACZA 3EIFA 4LP5A 4KROD 3DX9A 5CILL 1SMOA 2W9DL 4U6TA 5C0DB 3IDNB 4KV5F 2MCPH 4JY4A 2DN7A 3PWNA 4HQQL 4LHUD 4WO4A 2Y07H 5ANMB 3DBXB 1YEEL 3VXUE 3GKWH 2N7AA 3BN9C 2MJWA 4KDTA 2BNQB 5JLZB 1RZKH 3T4YA 2ESVD 2IANE 3VJ6B 3AMKA 4L8BA 3D69A 1CIUA 1FP5A 4NDMA 4YC2C 2VL5A 3LKNB 4CAGA 4LARH 4UTAH 5KSAB 4OF3A 5FDYA 4LSRL 3BZ4A 2NY5H 5EOTA 5BQ7A 3V52L 1SJEB 4P5MA 1IT9L 1S9WA 5EU6E 2IWGA 2W07A 5I1LB 4J3UA 4WV1C 4PRHD 4WDIA 1EMTL 1CDIA 3LV3A 1ZT1A 4JY5L 1MCLA 5HHXH 3MBXH 4M9OA 4XPFL 5J12B 1EHNA 2P43B 3DGCR 4MLSA 2MPAH 1RVFH 4H8WC 3UEZA 5IFHL 4O9HL 1DVFD 3VGHA 3F62A 3MGTA 4KC3B 2AXGA 2IQ9H 4P5TD 1CE6A 1UT9A 2YSSA 4RMWA 3I3DA 5FGCE 4R7DA 2GYSA 4IMLB 4RISL 5IB2A 1SBSL 4Z0BL 3UXFA 3PV7A 5FK9A 4PJEE 1WBZB 1YEKH 2HN7A 4OZGE 1CDJA 3GSXB 1JTOA 1T1XA 1BD2E 1MREL 2R2EA 3LKOA 4P2RE 4BFGA 4J1UA 1D5XB 5MEQB 1S7XA 5LGJB 4ETQA 4HUWB 3NPSC 1HIML 3CSYB 3QAZC 3QDJE 4GMTL 5FYJL 2W0PA 4XXCA 3C6LA 3SE9L 1J0YA 3DX6A 4ZOBA 3MOAL 3ULUL 4HIXH 2EXYC 5EIIA 5MERA 3C5JA 5KN5B 4DW2L 4I0KA 2BOCA 5DTFB 4PJDE 3FN3A 4P4KA 5J9PB 2LAGB 4YDLB 3V4UH 2A9NL 1VGKB 3QG6B 2XWBA 5D2NC 3B8YA 4KHTH 4FHBD 3KPPB 2I9TB 4OZFA 3W9EA 5GJTL 4UV7H 2ZSVB 5DJXB 1B3JA 1L0XA 2AJYH 2R56H 1P1ZB 3BPOB 1M6OB 1S9VB 4JDVA 1Q9LA 4J3XA 1FZJA 3PWPB 5IBLD 1LK2B 2ADFH 5FYLE 1WFTA 4FQ1L 5JOFA 2PCPB 3O2VH 3JVGC 2ATPB 4X7TB 4OGZA 3L1OH 3SGEH 2X4RA 1T1ZA 4MCZB 4EUPB 5SV3A 4A2LA 1FAKT 1G7PA 3B5TA 4CVWA 1E27A 3K80A 5ALBL 4TUKL 1FL3A 4YLQT 3VCLA 4IRZH 2A77L 3N50A 5DMKA 3SY0B 4LLVB 5JW3L 2DL2A 4JEGB 3ZSTA 1R3HA 1U6AH 3CK0H 3ZT6A 4HC1L 5EU4B 3GM8A 2YUVA 2OTUB 5JDJA 4G42A 4J3VA 3TPKA 1J1XL 1EXUA 2YD3A 5D1QC 4M7KH 5HGGS 2C3VB 4Y2DD 4P2RD 3OXSA 2KZ1B 3BQUA 1XGUA 5CJ8A 1FFNA 4K9EL 4Z7VF 2BRRL 3TZVC 5I75C 4NQCB 3LS4H 4WVRA 1DQLH 5KVGH 1UCBL 4K3DH 3DPBA 1YPZE 2HJFA 3O3BB 3VXTB 3IDIA 1N7MH 4M1CD 5F72S 5T1MA 3VFTA 3I3EA 4NC0B 5D5MF 3BHBA 5I73B 2DLIA 1CXHA 5CJBA 1G7HB 1QBLL 1QBMH 5D71H 4XMPH 2NY5L 3ARWA 3E8UL 1MFAH 4O2EB 4GG6A 4U49A 1ZLWH 2FX8L 3DRTA 5MI0C 1QLFB 4NFBA 4LIQE 5IROA 4NJAL 1IVLA 3ZL4H 3MRKA 1Q9WB 1UG9A 3TO4B 1QA9A 5ADPH 5GS0C 2X7LB 1I3RB 4JFQB 5CCKH 1WAAA 3GBNL 5CJXA 2A6DB 3QCVH 1YEJH 4R6UA 2IPKB 3DI3B 3ROOB 1WC7A 3QXTA 4NFDA 4OIAA 2X1OA 3MLXL 1NC4D 1YEFL 1LDSA 2DLFL 4DCQB 3ZL4L 3NA4A 4KJWC 1ZGLP 3DV6A 5IHZB 5C0JB 2NCMA 4YBLC 2V5SA 2UWEB 4ODXB 3KR3H 4FFZL 1X6LA 1J8HD 2DYPA 1U8MA 1UKSA 5BV7L 1PQZA 1FC1A 3BJ91 4XPTH 3VWKC 3LS5L 3QNXB 5ISZB 2YPVH 4G3YH 1Z5LB 2AXHA 5C0AE 3DXAD 4XH2A 1OM3H 3LHPL 2WZPD 1M7IA 4NKQB 5D93B 4QOKB 4Y1AD 2VKWA 3PL6A 1FSKC 3ULVL 4HS8H 5HDQH 3MLYH 1QTYT 4M62H 3DX8B 3EOAB 2GITA 1EZVX 2FB4L 2X89D 2GY7B 4J23A 4LVNB 4WEBH 3QEGL 4KKNA 1FE8H 2A73B 5GGVH 4H26A 1NUDA 1AQKH 3CFKA 4NHCH 4EIGB 1DBJH 3WIFA 2VLMD 1G7JA 4LLDA 2EDEA 1PKQA 4YHMH 1GPOH 1B88A 5E8PB 3P73A 4HS3B 2F9BT 1NMCC 5E2WH 1YA5A 4HPYH 4B50A 2ZUUA 5L2KE 4TVPL 2UWEF 3GBLA 4ODTL 3O6LL 5BVJB 4LPUA 5E1AB 3D69B 4BYHA 4NM4L 4M02A 1OHQA 4L3EA 2X4RB 1C8PA 2ZPKH 3MRDA 3EOTH 3UPAA 1D5IL 2AJZB 3P0GB 2I26N 4ESKA 1XGQB 2PCPA 5F1KC 1A7QH 1CT8B 4DOHB 5E99L 4P9HL 4UAOC 3DVGA 3LQAL 2H3NB 3JSSA 3D3VA 3BX7C 1EXUB 3STZB 1GCFA 4FQHB 1J1PH 1P1ZA 1KEGH 2P5WE 5DI8B 3KXFE 1V05A 4QY8A 2AJ3B 1E4XL 5F7EH 2XWBB 5DK2A 1W0YT 4IIQC 4NYLB 4XCNB 5FA4B 1MAJA 6FABH 4N8VB 1LQSR 1U8IB 1FZMA 4GW5A 4XBEH 5L9DL 4QO1A 5LGHH 5K9QG 3SQBA 1J1PL 3FO1B 1PKOA 4BSJA 5JA8B 3H7BA 4BQ8A 4NQXA 4UB0H 4U33A 3A6OA 4HIIA 3UJJL 4KGJA 4RMRA 2ICES 4M03A 3BGFC 4Z78A 3N0PB 5HYJD 2B1AH 4R7NB 1JI1A 3NCYS 2R4RL 4YWGL 4PJCF 5DO2D 4QTHB 3VH8A 4OD1H 3NN8B 5DT1L 2PW1A 4N0RA 3AREB 4K3EH 1V5JA 1MIEL 1SEBA 3OSKA 1G9MC 3QAZB 3KPRE 1P7KB 4L8DB 3BP4A 4RNRB 3QXAA 4X99B 3S34H 2Y72A 4RAVA 3DMMC 5BXFA 5JOPD 4MD4A 4TSCL 1K9TA 1DR9A 4M1CC 1H8SA 4KK8C 1NGPL 4JREB 5E6IB 5TDPB 2FR4B 4IRSB 1OSPL 1BECA 1MCDA 4KAQH 1NEZA 1W0VA 2LU4A 3LV3B 1N0XH 4U1GC 2WM0A 3RX8A 1HOCB 5K9KB 4JVWA 1YJDL 1S8DA 1Q72H 5LGJA 1M1SA 1XCQB 4OGXL 2E9WA 5FXCH 4Z7UF 1SYVA 5EO0A 3Q3GB 2F54B 2J12B 3B9AA 5DQ9B 2J3SA 2OZ4A 4XCYA 1L6XA 2IANB 5FOBA 1HNGA 4P5KB 2BVQB 5E08L 3MNZA 3SPVB 3T65A 4L8SC 3L3DB 5BV7B 4XP1H 4M6NL 3RWGA 3WS3B 5EIVA 2G2RA 3MV9E 2W9EH 4X6DF 1HHGB 1UM5L 4XCCH 1BJMA 4LCYA 1ZEAL 3HZMB 4PUBH 2MWCA 5MP6L 4HWBL 5HHOE 3W11C 4JM2F 4MAYD 5CEXA 4MNHB 4JFHD 5EO9A 3KDMA 1NBYB 1S5IH 2QLVB 3W0WA 3ZTJH 3MO1B 2FYYB 3RKDD 3P0YL 2N4IA 4DWHA 4H1LB 1J1OL 4F7TB 3L7FA 3VXPA 3FTGA 3ARDD 3MV9B 3QEQD 2EDYA 5D2LF 4XGZA 1TNMA 3QXUA 4P23C 5AZ2L 1B2WL 2HTLC 4L8BB 1T3FB 5HHMD 5JLZA 4PR5A 1IL1B 5DDHA 2OXGA 3A6BL 3R8BB 1HHGA 1VA9A 1CG9B 4WJ5B 4HXBH 1JPFB 1T22B 4ZTOL 3QA3A 1MRFL 5TDNB 3QQ3A 2YBRB 4OFYD 1FC2D 2ZKHH 3TVMA 4L5FL 5EBGA 4AMKH 5DUBA 4R2GC 4OGAD 3QXVA 5D2NB 3JV4A 1G9ML 3ARSA 3SKNA 3IJHA 4UU9B 4Y2DB 5DQ9A 2M1KA 1EAPA 5AAMA 4TVPH 4ONFL 4U05A 2CLVB 1S8DB 1MI5A 2E3VA 5ESVA 3UAJC 2G5RA 4JDZB 5B8CA 3VWJC 3BJLA 1H5BB 5FUOH 3KS0H 2P24B 2LTQB 4I5BB 4WEBL 3DSNA 1RFDH 4KVNH 5L8KB 5DUML 3D0LA 4OCWL 2ESVA 1GPOL 3GSUA 2VR4A 3FOMB 4F9PC 3S35L 2HRLA 2JB6A 1IARB 3VFMA 4LLYB 5D1ZA 3QQNA 3BXNB 4YGVA 3TBYB 5INCA 4YEFA 4NHUA 1KJ2H 4NKDA 1FSKB 4OGYL 3SKOA 5JIKA 4JFEA 3QHFH 4XCFH 1NGZA 1JNLH 4HHAA 3WNPA 5ALBH 5IP4A 4YE4L 3SOBH 3Q6GH 1BQHB 3WEXB 4G8GD 5BRZD 4F7EB 3LQAC 4PS4L 3VH8B 5JNYB 4HD9A 1LEKA 3TT1L 3OHXB 2BVYA 2EDFA 3MLTA 4LLQA 4DFIA 1FVEB 4NO2A 5IR1A 2H6PB 3S4SB 3B9KC 4NKIL 2CIIA 3ME0A 1NC4B 3UO1L 4IM8A 3D2UB 4JPWH 4XZUA 1CGSL 4WU5A 1T3FA 3SCMD 2CUMA 2VLRD 4I18A 2ORBL 4NZJA 1CK0H 4XWGL 1GIGH 2CUIA 4N8VA 2EE2A 2XA8H 1UH2A 1ZANH 3V52H 3VMPA 2PR4H 3NCCB 4GG8B 1FFOB 1KOAA 3H3BC 1I7RA 3KS0J 4PGJA 5HDQL 5CEYA 4FQQA 1VESA 2A9NH 5F3BB 3G6AB 4NZDA 5E8OA 2D9CA 3Q5YA 3S37H 4D8PB 1VGEL 4F33B 4PJAF 2ENYA 1C5CL 1CWVA 5B3NA 4Y5YC 1W2KT 4AIZB 3C5ZB 1U58A 3SE9H 5DYOA 3H3KA 5JOPE 4QRPE 3MUGB 2V17L 3QUXD 4HMCA 2OP4H 4MB5A 3SGDH 3N1GC 2G75B 3WS3A 3NFNB 4PBWD 3ULVC 1A6TA 4ELMA 4QNPF 4KDVA 4ZFOA 1Z9SA 2NXYC 4LSVL 2IH3A 3U7WH 4HWBH 5HVFB 4PP1D 3VD7A 1F8TH 2EKSB 3AB0B 4ZQKA 3WHE1 1CD9B 3ALXA 3KHQA 1VFAB 1DP0A 3QXWA 4QWWC 1NCAL 4IS6A 4HIHA 4YHIA 3RQ3A 3TBWB 2G60H 4WUUA 1PKQB 1SYVB 5BV7C 4OI7A 1WZKA 4ODHH 5GGUA 4NQSB 3RVUD 2HAZA 3ZKXB 4I3SL 4AL8L 4FMKA 1AO7D 3CZJA 3C9NA 3UTSE 2A73A 5IV2A 4DUWA 1KJ2B 5I1IL 4JDTH 1TPXB 1BBJB 3RL1B 2CKBH 4Y16A 2HT4D 2NNAA 2A38A 3RKPA 1JWMA 1ZHBA 4XNMB 4D9QE 2P5WD 3WDIA 4PJEA 1RIVL 4MDJA 1KENH 3ARFA 4C56B 1DBMH 4NZUL 4X6FB 4X4MA 4G6ML 3U36B 3ABZA 2ZG2A 3HMXL 2BCKB 2XA3A 5GS0L 4PJAE 1YC8A 1J0IA 1BAFH 5JORA 1TVHA 2MQ0A 1Q9KA 5A2KH 4S10A 3N85H 5FM8A 4HUKB 3EJZC 1OP5H 1OWWA 1X5IA 2GTWA 5TH2A 4J4PC 3CXHK 2O5YH 2NY5C 5FUCC 4C83A 4P2RA 3QO1B 3QSKB 3T0ED 4Y4FC 3U4AA 4NQXB 1HYSC 4YDIH 5E03A 5IB3A 4FQXA 3WUWA 3WEXA 1YPZF 4LOUD 4Y5XC 4QOKE 3VFOA 5I9QB 1B9ZA 2VDOL 4Y8AA 2FSEB 4Z7VE 4OGAC 5D5ME 4X5XB 4HQQH 1ORQA 4LQFL 2BDNL 2EYSB 5D2LB 1X5AA 1P7HL 3FN9A 4PRPA 1QLFA 1EV2E 3BH8B 4GG6B 4HG4J 2H2PC 3RZWA 4I77L 4JG0H 4YIQB 4PB9H 4DVRL 4LRIC 5BVPL 3N85L 4DTGH 5D7IE 2NY3D 1DE4A 1FAIL 5MHSD 2XG4A 5E94A 3O8XD 3OG4B 2VIRA 4KQ3H 1DUZB 1OPGH 1V3LA 3QQ4A 3UO1H 2AJXH 3RL2B 3BMWA 3O6KL 1HXMB 1TZIA 3MUZ1 2AK4B 4K71C 3BGAA 4KRNA 1INDH 2RFXB 1NDMB 1CD1A 1MREH 2JCCA 5F7EL 1FFNB 1MHEA 5J3HD 3MRLB 4XC1L 2MPAL 5IFHH 2Y07L 1EFXA 1N8ZB 3QG7L 4KQ4L 3WIFB 1JNLL 3FMGL 4X6CF 4JVUA 1J8HA 1TJHH 1MF2L 1YNLL 2X5PA 5D96B 5DA4A 4YBHA 3TT3L 1HSAA 4FQIH 5EZLA 2Q8BH 3BKYL 4JZNB 2XG5A 5FV2A 1TQCB 2E6QA 5J06A 3SCMC 1A6UL 1D6EA 1FYTB 1DN0A 1RFDL 1YZZA 3E6FA 3O9WD 3G5VA 1EEZA 2DLTA 1CICC 3QFJE 4R0LB 5H2BB 1NUFA 3P2TA 5DJYA 4NP4H 3QNXA 1EERB 4KPHH 3B9VA 2DJUA 4LLAA 5LGHL 1RZKL 3K4DA 2JJUA 2ATPA 3M45A 5C6TH 3R8QA 5CEXB 4PJGB 4HKBA 2NY6B 3KJ6H 3U9UA 3QFJB 3MLWL 4XZUB 1FYTE 2KPNA 1FZJB 5J11C 1U95A 1EGJH 3AS3A 5FO9A 1I1AD 1NBVL 5SWQA 5JW4M 2YWYA 3FQUA 3QUXC 5HHNB 4I3SH 4AL8H 1UFUA 1NEZG 2AJYL 2R56L 1JNNL 5SWZA 4L8CA 1RJCA 3A67L 4XB8A 2KZWA 2OP4L 5IVNA 4M62L 3TP4A 2NLJB 3BUYB 4DGVH 1SY6A 3F12B 4AH2B 3VXRA 1FO0B 3OKDB 3L3IA 5FO7A 1K85A 4AEHH 1MCHA 5FM5M 2PO6D 3GJFB 4H8WL 5I2IB 3ULUF 4LSVH 3T8XA 3Q3GA 4F58L 4FXGB 4KI5D 5H94B 2EEBA 4ZO8A 3WL9A 1S3KL 3QISA 3CFEB 3C60D 5ALCL 4XX1E 4OLYL 5GRJL 3U1SH 5I1CL 5KJRH 1P2CA 3BN9D 2VZUA 3C5ZC 4IRJA 4TSAL 2CSPA 1YY8A 3KPQB 3PWJB 4U1NB 4EKXA 1TZHA 3TNMB 3AAZA 3X17A 2HT4C 3RDTA 4BUHA 4NZRH 1QR1B 4J3WA 2EDNA 2HH0H 3C8KB 3MA7A 5B3JF 5JQ6H 3VD3A 3IJHB 4YZFE 1E6JH 1YQVL 3OKNB 4RCAA 4XMKH 3C5SB 3FAWA 4E42A 1RUMH 3UPCA 4ZS7H 3KPTA 3MJ8B 3D9AH 1VPOH 4PRIE 1I9IH 2BY1A 4F2MB 4FFVD 3LQAH 4Z7VB 4OZGA 4LSTH 3QR2A 5J6GB 2OYPA 5L2KB 3WNKA 5C0CA 4G6AD 1RV6X 1JZ5A 2DQDL 2C3WA 1HQRA 3QUZC 1FNGA 1HDMA 3UP1A 1QFWL 3Q5TA 2GTZA 3MYJA 3KHOA 4Y4FD 3BSZH 1Y6NR 2YWZA 4WWID 4ISVB 4NUGL 5CJOL 2C9AA 3WE6B 5JXAL 2FD6L 1FNEA 4O02L 4JO4L 4P2QE 1WIPA 3JXAA 5K59F 1OGAA 2AJ3A 2YA1A 1VADB 5BO1L 1XF5B 1U8KA 1BZ9B 2AV7A 5GGTL 1C16A 1M4KA 1XR9A 3RVWD 4Y5YA 4G6JH 3RTQB 5C0AD 2F53E 1RY7B 1PX4A 1YEJL 5IT2H 5ISZE 1U42A 5FKAB 2X09A 4CBPA 2P5ED 1XR9B 4JGUA 4JY6A 2VXTL 1A9EB 1K8IA 5ACZB 1AKJD 1V7NH 4NRXA 1EVUA 5L2KD 4MJ5B 2OJZL 3O2DA 5ESAB 4GUPA 1PKQE 3WXWL 3BKCH 2UUDH 3KYKH 3RVVD 1JGVH 3HNVH 3LH2L 2GJ6D 4KJWD 5IW6A 2GTZB 3MYJB 4W70A 4RWHA 1DZBA 1LO3L 2EH7H 2R0ZH 1CXIA 2X4PA 3CDGB 5CP3A 1MJ8H 1LP9E 4HZAA 5D7LE 4J1UB 5MEQA 3WLWC 3OKEB 5C6TL 4DK6A 3FO9B 3VRJB 1HEZB 5EUOA 7CGTA 3IYLW 1YEFH 1I7UB 4K23H 1HYRC 3INUH 1FLTX 2FHFA 4LHUA 3MLZH 4MD5A 1LDPL 1BQHG 2J7LA 1X4ZA 5ITBL 5EZIL 4F57H 3ARGA 3QWOA 5EC2A 2XNAA 3JTSB 1MWAL 3IJYA 4PGZA 4XNQB 3I6GA 3TNMA 2P49B 1JWUB 1I1YB 2D0GA 3U46A 2AV1A 1K5NB 1PG7X 1U8MB 3FT4A 1K4CA 4NP4L 3L7EB 1UWGH 4R97C 1IKNC 5K9QI 2XTJB 3AB0C 4Z78B 1BIHA 1IZKA 5IQ7H 2VXQH 4S1RH 3TZVD 2BNRE 4WIQA 4Z8FL 5FF6B 4Z7UA 1SJEA 4P5MB 5LGKA 4NN6C 2VDLH 4HFWB 5GHWH 1FFQA 3WN5A 2Q86A 5E2VL 5EOTB 2ADJB 3SGJA 4XBPA 1QFUL 5GRZA 1JTPA 2D7OA 1EPFA 4PJ7A 2FZ3A 3QEGH 2NQCA 2UZYB 5EZOL 3RY5A 5J6HB 1JYVA 3GFUA 4HBCL 4U1SB 1CTNA 4GKNB 4Z7WB 4Y19A 2ID5A 1KJMA 4ZXBD 4P5TA 3T4AA 4V1DE 4I77H 4Z7QF 1GC1L 3CX5J 4N1CA 4Y5VB 4ZPTA 4YC2B 4LPCA 3S97C 3VXQA 2EO9A 1OB1A 3ZTJG 3QULA 2Q3AA 1F4XL 1IC5L 3C5ZD 2B20A 5IBTH 1Y18B 5D1ZD 1WZMA 5TJWK 1A14L 3VE0B 4RGMC 3NA9L 3QDMA 3RZCC 1NFDF 4HKXA 2UY7A 3VXOA 2AP2A 3WNLA 5A2JH 3OKKA 3OAYH 2ZOLB 3MTRA 2AABL 4I9WE 4F58H 2F58L 1W72H 2N7BA 1T21B 3MCLL 4G9DB 3I50L 3QI9A 1Z2KA 1AXSA 4EDWL 1I8KA 1NC2A 5DJ0B 3MNVB 4AT6A 5I1JH 2E9IA 3EAKA 1FFPA 3HS0B 1Z9OA 5T1DH 1EGJA 2X70A 3ZE0F 2H1PH 4PLJC 5DJ6B 3MRLA 4PLOB 4OD3L 5F7MC 4HT1H 4MNQD 3TBVA 3BWAB 4MLIA 1JGEB 3TO2B 2RGSA 2YPLD 4LF3B 4M93B 5I1GL 4R90L 1BBDL 3RTQD 5ISZD 3FFCE 4UMGA 3UJJH 4IDLA 1T1ZB 1BMGA 4MCZA 4MA8H 3RA7L 2P48B 2FIRT 2Y36L 3RVTC 4QEGA 3OZ9L 1P5VA 4MJ2A 4GRLD 3F7PC 3O9WB 1TJGL 3RVWC 3FO0H 4I0PC 2I07A 3B6SA 1S7VB 2A1WL 3K4ZA 2IALB 1NMBL 1UH4A 4P2QD 5INDA 2H9GA 4Z7OE 4I8DA 1QFWI 2KQNA 5D7LB 5C0EA 1J5OL 4PJDA 4OZFB 3W9EB 2BJMH 2JCCF 2XY2A 5DHVA 1AC0A 1AGFB 1VGKA 2XZAH 5EOCH 3MXVH 1C5CH 4MXVE 2NLJA 2NXYB 1ES0B 3BUYA 3UYRL 4JZOB 4PP2A 3TBTA 3W39A 4WTWA 1EJ6A 3HAEH 2OL3L 4FQXB 1EUTA 4JFZL 1A1NA 2C3HA 2V17H 3K7UA 3NPZB 4CU8A 4KRPD 1QPPA 4ZO6A 3WJLC 4PG9B 2IFFH 4DKDC 1UWXK 3D39B 1BD2D 4L4VA 4MJIB 5DD5H 1KXVC 3FQWB 4JRWA 5JW4N 1S7UB 2BVPB 1G7HA 3AY4C 5AYUH 5ID0A 1DLHA 2VDPH 1RJZA 3HG1A 3ARFD 4YXHL 3LKPB 3MODH 1K4DA 2VRAA 5IM7A 4JANB 2GFBB 5DQJB 4JQXA 1LNUB 3D48R 1UQSA 3O11B 4P23D 4QT5A 4F15C 5CINL 2YD6A 1FYTA 2A0LD 5E8DL 5IB1B 3HNVL 4LLUA 4OLVH 4JKPH 4QHLA 3QZWA 1V3KA 2AK4D 1BWWA 2FWOB 3ARXA 2J6EH 3MRGB 3CSPA 5C0ND 5IHBA 2D7TH 1OQXA 2UYLB 3P9WB 5HYFA 5I1LA 3IT8D 3F7YB 1LVEA 5CMAA 1NAMA 2BOBA 1MFCL 2DICA 3C6LC 3TEUA 4S2SA 1CS6A 4OT1H 3AXLB 2A74A 2WQ8A 3IGAA 4XP5H 5CKGA 3QHFL 3QIWC 1G9EA 5CHNA 1AE6L 4HUUA 1CD1B 4AEFA 4WHDA 5MP6H 1KN4L 1D3CA 3QH3B 3VJ6A 5CIPA 4PRPD 4ZUUB 4OCWH 2OI9C 1S5IL 3NCJH 5GJSL 5L8LB 1YNTB 3OB0H 1NSNL 2DM2A 1DL7L 5KAQF 1EO8H 3KPSA 4YUEL 3T3ME 2CDEB 5BMFH 1M71B 4HWZA 3F7VA 1IAII 1XGYH 1WWBX 4WO4C 4OGYH 1TJHL 1QSEE 3GKZA 1T5XA 1L7IL 4GMSH 1NGYA 1R3KA 1VKXB 5IESL 3MV8E 4HXBL 3D85A 5D1ZC 5J6HA 1GH7A 3NH7L 5EWIH 2FLBT 2Q76B 1JPGB 4NZRL 5DFVD 3UX9B 4L5FH 4PJEF 1Z3GL 4R2GB 4QGYA 4WGWB 3T0DA 4BFBD 1XIWA 1WCQA 1ZA6B 2EH8H 1E4JA 4KVNL 5CP7A 3QUML 4XTRD 4UQ2B 4YGAB 3JV6A 4R90H 1ERNA 5BZWA 1VFBB 3UJTL 4AENA 2CQVA 2X4TA 4MAYC 3H6JA 2XZZA 1W72L 3VGFA 3MLRL 1O7VA 1A6PA 2D03L 2IFGA 4Z7VA 1GC1C 4N0FB 3DO7A 3BQUC 3BGMB 4HHAB 1HHKA 4PRNB 3HR5A 1WITA 5DRWA 5FO8A 2Y7QA 4GKOA 2GT9B 3KVQA 3ET9F 2MFNA 5D7IB 2CLZB 2EYRA 4OZHF 1NCNA 2A77H 1A6WL 3B2UD 4MD5B 3FMGH 3OJMB 2NY2D 2BJML 1MCNA 3AAZB 1HEZA 3REVA 5JIIA 2QSVA 5DSCA 1G7MA 4M7LL 1IGYA 3OX8A 3FB7A 4KJPD 1HSBB 1NFDA 3S88H 1QR4A 4I0PD 1JNNH 4JQXC 4RAUB 4EDWH 5I1JL 1QBML 4H88L 5GGUB 2OI9B 4JLRB 1S9WB 2NW2B 4MJIE 4UT6H 1JGLL 2NXYD 1IC5H 4JFDB 1QSFD 1IAIM 3EYUL 3OKDA 1FO0A 5FO7B 3JTTB 2XTJD 4NBYB 1B4RA 4W81A 1JL8A 3HPLA 3WHXB 2HLFC 2A83A 3NFPB 1RD6A 4MJ5A 2OJEA 3JWOH 1QUNA 3PV6B 5DGRA 2VC2L 3RHWF 2R9HD 3EOTL 5I1GH 3H42L 4NFCA 1ZHLA 1A6ZA 1FHGA 1KBGH 1A6WH 5FO9B 3RWJB 1U9KA 2WLZA 1NGQH 4M5YH 1MIML 3BD4A 3MXWL 1NGXB 3D5OF 1KB5A 1ZLSL 3R06A 4EBQH 5JHDA 3P11H 2JJTC 2K9UA 1DQQA 1YMMB 5TE7H 2YKLL 1YMMD 3B83A 1JRHI 1BZ9A 2AV7B 3REWB 5ICZA 4BKLA 2XZAL 5EOCL 1HHIA 4I4WA 3CLFL 4K3GA 2PN5A 3M1BA 4PJ9D 1JGLH 4PJDF 1AQDA 3C09C 1IGML 3QCUH 1TCRA 2DQHL 3QT2A 5CBAB 3DUSB 1N2RB 1YPZB 5FHAH 5J12C 2EXWD 1FLRL 4V1DA 2VLLA 4TSCH 4O4YH 1A47A 1FH5H 3T0EC 4UOJA 1MEXH 4RRPG 4YO0A 3UZVB 4HLZG 4CL7A 3CD4A 3PHSA 3KYMA 4CADB 3EZ8A 3FB5A 1CGTA 4PV8A 3K4AA 1TIUA 1QFHA 2OMNA 2J6EA 1RUML 2NY7L 2PNDA 4GRWF 3MRRA 1RK1A 1RZIB 3BIKB 1OGAD 2Z92B 1IC7L 4WFEE 3SKOB 2BNRA 3RL2A 2XT1B 4LSPL 3MR9A 5IOPA 4YGVB 4MAYA 3E1F1 4HKZB 1NL0L 3CH1A 4JFDA 4PRDA 2M2DA 3DIFB 1QRNE 5EZJA 1A3QA 2VO5A 1Q8MA 4Z7WF 1INQA 2G5BB 5AWNL 3TA3A 1UXSA 3HE7B 2P5EA 4E41A 1IGYB 1L7TH 1ZS8A 3PL6C 3UMTA 3UBXG 5LXGL 2VZVA 3FFCB 4ZUSB 4ZYKA 1RZ7L 4MVBD 1BLNA 4HFUL 5DHYA 4ZNCD 2ITCA 5I17A 2FBJL 1MI5E 3RX5A 3WS6C 4U2YA 4Z5RA 3MRHA 4MA7L 4LU5L 5D1QB 5IBUB 3F12A 1A6AB 5FO8B 4WHTB 4F7MA 3TVMD 4NPYA 4B41A 3D3VE 3BGMA 5A40E 3RGVA 1U0QA 3T3MF 1GIGL 3WFHB 2ZPKL 4QTHA 3ULVH 4PJ9B 5ITFB 1UJ3B 3F7VB 3PGFH 3TC9A 3I02B 4YHYB 2VUOA 4L4TA 3EYFB 5GSRB 4PJXA 4EIZC 5T3ZL 3X3GL 2AXFA 1DTUA 4WHYH 3W5NA 5FYLL 1Q0XL 1OP9A 2DD8L 4N8VG 3V7AE 4KZEL 4LKCA 4UDUB 4F9LC 3FTGB 4E41E 4TPRH 3RZCB 1AE6H 4H1LA 2A74B 1QHOA 1N59B 4BKLB 1F02I 4KMTL 5JPMA 4GRWE 4NN5B 3DMMA 4FG6C 4PJEB 4PY7A 1QLEL 4NGHL 3UTTA 3T0VA 5F6HI 3LQMA 2YK1L 4PJHB 1XGTB 1OOAA 1HYSD 4LARL 4JFED 1AQKL 3GMQA 1KJ2A 1U92B 3G9AB 2BHYA 2AJZA 5J89A 1L4IA 4JGMA 1QSEB 1E6OL 4NO3A 5ILTL 4KROB 1OL0A 4X8JA 1LP9B 4NRYB 5GPRA 4P3DB 4PRHA 4X9FA 4PLKD 4YZFF 1VEOA 4G9FE 1PLGL 1RZKC 1KIQA 4XMKL 3IS0X 1K4DB 5DJAA 4QRRD 3U9PL 1GXEA 5EU6B 4RFOH 3MRPB 8FABA 1U3HC 2PO6C 4LIQL 2VLRA 1QACA 3RRQA 1CK0L 2NZIA 5B38G 5T1KB 1MCJA 3EFFA 4ZTPH 1ITCA 3KGRA 5E5RB 4MX7A 4EDXA 1JFQL 2R9HC 5F9OL 3IF1A 1QFWH 2BHUA 4XPAH 3VXMA 3ZYOA 4NUGH 3C5ZA 5T3ZE 2GCYB 1BFOA 5I30L 3BRGC 5ECJE 3HC0A 3ISWA 3VXNB 5JR1L 2GQHA 4RQQB 2CK2A 5KVMC 1KNOA 4H8WH 4JZJB 1JPTH 5I1DA 5EZOH 2L7UA 1D6VH 4LCWD 2DLEA 3RBSA 3Q2CA 1HIMH 1A7QL 4ZO9A 4KDWA 5HHVH 3TNNA 5KSBF 2GK0A 4ALAH 5EORH 3TESA 2L7JA 4MMZC 3ARDC 3HC3H 1R3LA 4DW2H 1NC2D 4XP6L 1F2XK 5DA0B 3HZVB 1F4XH 2J8UF 4KK5C 4ELKB 3D0VA 4QRRB 4YEEA 1DEEA 2LAAA 2YUXA 1KN2L 2X4TB 1XF4B 5C0IA 3GMOB 4C83B 2ITDB 1AGDB 2CGRL 1JCKA 3HI5H 4WUUD 4WTXA 4MYWB 4YHOL 3WSQL 1KSRA 3AS1A 4LGSB 4C59B 3SDXE 1H15B 1YN6A 4BQ9A 1WTGT 3TO2A 3P11L 5L6YH 4WI3A 4GFTB 4X98B 3S34L 5C0AB 3ZYZA 2IPKA 4NWUH 4ZO7A 5B21A 4OM0H 1X7QA 5CGYC 1KACB 5F9JA 3MJ9L 3OWEA 2EC9T 4P9MH 4BJLA 4PBVC 1A3RH 1H3TA 3QIUB 2IALA 5TGBA 4O2CB 2Z4QB 1WK0A 3NABH 4JJ5A 4PJBF 2FX9H 2B0SL 1OLLA 5CSGA 3UDWC 4DGYH 5B8CB 3QI9B 3UAJD 1KBGL 2BSRB 4OTXH 4XNZB 1DBBH 4JRXD 3DETD 2VDQH 3OXRB 4JREC 4XC1H 2GK2A 4QHKJ 1GJIA 3GIZL 3MRDB 1WBXA 4XPHH 5D70H 5J13C 3EKCA 2R2CA 1G9NC 1EAPB 1S7WA 3GI8L 4IS6B 1U3JA 3T0EA 4QYOA 4K8RC 4Y2DA 3T3PE 5D8JL 3ULUE 2NXZC 3FB8A 4RIRA 3BO8A 1WAAF 4HBQA 4GXVL 3QPXL 4X7DC 3RGVC 1IM3B 4K7FA 4EOWL 4PD4K 4UOW1 4HLJA 4HK0A 4RMTA 3HPJB 4KK9C 5HJ3A 4WJ5A 3L5WA 4MXQC 2ICWA 2QJDA 4Z7WA 5EBMA 4PR5B 5EU4A 2HWZL 1I9EA 1NBQA 3R4DA 3EZJB 2DTMH 2NY0C 4PJCA 2VZTA 5CZVL 2WMPA 3SHSA 5CBEB 1DQTA 3DV4B 3DX8A 4N9GB 1ONQA 4JN2A 5IF0A 3OAYK 1VFOA 1PSKL 2B1HL 3FZUC 3L3JB 3TH3T 1G6RA 1TQBC 5AAWA 2IBGA 4FQQB 4LAQL 5IM7B 5HGHA 4OZHB 2LE9A 1ZANL 2Z8RA 3KDMB 4G80B 1IJ9A 1TENA 4TRPH 4JFFB 3GMOA 4KUZL 2YN3A 4PY8J 4L3EE 2GSIA 4L9DA 2ADIB 2JTDA 1QOKA 4R4NC 4WWKB 3ULSB 3QUZD 1HXYB 3FQWA 1ORSA 1NC4A 4XVTH 4D0CA 2HT2C 4P0DA 3D39A 3MV9D 1KC5H 1LO2L 1ZLWK 2BZDA 2X42A 1UJ3C 2MQCA 2UZIL 5IHZA 3T4AB 3PP4H 3NAAH 4CJ0A 3QWOB 5I71B 1KFAL 5H37G 3TIDB 1T66D 4M1DL 35C8L 2IPTH 4H5SB 1ES0A 4LNVA 2DYPD 3T0AA 4CW1A 3O45B 1RUKL 2X1WL 3HPLB 3CUPA 1T4KB 5INCB 5LQBH 1TTUA 3GMLB 3HCVB 3FQTA 2E8ZA 2BFVL 3KPSD 1QA9B 1QLEH 4NGHH 3BVNB 4QWWD 1F3RB 3BMVA 4TNWF 1H3WM 3TA3C 2Q87A 5HXMA 5ITBH 1MUJB 4IMKC 3RPKA 25C8H 4K7PY 4PJ8A 5DR5H 5I18L 4PJFB 4RMSA 3UJTH 3QG7H 2HJKA 5DWUL 4JHWL 5C08A 2B4CC 2X4OA 3NFSH 4ETYA 5T1KA 4YK4C 1SVZA 1MI5B 3MMEB 2FB4H 2AJUH 3GNML 2YS4A 2OTWB 1FZKB 5DJ2A 3NCMA 3PABA 4KTEH 3GRWH 2Z93B 5SX5K 3ARGB 5SX5H 2VMFA 4FQJH 2YSSB 5LCVH 3ARZA 4MCYB 4AQ1B 1OAXH 3GBNH 4NNPH 5GGQL 3B4NA 3N9GL 1OAQL 2SEBB 3OQ3B 4X9HA 4HULB 1I8MB 3EYQC 5DJ6A 5E5MB 2F74B 3T77B 1JVKA 1JYNA 4X5LA 4OZ4B 3DOSA 4KV5E 4GMSL 4V2BA 4NUJA 3HB3C 3VFUA 5C7XH 1JPFA 1YYMH 2X4PB 4JFFA 3HMXA 3CDYA 1KEGL 4P9ML 5F9OH 2W60A 2XKSA 5IBUG 2Z35B 1NFIA 3L3KB 2XQBH 3HRZB 3G5ZB 1KV3A 1CZ8L 3GK8H 3WJJC 4LOUC 1Y0LA 2MCG1 1W8NA 4UIMB 5DMKB 3JWDH 2E7MA 3WE6A 4K7PH 1K6QH 3D85B 5DGQA 5FM5O 1V7MH 3SKJL 5AZEH 1V7NL 5ENWB 2Z31A 3RI5F 3GMNA 4ZUTB 4OZFH 5MEND 3GK8L 3BDBA 4I0PA 2W92A 1NLDH 4HUNB 5E5MA 4Y5VA 3T77A 2QTEA 4HWZB 4R4FH 4Q2ZB 2O5ZH 1CFTA 4HC1H 1C16B 4RIRB 1QSFA 5A1AA 3DETC 4PV9B 1OW0A 3F6IA 4I0CC 3S37L 1N4XL 1A5FL 1IAIH 1R3JA 3C8DA 4RFEB 3DUUB 1V3MA 1JPTL 4WI5A 4MNQE 3G04A 2E7BA 3AUVA 3PWJA 4HFWA 4FQXC 1P4BH 1UC6A 2HJKB 2RCSH 3BT2L 3P4MA 4LPVA 2R1XB 4FZ8H 2ZSWA 3QIWA 3TN0C 4M8QA 4YXHH 1IKFH 3BKMH 3U1SL 1MQKL 1WCBB 5JHDD 3GMMA 2HLAB 4GRMB 4H26B 5HYQA 2QKIB 2Q6WB 3Q1SH 2L4OA 4MXQD 3OZ9H 4HXAL 1BQLH 1XCTB 1QBAA 4LLUB 3V5HB 3K74B 1M7DA 3V4PH 4MA7H 2IMNA 3UDWA 4PRIB 2FECI 2DDQH 3P0VL 4OBSA 1GGBL 1CFVH 1CFQA 2AXGB 4LRIA 4XWOD 5F3HB 4NQVB 1AKJA 1ZLVH 5C09E 2R0WH 4FP8L 4MHHI 5KOVC 2YPKB 1FNHA 1YJDC 1PG7L 1X5KA 3HNSL 3DUSA 3W9DA 1NUNB 2HT2D 1MCOH 4KI1A 1LO5B 4N8CH 3VFSB 3QWRD 3S7GA 4JM2A 3FQTB 1QQDB 1EEZB 4R0LA 4TUJB 3PQYD 4QHNA 3U0TB 1ZAGA 3KYNB 1ZEAH 4YNYA 3V9FA 2DOCA 1IQDB 2ZNWA 3GI8H 4PTUB 3RJDA 5HDLA 3LB6C 3RVTD 1T6WA 2NY6C 5BCAA 5A16B 2X7LA 1PYWA 1IGJA 5JDSB 2IAND 4YH6A 4ZODA 3WMSA 3BN3B 4WO4D 3O2WH 3PGFL 3IDXL 4WO4B 5FCUL 1HKFA 2F5AL 5I15L 4RGMB 4MX7B 3C60C 3HE7C 1MY5A 2QSQA 3HUJA 5I1AA 3Q5OA 3IFNL 4JFYB 3MCLH 1KG0B 1RURH 4WUKL 2VQ1B 3STLB 1I1FA 3O6KH 2FHBA 1YJDH 2V5MA 5E00A 4APQB 5EU7E 3U82B 4LF3A 3OKYA 3L3JA 3PHOB 5DZOA 1JHKH 2V9QA 5IMMA 4HPOL 5D7KD 2ADGA 5E2WL 4JQIL 1F4AA 1QLRA 5BVPH 1MQ8A 5C6PB 3BIBX 5LQBL 2VLJA 4TULL 5BZDB 4QRQB 4JY5H 3RHWK 4P9HC 1KPVA 3S36H 3WUWG 1LK3L 5DJ0A 4ZD3L 4Y19D 5GZOD 5JR1H 3BZDA 3U2SB 3NIGE 3MGAA 1U93B 3HE6A 4UILL 2RFXA 2BNQE 5FFLA 2EYTB 3V6FA 5L2JB 1H3PL 4U3HA 2D0FA 2YXMA 2WIIA 3DMMD 2WUBL 3O3DA 1Z5LA 1T20A 1G7LB 2D7QA 3HAEB 4EUPA 3THMH 2R2HA 4KK6C 3ULUD 1AGDA 1Y18A 3C2AH 1E4WH 3GSVB 5C07A 4BFEA 3QDMD 5GS1B 3KWWB 5FYJD 2J8HA 2BVUA 3IDUA 3JV6B 3I02A 4DGIH 4UILH 5KS9A 3GMRB 1GYAA 3C6LD 4J6RL 4G8IA 5IB4B 1QVOA 1T6VN 2F58H 3WSQH 2IG2L 3ULUH 3MV7B 1A1OB 3RJQB 3MOAH 5HHOB 3B5HA 2VERN 4GKNA 5JHLH 4X6FA 1D5MA 5FYKD 2OZ4L 3TNNB 1JN6A 1QFPA 5TE4L 1UACL 1JN6B 5C3LD 3NPSB 2ITCB 3TV3L 1UM5H 1E4XH 1FV1B 1VKXA 2FEEI 4M7LH 3PGCA 1DUYA 5HHPA 5IFAH 4OD2B 4UUJA 2DM4A 1GAFL 1MIEH 5K33A 2BC4B 1S9XB 5ID1B 3MRKB 5GGTA 1KPRA 4R0LC 2W65A 4AEIL 3TN0D 2CK0H 4YHKH 4PBXA 2Q8AH 5FYKU 4HGKC 4O9HH 5DF0A 2HJLB 2NY1C 2HA1A 5D1XA 4OFKA 4Y4KD 4HKBB 2W91A 3BHBB 1TQBB 3MRPA 3GJEA 3Q1SL 4O5LH 4AYFA 4M6OH 1SM3H 3QDAA 3U36A 5DJAB 4O4YL 5JPNA 1HCFX 2WBKA 4Q9QL 4ELMB 4P3DA 3U2SA 5K59E 3NFNA 5I1DB 1JGVL 1CE1L 2PYEA 2EXWC 1I7ZA 4X5WB 2IBZX 3FT2B 1U92A 2HYMA 5EUKA 4NO5A 2A2QT 4OAWA 5BS0B 3S96A 5J57B 4NO5B 1UM4H 5EU5A 1QLRB 2Z8SA 5C2BH 2IPUK 4FXKA 5E8OB 3P4LA 4YHLL 5FA3B 1T7VA 4YFLF 1PG7H 3MCG1 3UTSD 4HIHB 4S1SH 4HIEB 2F5AH 4U6HA 5BJTA 1XGYL 2W0FB 2EKJA 3MRCB 2NY2C 1ZT4B 3U6RA 3VCLB 1A7RH 1HN1A 2QHLA 1DUZA 4TTDC 4GBXC 5B3JE 4JKKA 1S7UA 2Z31C 1I7TA 1CF8L 2Y36H 3BKCL 3QYCA 2P8MB 4K9EC 4OUUA 2XOTA 2ICEA 2W59A 3X3GH 1KLUA 4YFLI 4ZXBC 2XXMB 5GZND 1IAMA 1U2HA 3VWJA 2P5WB 1FYTD 1QO3A 5ITFA 3U30C 1UM6L 3H8NA 1BQHA 3RGVB 1Y6KR 1I8LA 1YYLH 3EO1A 5CD3B 3AM8C 1ND0A 2GAZA 1IQDA 5ADPL 4KDTC 1NL0H 3OAZH 3H9SB 4UI2A 3WXVL 3U0TA 3RIAK 3TBYA 2XWJA 5CWSA 1T04B 3RZCA 1N5AB 2BXZA 1DQJA 5FGCB 1TLKA 1FN4B 3HZYB 2GJZA 4UT7H 5DK0A 3BFOA 4G3YL 3GHBL 4P3CL 2XN9B 3PGDA 1GGBH 4WU7A 1I1AB 2P24A 1X44A 1ZS8B 5FUCE 2ENSA 1S7VA 4E41B 2IQAA 1WWAX 3Q6FA 4J8RA 3SGJC 1FNGB 4UINH 4HFUH 3H3PH 4EQ2A 3O4OB 3MV01 5GJSH 3VA2C 5BS0D 1TETL 4NQVA 2R2HB 4X4ZA 2ARJA 3QUYC 4DK3A 3CCHB 1CDGA 2X4QA 4PB0L 4KVCH 3MRMA 2BY3A 5L88H 2EDBA 3HE6C 2BNRB 4EUPG 4WHTA 3DXAA 3IDGA 1N7ML 4F7MB 3BD5A 1I9JL 2Y7QB 4JFEB 3DXAB 4TVPD 4Y1AA 4XHJC 1ZLUH 5J11B 1XCTA 3QDJB 1AFVH 3TM6A 5DUBB 2DM7A 3BDXA 1CGUA 4CN4A 5KSVA 3WBDA 3L5IA 4GKZB 3PDDA 3G6JF 4PGEA 5T3ZH 3UTZB 1H3PH 1JWMB 3O4OC 3WS6A 4BQ6A 3ULUC 4M3KB 2FX7L 1BP3B 4J8RB 1FE8L 2XFXB 4M7LT 5FOJA 2VAAB 15C8L 1G9NH 1JP5A 3GMPB 5I9QC 5ESVB 1LK3H 3B3IB 3P40A 4XGZB 3X14B 1OAUH 5I8KH 1DQJB 1ZSDB 2VABA 3RWCB 4R4FL 4PJCE 3MRQA 1IEBB 4Z18A 4MB4A 1C5DB 2D3VA 2UWEE 5T5NG 4RDQF 3L3IB 2D4DA 4AH2A 5D2NA 3MRRB 1A7PL 1MFEH 1V7ML 1WAAE 4RBPK 3THML 4PJXE 1JMZA 3T4YB 5MHSE 4WHCA 3EHBC 1A1MB 3GJFK 2D7PA 3ARVA 1A6VL 4FFZH 1M71A 2G75A 1CCZA 4LAJH 4LSUH 1I3GL 2ERJC 4HH9A 4Z0XA 2QSCH 4JM4H 5E99H 5A3IC 3MUGA 5C08D 5C2UB 3D3VD 3UC0H 4PJGE 1KYOJ 2W9LA 4XPBL 1MVUB 4WW2B 3L3DA 1HK6A 5FCSH 2DTSA 3SPVA 4HMEA 4UV7L 3BW9A 2HFEB 1LE9B 2D03H 1N5YH 4XBPB 2PYEE 3VGDA 1H8OA 2V7NA 2YPLB 3W2DH 2FJHA 3IGAB 6FABL 2IBZY 1YMHA 1SBBA 3QCTL 1I7RB 3CLEL 3FFDA 4L1DA 4GG8A 2NW2A 1C1EL 3RWDB 3QEQE 2KBGA 4W4OC 5IFJB 4D9QD 2A0LC 4NUJB 5EU5B 1CDCA 4NHCL 4GG6F 4XVSH 1K4CB 5KSAD 2F74A 2PO6A 3NA9H 1JBJA 3BEVA 4HAGA 1A9BA 4RRPA 4LLQB 1ITBB 3ORJA 3X3FH 4K2UL 1P4IH 4RAVB 1NFDE 4HH8A 1T0NA 3SJVE 4J3TA 3WFDL 1A3LH 3ARPA 4P49A 1P7KA 3NCBB 5IK3A 5DHVH 5D93C 3MRJB 2GT9A 1A5FH 1IAIL 4FG6D 3STBA 1G0DA 1ZHKB 2JE8A 2X4QB 1N3NB 4XB7A 4Z77A 2VXUL 2I25N 2MQ3A 3RDTD 2DWDA 4TTDD 1F4YL 1IGIH 3DSFL 2Q6WA 3LN5B 4Z7NE 3O6FC 4W68A 3J7HA 2DQTL 1EX0A 2Y06H 1UJTA 4I5BA 4MJID 4KQ3L 4X6CA 1A1NB 5ICYA 4ACPA 1CQKA 3KLHC 5CZKA 3KLAA 4GJTB 4YDVB 3X11B 5C0RL 4XBGB 4PD4J 1I8LC 5IEKA 4A6YL 5F6IB 5DK0B 1ED3B 5I76A 3D6GA 3OKLA 5E8NB 3T1FA 4L8DA 2EYRB 4FFWC 3V6ZB 4R3SA 5EOQL 3UROR 4PJ5D 4Y4FA 1F00I 2DMCA 2XRAH 4WI7A 3WXVH 5DQDH 1EO7A 2JJWA 3O41B 1EJOH 3NOIA 1WISA 1EEYA 1P7QB 2NMSA 2WANA 2VDML 3MQIA 2YBRA 4KK9D 2B1AL 4FP8H 4PG2C 3LEVH 3SDAC 1U8KB 1IAOB 5EBLA 3QQ9D 2X1PA 2RIKA 5KAQG 2VLJE 5AYUL 3WKML 1YYLL 4NC2B 3W0WD 4BZ1L 2YOCA 5I73C 3VD5A 5I66B 2B0SH 4Y2OA 1IQWL 5KS9F 4MZ2A 5KSBE 3CPLA 3VXME 4NWTL 2Q76A 5EA0L 5KANG 4U1KB 4ISVA 4J3OC 1LO3H 1QSVA 4Y4KB 2ICWB 3U0PB 3LN4B 1U3HB 5L2KA 3L3OB 5GGVL 5JA9A 1WT5C 5L0QC 3KXFB 5ADOH 1T1WB 2X40A 5KG9A 2VSDA 1TETH 2MCPL 3BZFA 3DI2B 4FQ2L 3C5SA 4E42B 4LEOB 1LMKA 4HKXB 3PHOA 4TVPE 15C8H 1M7IB 2M26A 5L8JB 3CX2A 3BPLB 4GS7B 4OCYL 1S7WB 2Z93A 1CBVL 4ZFFB 4PTTB 4U4BA 1FZKA 4NQEB 1OGAE 3E3QE 4OFDA 2YD2A 2V9RA 1TZHB 1A02N 2HLFD 2NY4C 2IANA 4FTVB 1MI5D 2BRRH 4JPVL 2F54A 5IHUL 1DBAH 3PF2A 5GGRA 4YHML 4LLDB 3RNKA 5F7YC 3ARGD 4OSUL 4NBZB 1VHPA 2OK0L 1C08A 5DURD 1KJMB 2FNBA 1P7QD 2XN9E 4PGDB 1JPSH 5JDSA 2BC4A 3V5KA 1DFBH 2V7HB 3MLVH 2XI9A 2JJTA 1BFSA 4D8PA 4X6DB 3BKYH 3O45A 2APTA 3EDJA 43CAA 3UPRB 4UNUA 4XVUD 5F7LB 1U8NB 1H15A 3VW3L 4HMDA 4JM2B 5J3HC 4PRBB 1DQDL 4BUGA 4P3CH 1LO5A 3ZDXF 3MACH 4BH7B 4GAYB 5ERWA 3TYGH 1B6UA 2QADD 1QRND 9CGTA 4HIXL 1RHHA 4X4YB 2VLJD 4QHMA 4YX2H 1JGDA 1OTUC 2PW1B 1I1RA 4QRRA 1T2XA 1OP5K 3HZVA 4QGTA 5T3XH 4XX1G 5HD8C 4KKCD 4ODXA 2ZJSH 4MWFA 4XAWL 1A14H 3WFEH 3GIVA 3IJYB 3DV6B 1AKJB 3PDOB 4DZ8A 4WI6A 4CU6A 4LFHG 6CGTA 3G5XA 5F7DB 2Q7YB 3O2DH 4FXLA 3KYOA 3EYSL 4PP2B 5DR5L 5I18H 1ZVSA 4TSBH 5KJRL 1DANU 1KNOB 2ADFL 4N9GA 4M4PA 4X6DA 2HRPH 4IRSD 3BXNA 4RWYL 3BQUB 4LCIH 1U8PB 4P57A 3P4NB 5C07D 3TPUB 1A7OH 1A7RL 5HSFA 4C55A 2EIDA 1PG7W 4JFHE 2F53B 1WIOA 4WTZA 4HJ0D 4M8QB 4MDIA 3DURA 5CGMA 2WQRA 3TIEB 2OBGA 3P4MB 4MS8C 2DQIH 1J86A 2Q8AL 4F3FB 5EBWA 4OF6A 2YA0A 8FABB 2FIKB 1FBIL 4POZC 3FN0L 1KCSH 4GMTH 2XPGA 1MCQA 3OB8A 1IGCH 1FIGH 5DS8A 3DNKA 3MRBB 2FJGA 1IGTA 4JFOA 5I1HH 2FRGP 2APWA 1I8IA 3BZFB 4GQPH 5DUMH 4K9EH 3PXJA 1QSFE 3TVMC 1OB1B 1YEGH 4LP4A 5T1LB 4ZPTB 5TDNA 4LSDA 3MXWH 3RTQA 4HWBA 3K2UH 1LDPH 4D3CL 3L5XL 3ZDZF 3BYYA 3SDXA 1T7YA 1GHFL 4UBDD 4Y4KA 1IL1A 4NC1E 4GW1B 2DL9A 3TPUA 1A3RL 1AXSB 1N59A 1WEJH 4YPJA 1OF2A 3GSWA 4X5XA 4HGWB 3X3FL 5D7JC 3SY0A 4G7VH 1BM3L 4LVEA 4IOIB 4PJIB 3QUMB 4PYGA 1ZOXA 2PYFA 3VXOB 2EO1A 4QHNB 4MJ6A 5GRVK 1CICB 3KYAA 5AEAA 4I9WD 5IW3A 1E27B 1RUAL 3R1GH 1FRGH 3FONB 5F7DA 3DX7A 1YEHL 4WFFE 3I6KB 5I6XC 3EYFA 4MWFB 1YNKH 3H0TA 2C7UA 2DI9A 4XI5C 4L4TB 1DEEB 4OLZL 1MWAB 1T7WA 2HKHL 1EHXA 5C0CE 3PWPA 4Q9RH 3P0YH 3QDGE 2R0LH 4KRLB 3LMJH 2UWEA 3U83A 5HPMA 3V5DA 1GRWA 1M6OA 4GAYA 2VITB 1TTFA 2G9HA 5F3HA 4EI5B 1FG2A 5B4MC 4OIIL 1LE5A 1YEEH 4HSQA 1FORL 4HS6B 4PB9L 1BD2A 4UT9H 1BZ7B 5IKCB 4M48H 4N1HB 4JZJA 5CD5D 5D70L 4ZYKB 2F54E 3QDHA 5KVDL 3L9RA 1FPTL 4U0RB 1D9KC 3MJ9H 3PIQB 2E6JA 2DKUA 3FQXB 5MERB 5FM4A 1N26A 2CDGA 4M5ZL 4OM1L 1AP2B 2A9MH 3MLZL 5E70A 2QKIA 1F5WA 1KB5H 2QHRL 3IF1B 1MUJA 1RZJH 2NY7H 5GGSB 1U91B 4NZTH 5H94A 1A6VH 1N64H 2CDGB 5EFIA 4X83A 5DVLA 3BP7A 1G6VK 2O5XH 3VXRB 3MBXL 3O8XA 4GAGH 2I60H 1JZ6A 4KUCF 4XVTL 4DEPC 5EU3A 5ACMA 3LMJL 3SN6N 4PTTA 5EC2B 3RZCD 3D39D 1BD2B 5GRXG 1MCSA 3TIDA 2HJFB 4OZGF 5BOZG 3UTTE 1MCOL 3OAUH 4Z8FH 1CU4L 3VGAC 3MOBL 2R2BB 2QBWA 1A9BB 2FH6A 3EOBB 4XNZC 3ESUF 3NN8A 2B2XL 1J05A 4Z7WE 1X6NA 4XP6H 5J1TC 5IESH 3K46A 2HWZH 3OJDB 1XF5A 3OAZK 2P1YA 2N56A 5GRVL 3NACH 2AK4E 3FONA 4P5TC 4TUOA 5CEYB 3IVKB 1JF1A 1EEUA 4KJYA 5IW1B 5I15H 3JZ7A 3CFJB 2UZXB 3BPCB 1FFRA 4YR6A 5I8OH 1ONQB 5KZCB 4E0RB 1XMWA 3CFJA 2HFEA 4XWOC 2YEZA 1F3DH 2HT3D 4Y8DC 5T1KD 5I19L 1OF2B 2HFFB 2NY0B 4ODTH 3LS5H 3TH4T 3DHMA 5E2TL 4QY8B 3MSPA 2AXFB 1ZK9A 4U1MA 4ORZC 2WUCL 3L5WB 1G6RH 5I8EB 4DOHE 4YJZL 5JUEL 3TJHC 3J8F7 1FIGL 3ZO0A 1DBAL 1JZ3A 2EC9U 1KCVL 3VXUB 3VFWB 1XIWD 1I9RL 1FAIH 1PAMA 4JDVB 2SEBA 3TCLB 3BO8B 2OCFD 5E6YA 4CMHC 1DDHA 1J9CT 4DGYL 1CBVH 2BRQA 4Z5RB 4LVHB 3U9PH 2HVJA 4OB5L 4LLYA 3VXRD 4OQ1A 2AVGA 2O26U 1ZSDA 3MLWH 2IH1B 3OR7A 4HS8L 1YN7B 3MREA 2R1YB 5DMYA 3HFMH 5EIIB 2ZCLH 5D7SL 5C0BD 5AYQA 1FGVH 1QEWA 4IRJD 2OXHA 3C2SA 5IEHB 5DZNA 3NCJL 3GSQB 2GIYA 2WUCH 4Q6YA 1HWGB 2YMXH 4Y4KC 2YD8A 1KLGB 3DHJA 4ZOEA 1J7VR 3QNZB 1VFUA 4ENEC 2DQDH 2IADA 5MENA 3I9GH 2R4SH 1A7NL 1CL7L 1HHHB 3BIKA 2FATH 5E7FA 5DURB 3SDCB 4UTBL 4OUOA 1YN6B 4O58L 5HI3C 1AJ7L 5JXAH 5A43C 3JV5A 1CE6B 4YX2L 3D9AL 3HLAA 3QEHB 1DANT 1Z9MA 3JWDL 1CIDA 1BGXL 4P2OB 3ZTNH 1NAKH 2VOTA 4JO2L 3TV3H 5T33L 1KPUB 1KJ3L 8CGTA 3MXVL 4BZ2L 1J1XH 4ORGB 4POUB 4ZSOA 5CLWA 3FO0L 2XN9A 1MFAL 1CXEA 1R3LB 1O0VA 4TNVK 5JTWA 2GJZB 5LKNA 5FHBH 4OJFL 3VFNB 5CJOH 3QIWD 4C56A 5SX4I 1YMHB 5C0BE 5E1HB 2APBA 4KHXL 1J12A 1G6RB 4L9LA 3QRGL 5IQ9A 4NKMA 4PJIF 1EHLH 3T3PF 3W0WB 1T66C 1DN0B 3BI9X 4JRYD 5ESQB 1PJ9A 3S36X 4YDKL 1ZV5A 2ZCHL 4LSQH 2ORBH 1YMMA 5FYKE 1Q9OB 1YEHH 2YKLH 2FGZA 1RJYA 4HG4K 5D7JA 4KKAC 1DJSA 1TITA 1YEIL 2BSSB 5SWQB 5GZNC 4MA1B 5D6CB 1RIHH 3I2CL 4OFVA 2VDOH 5FGSA 3V6OC 2JELL 1UZ8A 5C0FA 2WBJB 4Q74A 4YHIB 5C0DA 5CIPB 2X4NA 3PV6A 3MLSL 1JTTA 1H0DB 3DX9B 2JCCB 3IKCB 4V1DD 3QP3A 4PUBL 1ZT4A 5GJTH 1TZIB 4OCLC 3VFTB 2IH3B 4TULH 3PDGA 3SGEI 2O5YL 3NGBB 3G6JE 5TF1H 5I1CH 1U8JA 1MCIA 2PTVA 1IAKB 1QBLH 1WICA 5AWNH 1UENA 1WBXB 4L29B 5DRNA 5HY9B 3PNWB 2F5BL 1RSFA 4YHPB 3B2VH 3RNQB 3VGAB 3LQZB 1IC1A 4XTRC 4JZNA 4ZS6C 4U1JA 2BSRA 1S7TB 2BNRD 1NCCL 4OSUH 4AIZA 4ZNEE 5J1SC 4GXUN 4QHLB 1W8OA 1L9NA 3NFSL 3QUYA 2X2YA 5F3BA 3PG2A 4WEUD 1OD9A 1NJ9B 4NWTH 1MJJA 1PSKH 1WFNA 3MUHL 4WFGD 1NDMA 4X80L 5I1IH 1BX2A 4LPWA 1DLHB 3MLUH 4GAGL 2AJVL 1ZVSB 3RUGB 2V5YA 3UTOA 5HGBA 1IEAA 4H20L 4B5EA 1RU9L 4O51A 4OCRH 3QRFM 5EG6C 3KJ6L 1RUQL 3HUJF 3FB6A 4FQIL 1RJLA 4JRYB 5GSVB 5F9AC 3HUJE 4C4KO 4HDIB 5GRUL 4BK5A 2DQCL 4HIIB 4XNYH 1KPRB 3MJ7B 4YIQA 2NX5E 1H8NA 5DK3A 2DIAA 2LVEA 5DEFA 3AU1A 4Q0XH 4X4YA 3MZTA 1FZMB 4CGTA 1XIWC 4RFNB 4Z7UE 2CLRB 4HJJL 1HCVA 3EW3B 4S11A 4L4TD 1MWAH 3QCTH 4U1GB 4G8EA 4Y0GA 5CWSB 5IWLC 4LSRH 5EN2B 5EOCJ 2VDKL 4RZCA 4KJQC 2FSEA 1HH6B 4L3CB 5INDB 1A1OA 3T2PA 5LAXB 1E4XI 3AROA 1A7OL 4JCMA 3DVGB 3MACL 4QRTB 1HKLH 1X4XA 1FYHB 2GJ6E 3WUWB 2MHAB 3OR6B 2CDFA 2X9WA 1TDQA 2CIKA 3WJJA 3FRPG 4XRCB 5HHXL 3SDDB 4QXWA 5DVOA 3GSVA 4P2RB 2QQKL 3ILPA 2LU3A 5C07B 4YHPA 2AGJH 3RNKB 2EZ0D 1IAKA 3WFDH 3ROLA 5E9DA 2F53D 3D18A 5C09D 3BWUC 3UTTD 2R2EB 4HKZA 4O51B 3T08A 5I1KH 5B39A 1KJ3H 1GVIA 4HEME 1I3UA 3CU1A 4LNRB 3TBVB 4NQEA 4MSWA 1ADQH 3HC4L 1RK1B 1RZIA 3EJJX 4PGBA 3FQNB 3IJSA 3LY6A 5T5FL 4LVHC 2BSTA 4N5UA 4PRHB 1BPVA 4MHHG 1ZA3A 1UZ8B 5C0FB 4LEOA 3IFPB 3QEUB 3QI9D 3V0VB 1R3IH 5L9DH 3EO9H 3TGXA 3FHQA 4K3JH 2VYRE 1WZLA 1I8KB 1NC2B 3SO5A 4AT6B 5C8JB 4M61B 3RWFB 3TYFA 3MRIB 1GZQB 4WDIB 4X5WA 1HHJB 5DJCB 3TT1H 5IB1A 5FKPA 4TOYH 2VXUH 4NQSA 5ESQA 3RWDA 4QXTA 5IQ9B 4MNQA 4WUUB 2NR6C 1DQDH 1I1CA 2I5YL 1MIMH 1JZ2A 1HHIB 4ZOCA 2YPLA 1TVBA 3B9EA 5ISZA 4NT6B 5SWSD 1XGRB 5I30H 5AZEL 1R5IB 2XA8L 1J0ZA 4X9BA 5ANME 5J1AB 1UZ6F 3D18B 2Y25A 1AGEB 1RZ8B 3G5YB 4L4VB 1KPUA 5T5FH 3S4SA 4YDKH 4D94A 1D6VL 4LFHD 1X5HA 5E8EB 3I75A 4PJBB 1GGIH 4N5EC 5E2VH 2FHCA 5DD3H 3PWNB 4P2QA 3P9LB 1YDPB 4PJAB 2CKBA 1WBYA 4JPWL 5HHPB 1CXKA 3M17B 4NOBA 4PYHA 3NCEB 4IJ3B 4U7SA 5TPWL 2V9TA 2JIXA 2DQGH 4OI8A 5MENB 4G5ZL 4ZSOE 1DSFH 2XY1A 5DJ8A 4X4XA 5D1ZB 2VQUA 2ZP0T 1IEBA 4JPKL 3U7YH 4YDJA 2WSKA 4ERSH 3LH2H 4JLRA 2VABB 3UYOD 4G6FB 4MJ4A 3FFCA 1HOCA 1BWMA 2O5ZL 2NXZB 3CFCH 3CNKA 1K8DA 3VFGL 1S7SA 2CPCA 3GMPA 2P7TA 4PJHF 5KS9B 1OCWH 3MZGB 1LHZA 1J5OH 5CCKL 4IJ3C 1IMHC 4RGND 1KXTB 4ERSL 5T1MB 5B22A 3O3EA 2VAJA 2ARWA 4F7EA 1T20B 3HG1D 5GGRY 5GXBB 3O6FA 1N3NA 4YQXH 3BP4B 2OR8A 3BEWA 1LD9B 3MODL 4G9FB 2VN7A 4JRXA 3RY4A 4G9FA 2KUTA 2VDMH 3ES6A 4R96B 4N0FA 3CCHA 3WNOA 1JMXA 1FCCA 5IJVA 4HK3N 5DD5L 3NGBC 2UY6A 1KPVB 3HHRB 1PZUB 1JNJA 3BDYL 4WHYG 2NX5B 2FX8H 1JHLH 2D7TL 1KEML 4RSVA 4V2CB 2P7TB 2DQEL 2JKXA 3PGDB 5DMGC 2C1OA 3OKKB 3CDCA 1I9RH 7FABH 1OAYH 1EVTC 4NRXB 5E08H 1S7RB 3WD5H 2HVJB 4CRPA 5DI8A 5HDBF 3E8UH 5HDBE 1DDHB 5EB9A 5E6ID 2XQYG 5EA0H 5JUEH 3Q6GL 1CT8A 1VSCA 4LCYB 4IIQB 2B1HH 5D7IF 1AD9A 2ZUSA 4Y5YB 1T22A 3QZWG 4K3DL 4Y19B 1ZHLB 4RGOL 1A1MA 3TLRA 4L3EB 1PYWB 1XR8A 1RJYB 1MRCH 1DVFB 2AQ2A 3MA9H 4OFPA 1X5FA 1Q9OA 2EICA 3SDYH 4DQOL 4ZMAT 2YRPA 3D85D 4PTUA 3U6RB 4FFWD 1WT5A 4P5KA 4N90D 3MV9A 4JR9H 4NKMB 1MHPH 5F6HJ 1MCKA 2AK1H 5LWYL 5KN5A 1FDLH 1GGCH 2H26A 2FYYA 4PLNC 4NJAH 1UA6H 4C57C 1P4IL 2H32H 3PP4L 5CMAB 2OQJB 4YXLH 3CZFB 5IWLA 3OB0K 5HD8D 3DVIA 5TDPA 2FR4A 2AJUL 3GNMH 4Y4HD 1I1YA 2D31A 3QZWB 3T0EE 3EOBA 2P46B 5K9OB 3GEWB 4EJ1C 1JHKL 3OKNA 5FGBA 1C7TA 2R1WB 4UV4H 4QOKA 4WFED 1UB5B 3GJFH 3RPIB 5KSVB 2DRUA 3RPIA 1T0PB 3UC0L 4CJ1A 2CLZA 5ALCH 4MA1C 4EN3B 2XIDA 4IRSC 1I7UA 3GI9H 1MJ7H 2OTWA 4PPTA 1TZGL 3WFZA 5F1NA 2EDHA 3GSOA 3NCYP 4Y16C 3FO9A 1INEH 5CEZE 2LTQC 3K81A 1T1YA 5I1EL 4OFIA 2FJFB 4D3CH 4ODUA 5GGSA 3CZFA 1X5JA 5F8QC 3QPQC 5K9KA 3P77A 4KQ4H 4GXUM 1AO7B 4DAGL 3MFFB 3DJ9A 3O0RL 1D5BB 4UQ2A 3OGCB 2EECA 2HG5A 3DX7B 3GMLA 3A6CH 3HCVA 4QRTA 1CGWA 4JZOA 5BQ7B 1NH6A 5DHXB 3HZYA 3QUKA 3LDBC 1UACH 5KSAA 3T09A 1KN2H 1BVLA 3QDGA 2FBOJ 4HS6A 4YDLC 1DBKH 2OLDA 4GQ9H 3L1OL 1BJ1J 2CRMA 2EH8L 3JWOL 3MNWB 3SDXB 3BSZL 3FOLB 1P9MC 2DQIL 1KIUA 2ILLA 2ZUYA 4TSBL 1ACYL 1AD0B 4S1DC 4LHQB 5J56B 5D6DA 1HXYA 4UT6L 1II4E 1XGQA 2CRYA 3QHZH 3CDFA 1G7QA 1GOGA 3EYVA 4DZBB 4OUUB 4G80A 4FS0A 5DS8B 4U1MB 2PF6A 4LVOC 4XAKD 3ARQA 3BIAX 4G8FB 3ZDYE 3G6DL 2F8XC 5HYSB 1CLZL 1ZT7B 4GW5B 4O58H 2OR7A 3OMZA 5F70A 4XVJH 2C3XA 4QRPD 2W0FA 4EEEA 1MCRA 4KTDH 4ZFOL 4LCWE 1MJJB 4HIEA 4XHJD 1OAZH 3IAQA 5D72L 3ETBF 4XCEB 3TIEA 4U2ZA 2R4RH 3K2MC 4JHBA 1G7JB 4LMQE 3EJZD 5E2UL 1HQRB 1RZJC 3B9KD 2JLLA 1BQLL 3QCVL 4OJFH 1S7TA 3TBSA 2YD4A 5I75B 1R3HB 1Q94B 4YHLH 4ODBD 4LLVA 4XBEL 4C56D 1LO0H 2R2BA 1KTDB 1L0YA 2VXSL 3PNWA 1QNZL 5TE6H 1EHLL 1X4YA 3PL6B 1LD9A 3I6LD 3MUJA 5CEZD 5HYSA 4HCRL 3BH9B 2PUQT 1NCUA 3G5XB 5JPNB 4H25B 4JQVA 3DGGB 4ODVH 5E1AA 5GS1C 3D87B 3PDOA 4JFDD 3RIFK 1E0OB 1D9KB 3OXRA 3IB4A 1T2QL 4R26H 4DN4H 5C08B 3BP7B 3QNYA 3TA3D 3SDDC 4BH8B 4UNTA 2VH5L 5E9DE 4HW6A 2J5LC 5AD0B 1MAKA 3ARYA 1CDYA 4PJ8C 1AH1A 3SKJH 1U36A 4P5TB 1F6AB 4XC3L 4J2XA 3ULVD 5DRXB 4P4KC 3ZE2F 4NNXB 4UUJB 4POZD 4FMFA 2PW2B 3O8XC 3GUTA 3QG6A 1P5UA 5ICXA 1HH9A 2RR3A 5LG1A 7FABL 3PHQB 2ZNXA 3M17A 1KIRA 5KOMC 2BOCB 2C5DC 3ZZ1A 4XH2B 4LHJB 5DHVB 4NNXA 4CN1A 4MQ7B 3I3BA 4M7JL 1OAKL 5FF6A 3OGCA 3RUGE 3RGVD 4UOW0 4XC3H 2YD7A 3C6LB 4Y1AE 1NKRA 4HIJA 1CVSC 3MV7A 3C09B 2ZOKA 3PQYA 1LP9F 4M48L 3JVGA 1MWAA 1J11A 4R26L 3LDBB 3U9UB 2GSIB 4WWKA 3ULSA 1ZVYA 2M8XA 2ZOKB 3PQYB 4GBXB 2NY0D 1MLBA 3BP5B 4KTYA 1Q0XH 4LKXA 2GK0B 2VXVH 2X05A 1MSPA 4F15B 5MI0B 3FZUD 3WUZA 3PHQA 2HT3C 5D6DC 5HI4D 1JGUL 3V6FB 4R8WH 1KTDA 1CGYA 4OF7A 5KG9B 3GSWB 2IBBA 3KYKL 3G9VA 5EZLB 1UKQA 4PJXF 5DRXA 4HUMB 2VLKD 4NKIH 2C3VA 3GRWL 1PZ5A 3RDTC 2XZQL 1WSST 3UBXA 2WWMC 2I9LA 4EUPH 5F7UA 1T5WA 2HKFH 1HZHL 1QRNA 2BVEA 1QSED 1GGYA 3MREB 4UZGA 1IEHA 1AIFA 4XCFL 4HF5L 1WTLA 4G6KH 1TFHA 1UGNA 4I13B 1UWEH 4I3RH 5IUSA 4ZFFA 1PLGH 4WFHE 2J8UB 1KIQB 5I66A 2DLHA 2ZWLT 4MD0B 3TFKD 2AI0H 4KI5C 5DD0L 3S4SG 4Z7QE 1W0WB 1T03H 3V79C 1GGTA 3U7YL 4CMMB 5GGVY 3VW3H 5FYJU 4F37K 4Q2ZA 4QRSA 1NANI 3DYPA 3HG1E 3UZEA 1LK2A 3VXQB 3OF6A 3FO2B 4NQCE 3VFVA 2PTTB 4NQDB 4L9LC 4LVNC 4S1DD 4WFGE 4OLYH 5GRJH 4HUXA 2F53A 2D9QB 2YZ1A 4JHAL 2AERT 2OMBA 4PRPB 3SDAA 4K07A 2OTPA 5TE7L 1UEMA 3G6AA 5IMOB 3CVIL 4JPIB 5C0RH 2FECL 3VMNA 4FQ1H 4GAJL 3QQ9C 4LCWA 2HFFA 1IM9D 1ORQB 5CS7A 1U8HB 1MFBL 1ED3A 5I76B 2I5YH 3HFML 4LKCB 4UDUA 5ELIA 4OD3H 3GRWA 4XBGA 5EPMA 4NRZB 3HI6H 1MH5A 4Z7UB 4WU5B 3LSOB 1EJOL 3EJYD 3TT3H 3MJ7A 3IDJB 5FDWA 1EK3A 1AI1H 1JJUA 1S9YB 1G7QB 4JFPA 4G6AC 4OLXL 3KG5A 4ELKA 4Z76A 2AABH 3ES6B 2E7HA 5JIHA 3KPRA 3QIBD 4U0QB 4YK4B 1C1EH 1KUMA 1X3DA 3D1MC 5B39G 3QCUL 5IB2B 5DJXA 4MCYA 1RZGA 3TN0A 5FYKL 1I4FB 4NQDE 1OY3B 1U8NA 5SWSA 4OLXH 3GIZH 43CAB 4MA3B 5D1XD 1ZHBB 4K94C 3F58H 4LEXH 5IEKB 2NY6D 1F4YH 1IGIL 3DSFH 3C5JB 3X13B 2V7HA 3IXTA 2I24N 3NABL 4U1JB 4LSSL 4NJ9H 4EN3D 3CSYA 3LQZA 3VGEA 2V2TA 3A67H 3LCYA 1N6QL 2YR3A 2ZSWB 2PYED 3H9ZA 3VDBA 2DWDB 3FQXA 4LSPH 4X4XB 2OX5A 5CP3H 3KPOA 2VLRB 2G60L 4YWGH 2MKLC 5IVXA 4HCRH 3PWPD 3QDME 1LE9A 2HFGH 4XHQA 1BJ8A 3SDYL 4DQOH 1HILA 2AJXL 3DTXA 1YEIH 3DXAE 4UTAL 5DQDL 1XR8B 4GXVH 4HEPG 3UTSA 2G9HB 4MXVF 4NO3B 1MFDH 4EZMA 4JY6B 2XV6B 1CG9A 1U95B 1TVDA 4DVRH 1X9QA 4R4BB 1IILE 4HV8B 2FDBP 1NBZB 1QYGL 1U58B 4V1DB 3RWIA 3IDNA 5KVEL 4TRPL 1PX3A 3IAPA 1U3HA