2GFBB

Crystal structure of a catalytic fab having esterase-like activity
Total Genus 41
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
41
sequence length
219
structure length
219
Chain Sequence
DVKLVESGGGLVQPGGSRKLSCAASGFTFSSFGMHWVRQAPEKGLEWVAYISSGSSTIYYADTVKGRFTISRDNPKNTLFLQMTSLRSEDTAMYYCARGDYYGSRGAYWGQGTLVTVSAKTTAPSVYPLAPVCGDTTGSSVTLGCLVKGYFPEPVTLTWNSGSLSSGVHTFPAVLQSDLYTLSSSVTVTSSTWPSQSITCNVAHPASSTKVDKKIEPRG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of a catalytic antibody Fab with esterase-like activity.
pubmed doi rcsb
molecule tags Immunoglobulin
molecule keywords IGG2A CNJ206 FAB (LIGHT CHAIN)
total genus 41
structure length 219
sequence length 219
chains with identical sequence D, F, H, J, L, N, P
ec nomenclature
pdb deposition date 1994-07-07
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2gfbB02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2gfbB01
4AY0A 2VB5A 5D71L 3QFJB 2EO9A 3BP4A 1OAQL 1U8OB 1FAIL 2ED9A 2JF1A 5C70A 5CEZH 1HN1A 4FXKA 3B3IA 1XEDA 2AJYL 5AEAA 3FFDB 1ORQA 3GSQB 3QDHA 4KVCH 2E6QA 3HMWL 4RWYH 1JVKA 1N8ZA 2VDNL 3DXAD 1F4WH 1LK3L 4KKBC 5MEND 4M7KH 1MCBA 5D2NC 4LASL 1BBJB 4UIMB 5F7EL 5CMAB 1WVZA 4D9RD 3OKEA 4LCUA 3OXSA 4CUCA 3ARDD 5TQ0L 3SDYL 3N06B 4QRRB 5I1EL 1FH5L 4XNMA 4XNQB 1A7QL 5C08E 3TN0B 4BK5A 5IW1A 3SGEI 1FG9C 1I85A 4Q58C 1IC7L 1TVBB 3GKWL 1DBBH 2CGRH 3VRLE 1HOCA 4C55A 3SGEH 5TE6H 1K8IB 2VC2H 3U79A 2C3VB 2VDQH 1DP0A 3I50L 3DSNA 1JGUH 1S7RB 2P8PB 1FPTH 4CJ0A 1FPTL 5JDJA 1BVKA 1OL0A 3S4SB 4LPVA 3TVMB 2YRZA 1KCRL 3V6OC 3MYJA 5HJ3B 1B3JA 4M6MH 5J89A 4NUJB 1A6TA 4LVOC 3MJ9L 3ARDA 1CVRA 2R4SH 1HH6B 1CBVH 4L4VB 2GCYB 2AJUL 4L4VE 4NHUB 2X89A 5HDOA 1YNKL 3G9VA 2DL9A 4KVNL 2W9DL 3JWDH 2Z31D 1BQLH 4UV4H 2KPNA 1FZKA 4ZXBA 4QWWC 4HDIB 4G9FE 5BW7C 3RNQB 1S7UB 1UZ8B 5M7QA 4KY1L 2Y06L 3PGFL 5SWSD 1M7DB 5KSAC 2GJ6A 1MCQA 25C8L 2NTFB 3TJEL 1HWHB 1AD0B 1FDLL 3HUJA 1J8HB 3HCVB 2A1WH 3FQRB 3G6DH 2VZ1A 2ZUQC 2BNUA 3HAEG 2XFXA 4NKOA 2ZUUA 4HS8L 4WO4B 3DPBA 2NX5D 4C4KT 1SMOA 4UUJA 4HFUH 2Z31A 1V3LA 1K5NB 2OMNA 2NXZD 1F6AB 3IDGA 2AJVL 1YEEL 5BV7C 5F9OL 5DJYA 1MCOH 4ZXBD 3FO1A 1G84A 3KVQA 1CTOA 2N7BA 4P2QD 1T7VA 1E4KC 1IC5L 4PJGA 4GMTL 1ZLVK 4UAOC 3L5XL 2R0LH 3QRGH 1DQDH 2AK4B 2A83B 4LEOA 3BZFA 1J12A 5IW6A 4OF0A 1IRAY 1ND0B 1NCWH 4NN5B 1CIDA 3JVGA 3BOVA 4I0PD 5KG9B 2I5YH 2VLLB 5AUMA 1FO0B 3RWCB 1DLHB 3PWNA 1YEDB 2EDJA 5ID0B 5KANG 4G9DB 1ONQA 4YPJA 1MIEH 1A7NL 2YPKB 4LNVA 2HRPL 2DQCH 4WV1B 4MQSB 2EE6A 1V5JA 4F58L 2V2XA 3N85L 1EO8H 3QO0A 4ALAL 5HGDA 5SWZD 3VGDA 5D2LA 2VR4A 5IVOA 2NY2B 1UCBH 4EN3B 3MV9A 2DLFL 2J4WL 3MXWL 4QRQA 3U36A 4KMQA 4NP4L 2VZVA 1HILB 4J3SA 4PGBB 4OZIE 4P2QB 2BZDA 3MLSL 1TZHA 1CICC 3TNNB 3MBXL 4FFZH 4PGEA 2OBGA 5GS2D 3QEGL 3EOAB 1ES0A 5IVZB 5J6HB 5C2UB 4QF1B 1H3PL 3RVXD 1A0QL 2VERN 1RFDH 3KAAA 3AUVA 1U8JB 3Q5TA 15C8L 3KLDA 1QBLL 4HJJL 2IFFH 2OSLA 2VYRE 3A67H 5LGHH 4HIHA 3SE3A 4LPUA 3U36B 2Y5TB 3EJYD 1S3KH 5I15H 4OD1L 3S8WA 1QFWI 3DWTA 1F00I 3MRBB 1YEHL 3PWPE 1NC4B 2BY3A 2FZ3A 4L4TD 4OFYD 1U3HB 1S7TB 2OL3B 3MJGX 4LPCA 2OM5A 3BAEL 1WTLA 3C2AH 4LHQB 3QO0B 1J1OL 3V4PH 4U0RC 4X6DF 5JORA 2ZCLL 3KJ6H 1CD1A 3E6FB 1A2YA 1UM5H 3RTQC 4O9HH 3LEXA 5JW3L 4YDIL 2DI8A 1WCBB 2OL3L 3PJSA 3FOMA 1X4YA 3TWCH 3A6CL 1CFNB 2HKHL 4LFHG 3LB6C 1AY1H 3KYAA 5E2JA 1CZ8L 2L7JA 2VLLA 5DFTA 2XTJB 3I50H 3N85H 4P5TC 1NSNH 5D7IE 1ND0A 2OX5A 5DTFB 3PV7A 4MJ6B 5FUOH 3HE7C 4XP4H 1L0YA 3VI3E 1A6ZA 4LKCA 1QYGL 1R5WA 4WWKC 5FGCB 1KFAL 1YEIH 1MNUH 3RDTD 4F7CB 1I9IH 4GBXB 3O8XC 1FFPB 1MI5D 4OCYH 1T22B 5DJYB 3B9AA 2YWZA 3REVB 4YIQA 2VQ1B 4R4BB 1NBZA 5DS8B 4ONOA 3VFWA 5KVDH 5MENB 1FL6A 1LP9B 3HE6C 2XFXB 3PL6D 4F7MB 5T33H 4IRSB 3W11D 1DTUA 3OG4B 5ANME 2C26A 3WEXA 1SYSB 1BHGA 2Z92A 4MSWA 3P0YH 1J7VR 4X7TA 1BQHA 1DEDA 4J4PD 3CVIL 1KEGL 4DZ8B 1FE8H 1KEGH 3TBTB 3RNQA 1WGOA 4BQCA 5L0QB 4RFNC 2FH8A 3O6KH 3RDTA 4N0UB 4NJAH 1L6ZA 2CR6A 3CFJA 1MVFA 2NX5E 4AIOA 2CRMA 4M93C 3WFEH 1DDHA 3N1FC 1Q38A 4BQ8A 3BQUC 1RIHL 3AS2A 5FCSH 4P5TB 1ETZA 4JFDB 1DUYB 2OJEB 4PJAB 2PUQT 3CZFA 4L4VA 2BY0A 4LAJH 1J5OL 3EO1A 4X6FB 4YZFF 5GGVL 2ZUTA 2DBJA 1GGYA 1TJHL 1J1PH 3TVMA 4MYWB 5DEGA 4I0PC 3EO0B 5GS1B 5TQ2H 4NCC2 1MFAH 2MCPH 5ITBL 1AR1C 1JIBA 4TULL 2A6DA 3RL1A 1LO4H 4C54A 1PG7H 3O45A 1K8IA 1OAZL 3OKDB 5D1ZB 5HHNA 5DJ2B 4U1GB 3BKJH 1QZ1A 4K8RD 4HWBL 4LLUA 4OCXH 4OJFL 1I8MA 2A6IB 3TM6A 3GBML 3MV7B 1R3JB 4LSTH 1E27A 3QUYA 3MJ7B 1CXKA 3UJTH 3UJTL 2R23A 4M6NL 4XH2B 2XN9A 2IGFL 2PYEA 4JY4A 4RFOL 2DD8L 1EXUA 1CICB 1MOEA 3HRZA 4PJBB 2PW2B 2WMPA 3AY4C 4KKNA 4YHZH 1PAMA 3EYSH 4F7PA 1INDH 4EOWL 1PKQE 3AMKA 4OBSA 4GXVH 3N1GC 1PG7X 2O26U 2QQQA 2HH0L 5F96L 4E0RA 3ARYA 1FG2A 1S9VB 3X3FL 5B39G 4XPHL 1W0WB 3BYTA 3OKKB 2CGRL 2F74A 1INEL 3VD7A 3VRIA 5DHYA 1N6QH 1Z2KA 3GB7A 4XVTL 1XCTB 2ADJA 2PYED 3H0TA 4N0YL 4D0CA 4H8WL 4ZSOB 5A1AA 4TUKL 3ARVA 5I8CA 3LKSB 4HAGA 5MI0B 2WBKA 4G43A 4JHWL 2YOCA 5K9JH 2H2SC 4ZFFA 4OKDA 3GMLA 5FM5M 1WQVT 3SOBH 4FZEL 2GJ6E 5GGQH 2Y72A 2BNRA 5FYLL 2E3VA 4RRPG 3T0EA 4UNVA 1AGDB 4P9HC 3DIFA 1IC1A 1PBYA 4PRPA 1R5VA 4MCYB 1HI6B 4O02L 4G5ZL 3ZSSA 1QUNA 3DSFL 4RMTA 1PYWB 3S96B 4XB7A 5L2JA 4P59H 1YEHH 5F7WC 4U1SA 2EDHA 3VA2C 5TDPA 3HPLA 4P2RE 3HZMA 1GHFL 4G3YL 3DROA 4K07A 4PJHB 3LB6D 2E9IA 5EZLA 4KDTA 1X5XA 4JM2D 3OMZA 1NDGA 4OUUA 4EVNB 1B4JH 3HI6L 2DBLL 5E00A 1D9KD 4DN4L 1U8KB 1ZHLA 3O3DB 3N1MC 4M6AA 4P9HH 1QLEH 2CDFB 1TMCB 5DFWH 3CFKB 5DMIH 5KVEL 5ALCH 3RWIB 1G7QB 3LQZA 4EI6B 3IF1B 4WWKD 1QA9B 4H20H 3CVIH 1SQ2N 3KPPB 1JPGA 4R4FL 3UBXA 3H9ZA 4PR5B 5FKPA 4FP8H 5HYSA 3PG2A 4ZNEA 4FQHA 3VRJA 1CDJA 3MCKB 3HMXH 3JV4B 2BP3A 4EI5A 4NPYB 1MCOL 4YLQT 4P2QE 3KPMB 3VXNA 3MR9B 5DRWA 4XP1L 3OZ9L 4I18A 1NAML 5I8OL 1LEGB 1C8PA 4P2OD 4KROB 4Y16B 1LK2B 4Q9QH 1QFWL 5DWUL 5ICXA 1QG3A 3QCTH 4HUXA 1I8IB 4J7RA 3K2UL 3U4BL 1OP5K 2WP3T 2E7MA 3TIEB 3WO3B 2V7HB 4G8IB 4J3UA 2IBBA 3JV6B 5J11C 3QO1B 5JW4M 3BJLA 2UVFA 4WY7H 3ZL4L 4EI5D 3CFBA 4XNYL 2YUXA 1F42A 4QRPB 3BMVA 1RZFH 5IVXA 3KDMB 5IP4A 4M7LT 4PREB 4B7LA 4OI8A 2IF7A 4CVWA 3VFUA 3BIKA 5HYJE 4G6AD 3D0VA 3HR5A 1KLGB 4PJ9C 5IB5B 5MERB 2IPUK 1KXTB 5KN5B 4JHWH 4NO0B 3MRMA 4ZS7H 4LK4A 2KQMA 2DKUA 3WNMA 1UH2A 4PJ9A 1EVTC 1OAUH 3ULVE 3QEUA 5E9DA 2Q76B 5LGHL 2VC2L 4Y5YC 1CLZH 3PGCB 4Z9KB 3VFTB 4N90E 4A6YA 4E41A 1ZVHA 5B39B 3X14B 3LEVL 3UYRL 3W9DB 4F3FB 1RULL 4KV5F 4KK5C 2BJML 4X9FA 4JFDE 1D5MA 4LCYB 4OD2A 2XPGA 4GXVL 1PEWA 4LSUL 4XPAH 3FQWB 1HQRB 1FCCA 1BMGA 4RX4A 2KDGA 4ZYKB 4GKZA 3UYPA 4LHUB 2JK5B 3JVGC 2D9QB 3MRJA 4O2CB 5EO1A 3T65A 1CLOL 1ZS8A 3LVEA 4X6CE 3L3HA 4UQ3A 3DXAA 3E2HB 4JQIH 4X6CA 5EO0A 3OJDB 1K9TA 4I18C 3TFKD 4XVTH 4TSBH 4RAVA 4HMDA 2FX7L 4EDWH 3S97C 1EAPB 3P4LA 4NRYA 1JMXA 1BZ7A 3GRWL 5FKAA 4N8VG 1QRNB 4GO6B 5I1LA 4P2RD 4PJGE 2BDNL 3BE1L 2FX9H 3QJHA 5KS9B 2IPKB 3WYRA 3WIFA 3F65A 5CKAA 1LEKB 4DVRH 32C2B 1A14H 3DUUB 3ZZ1A 1EEZB 1GAFH 2OTUA 1HIML 4IBLT 4IMKA 5I0DA 1EHXA 2HMIC 5H94A 5CINL 4LEXL 2ICEA 2Q7NA 5ILTH 1XF3B 5JPNA 1MRDL 2BERA 3IETA 5EU5A 1GHFH 2G60L 1AO7E 3NMEA 3RKPA 4M93B 4NRXB 1BFVH 3W5NA 2HLFC 4HFWB 5DRNB 3ZKMC 3RX8A 3IFNL 4LMQI 2WINB 4NO3B 3IDMB 1KIRB 3FO2A 3K74B 4H0HB 4AH2A 3HI5L 1GGTA 1RD6A 1FGNH 2VDQL 3SE4C 5F3HA 1X9QA 5SWSA 2X4NB 1HINH 1NLBH 4Z0XB 3BFOA 5DK0A 3CMOH 3PWJA 1QBAA 3RX7A 3K1KC 4Y4FD 3P9MB 2DB8A 5D1XD 5CP7A 4G8FA 4CMHC 2PTTA 2IFFL 3PUCA 3RL2A 3ARFC 4OZFG 3CSGA 1I85C 4I1NB 4OB5L 4R2GC 5IJKC 1RUAH 1BWMA 3EO9H 4YBQC 2Y6SC 4K7PY 2D7TL 1A6AB 3VXOB 2MTPA 3KXFB 1G7IA 1QSFA 3K1DA 2F8XC 1CYGA 2HVJB 2VSDA 4LLAA 4QRSB 3KYNB 5CZVH 3T3PF 3V0VB 1XGRB 4M7LH 1I1AB 3INUH 3TO4D 1P2CB 2OQJA 4M4RA 4NCDA 3OSKA 1ZT4B 4I48A 3L3IA 3OGCB 4N5EC 2GJZB 2ZCLH 3DX6A 1UG9A 2IH1A 4TULH 1HHKA 5D2NB 1KBGH 4FQPA 1F3JA 4HUNB 5EU3B 2ITCA 4D94A 1TITA 2NY5L 4GW1A 5HVFB 1U36A 2M2DA 3MRQA 5C9KA 4HKBA 1ZHBA 1GJIA 1GAFL 1I1AC 5C9JB 1FV1B 2CD0A 4HPYH 4K3EH 5H37G 1HDMA 3RWJA 3T0EC 5H35A 2P8MB 1WT5A 3TBSA 5F89B 1MELA 5BOZG 1T66C 4HUVA 3TJHD 3TN0D 1A9EA 1NGPH 3P3YA 2OLDA 3ARBC 1QR1A 4H0IA 1QOKA 2XKNA 3FQUB 1GZQA 4MB4A 3M8OH 1LDSA 4QHLA 1MEXH 4UQ2A 3MV9D 3RA7H 1O7SA 5F72S 1WFNA 2WP3O 2EEAA 5EORH 5JR1H 4MXQC 4KJWC 1DQLH 1G6RL 2NY4B 2VLJE 3QDJE 3KYOA 4U3HA 1ZLSL 4P23C 2HKHH 1F90L 2VKWA 3TPUA 4JFZH 1F4YH 4WI7A 4DFHA 2R39A 4RQQA 3O6FD 4LIQL 5BV7L 2D9CA 4GRLA 4PRIB 4XPTL 4MB3A 4NQEB 4ZUVA 4O00A 5DRZA 2AK1L 3HC0B 4WVRA 1BF2A 4GSDL 1U9KA 3O4LA 4M1GH 2WIIA 1WAAE 2K9UA 1I9IL 2D31B 3O6FB 1CFVH 2F53B 1AI1L 2VQUA 2FEEL 4JZJB 4Z7WB 2OR9L 4XP9L 4WHCA 5MHSD 3BKML 1YUHB 1A6VH 2EYSB 1U8PB 3C60B 1QBBA 4UB0L 4PJIB 3C6SA 1CFSA 5HD8C 4LLVA 1OW0C 2QKIB 3ARUA 3TO2B 3L5JA 4G9FD 4V1DA 3O2DA 4NKQB 1NPUA 3ME0A 3KLHD 1KTDA 2W91A 2V7NA 1IGYA 3VWJA 3ZKSD 1AGBA 2AERT 1Q72L 1OGAA 4YXLH 4Z7QF 2BSSA 3BQUB 3HMXL 4WUUB 2BSTA 2IANE 2NY0D 4N0CD 4X5WB 4MNHA 1OLZA 1T3FA 3IYLW 4XBPA 1TZIA 1A5FH 3B9KC 2IPUG 1PX4A 3QNYA 1BIHA 5AD0B 4R4FH 4WW2F 2HT3D 4OIAA 2XXMB 4D0DA 4F37F 3QXAA 5FA4A 2EE2A 3I9GH 4HGKC 5EZJA 3VXTB 1FVDA 1NCUA 3U2SA 1U3HD 3U7AA 5IT2H 4KRPC 5JR1L 3MRCA 1T20B 1XCQB 2GK0B 5KVFH 1JPSL 4P4KA 5GS0C 1RJYB 1EGJA 3QDMB 4R2GD 1AP2B 4N1EA 2W1NA 1J87A 3OKMB 3HFMH 3HUJF 2MQCA 5HHPB 2FGWL 5D1XB 3UPRB 4Y4FB 4ZQKB 3J7HA 3C08L 3WJLA 1WIOA 5FGBC 3CNKA 4LLDB 3HE6A 3N1QC 2A6JB 4MJ2A 1A3LL 2EIBA 3ISWA 3KYMB 4OQTA 2HLFD 4PTTB 1KJMB 2X09A 4X8JA 1NCAH 1PLGH 4N0CC 4R0LC 1HHJA 1NLDL 4JPWH 1JE6A 5AZEH 5JQ6L 2Q3AA 3O4OC 3ROOA 3HPJB 3JUZA 5IF0A 2OTPA 5C07B 4IM8A 2Y06H 1Q9OA 2XZCL 4ZOEA 2JB6B 4FFWD 3CLEL 1PJ9A 1Y0LA 1J05B 3L3OB 1CQKA 2VDML 1EMTH 4QKXB 2P8LA 1U3HC 1PQZB 1EO7A 1PY4A 3T4YA 2PTUA 7FABL 1IGTB 2IADB 4PJXB 4DN4H 2O5XH 1EAJA 4J3TA 1C08B 1PKQA 2VAAA 4TVPH 3QXWA 4HBCL 3RVWC 4OKVA 2JIXB 3WJLC 1DBML 1DQMH 3AM8A 3G5VB 3NACH 3V5DA 3VW3L 1UA6L 4P2RB 3WJJA 1M7IB 3CXDH 1CLCA 1I1YB 3HZKA 4BFGA 3ARBD 4XPTH 5DK2A 2Z35B 3KLSA 1EBAA 1I3UA 1IC5H 1QFHA 5CZKA 5I1GH 1VGKA 3B9EA 1RZJH 4MXVE 1RZJL 4POZD 3MV8E 2Q87A 3VXRD 5IROA 2AQ3A 5FB8B 1FIGL 3SDXF 1JZ8A 1EH9A 5I1KH 2NZIA 4LLQB 4EUPH 5LJYH 4HWBH 3GKZA 2P44B 2QSTA 5T3ZD 2ILLA 2XZAL 3EBAA 1ZHNA 2DQCL 4YHNA 5BS0D 3MRHA 4S1QL 4D0BA 3GSVB 1I8KA 5EN2A 3I85A 4H1LH 4L4JA 4FZ8H 4WO4D 1I8LA 3GM8A 1NBYA 5JDSA 2QQKH 1MAML 2CUIA 2HWZL 4UINL 1J8HD 5F70A 4MGXA 1KIPB 4R90H 1RZJC 1SHMA 4KI5F 3BYYA 3DLQR 1RJZA 2FSEB 4MX7B 2G9HB 2HH0H 5F96H 3L5WA 4NQCE 4F57L 5HHQA 4X6BB 3JWDL 4OQTH 4LCWA 2A9MH 4QNPF 3FRPG 1NMBH 1ZEAH 4LSRH 5IB3B 2ATPB 3QISA 3BEWB 5T33L 3SDXB 3V7MA 4H5SB 3P2TA 1I3RB 5C0BE 2HG5B 4E5XA 4OLWH 3O3AA 4XXDB 5JOFB 1MJJB 1QEWB 4JG0L 4GUPB 3RBGA 3UPCA 2QADB 1Y18B 3LEYL 4ZPTB 5DD0H 5ACLA 3T1FB 3HAEA 4P3DB 3FN9A 1LNUA 3BO8B 4OZ4A 5AWNH 3ARXA 1TPXB 3LKPB 2IAMC 3CVHL 1H8OA 4JRYD 4OCWH 3SE3C 4HH9B 4PD4J 4XHJC 3VXMB 4RDQG 4PJFB 2GTZB 2QHRL 2VWEC 4G6KL 4WO4C 4K7PX 5AZEL 3MLRH 5JQ6H 4BH8B 3P4MB 1X6LA 3UYRH 3EDFA 4Y5XC 4R97C 4MAYB 4QRRD 3UO1L 3PF2A 1P5UA 4KROD 4QTIH 4U1HA 3PHOB 3ZDZF 3QXVA 3LS5L 4QXUH 3T1FA 3T0VA 3O2WL 4HUUA 1KN2H 2WQRA 3RVUD 5EU4B 3TBVB 3Q5OA 3CSPA 5HGHB 1G9ML 4E5XB 5IKCB 2OJZL 2YMXL 1CT8B 3SDXA 5GIRB 5ICYB 2P5EB 3G9AB 3RU8H 4YE4H 3VE0B 4F33B 5C3LD 6CGTA 3OJVC 3EW3B 2HRLA 3FO9A 2VLJD 4ZS6D 4HUWA 3BH9A 2VDMH 5LQBL 3OHXB 2BVEA 5C71A 4AT6B 2FR4B 3UP1A 2Y23A 5IB2B 2J8OA 3CPLA 1B90A 5F3BA 3DRTA 2ZKHL 1FYTD 3K81A 2FX9L 3Q2CA 4K7PL 2VTFA 2B0SH 4P5KB 3SQOH 2ZJSH 4HZAA 3EYVB 4ZPVB 5I0ZA 2E5EA 3QWRD 5IUSA 1OWWA 4JPWL 4H1LB 4HS6B 3GIZH 3PWLB 3EOYG 5B8CA 3FT2A 4R26L 5HHME 2ZSVA 4ZFGL 1S8DA 1FFOB 5GS0L 2NNAA 4OLZH 3MLYL 1JJUA 1D5ZB 2AABH 2J2ZA 1ZE3C 1JNNL 3VWKC 4HC1L 3K4AA 2WIMA 4ONHA 1WC7A 5HY9A 3G5YB 3GO1H 3RTQD 1ITCA 3O2VL 4FZEH 5FOBB 4KTYA 5IG7B 1L7IH 1VFOA 3MLUH 1T03L 1DBJL 2EH8L 2WBWB 3LPWA 4WJ5B 3CJJA 1JHKL 3VFRB 3QDJB 1Z9MA 4NNYA 3BKMH 1GGIL 5E94B 1I7ZA 5E24E 3CD4A 1XF2B 5GXBB 1FO0H 4JREB 3MXVL 5B8CC 4UILL 4C57C 1Q9KA 2GY7B 4Y19B 1JNHA 2ARJA 2VLKA 1B0RA 4MQXC 4Y19E 3B6SA 2VDPL 3WHXA 4M03A 1T83C 2IANA 3WS6A 4JFED 1YEFH 3KPNA 3L9RB 4X6EA 2PR4L 2DQIL 1T1XB 4YC2B 1BD2D 3PXHA 1VKXB 4JFXB 4OF7A 1X5HA 3BP5A 5J1SC 1G9MH 5D4QA 3H3PL 1ZK9A 1I3GH 1FVEB 1RJCA 2VZUA 4HWEH 2YKLH 3G5ZB 3LHPL 5LBSL 3H6JA 2W59A 2PNDA 4ODTH 3P11L 1D5XA 3HB3D 1HHJB 4GMSL 4LLYA 3CPLB 4KJPC 4Z8FL 5ECJE 4H25B 1IL1A 3RTQB 4AIZB 5JW4Q 4RCAA 4I5BB 5DJ6B 3FO9B 3BRGC 3BXNB 4X99B 2IAND 4O2FA 5DQ9B 3WO4B 1TFHA 3VE0A 1OVZA 2BXZA 1H8NA 4XMPH 3KLAA 4DVBA 2AJZA 2NW2B 3AREB 3PQYD 4JFFD 4HGMA 2E6JA 3IU3A 2FWOB 2IMNA 3F58L 3GMOA 3FFCE 5F7DA 3ROLA 4BKLA 3GJEA 5IWLC 5A2LH 4HUUB 1I4FB 4MAUH 1G0XA 5FUZH 1RY7B 3MRCB 1M71B 1CDIA 4JPIB 1RIUL 5I6XC 4N0FA 5HYJB 1EV2E 2VKXA 4R7NB 3ILPB 4BH8A 4QXGH 5JQHC 4R8WH 5JNYB 1HHHA 1V8HA 1N6UA 3QDGB 4YHKH 5BQ7B 5DMKB 3WLBA 2IJ0C 5AD0A 3QEQA 1XGQA 1S7QA 5JW5A 2EDTA 1K8DA 2E9BA 3NFPA 4HIEA 4K7FA 5AZ2H 2V2TB 1TZIB 4W6YB 3LKPA 2W60A 4HLZG 2O5YL 3HI1A 1EPFA 1LNUB 4FFVD 4KJPD 4LP5A 1VADA 5FYKD 3R0NA 3D3VD 1NGXB 3G6JF 4S11A 3EZ8A 4MB5A 1A1OA 1LO0H 1AQDA 3GSOB 1R24A 1JGDA 3X11B 4DEPC 2VE6A 3LV3B 1AC6A 1KTDB 5GRYA 3VFNA 2DS4A 4U33A 3UTSA 2BCKA 5ANMA 2EO1A 3BEWA 3PWUA 5GSVB 1FC2D 2HJLA 4RGOH 4K3JL 1HKFA 1IGIH 3STLB 1HXMA 5F9WC 2P5WE 1CGWA 1Q9WB 5E8EA 4D3CL 3M1BA 4LPTA 5DVOA 1OSZA 4YHZL 3EYSL 1MHHB 2VE6B 4WFEE 2DYPA 4XAKD 2X05A 4JM4L 1FAIH 5E2WL 3TV3H 3VCLB 4APQC 3EYQC 4KUCD 4F2MA 3I3BA 1ZLUH 2WIIB 1UFUA 1FIGH 3RJDA 4A2MA 1DVFD 2AJSL 3G6JB 4XX1E 4Y4KD 5EU6D 4YHNB 3I75A 2ERJC 2HT2D 3C5ZC 3UJJL 2CIIB 5BCAA 4KI5C 3MA9H 3KPOB 1U8IA 3TIDB 3BKYH 1FZMA 5E0QA 4P9MH 3D69A 2D7QA 4R7NA 5TQ2L 3MRNA 5D72H 4IOSD 5DJZA 2BC4B 4RBPH 5C08D 2OZ4A 5EOCL 2X6MA 2XKNB 4W6WB 1QR1B 5FM4A 1GGBL 3CCHB 2VJXA 1SYVA 3VH8B 4Y5YB 5HHOD 3V5DB 4B53A 3ABZA 2P5WB 4OT1H 2QSCL 4UTAH 4YR6B 1KCUL 1YDPA 5HVHB 2LTQC 1JZ7A 3H42L 1Q0YH 2H26B 3RWGB 4FFZL 4ZAKD 5TGBA 4M7KL 4R7DB 4PJXA 4Z8FH 1RZ7H 3QDGE 4GKNA 1AO7D 4KFZC 1NGQL 2G5BB 4G42A 4I5BA 1J05A 3NIFE 1JYNA 4NN7B 3OG6B 2NY7H 4UMGA 4TTDC 1J1OH 4GXUN 4PJ8C 1EUUA 2D7PA 3BP7A 3C8KB 4X4YB 1ZTXH 5JHDE 4O9HL 1JF5A 1PG7L 2EDNA 1JBJA 4I48B 1X4XA 4GT7A 5CIPH 2OQJB 2OI9C 4JKKA 1JPSH 3ZKQD 4NQCB 4HW6A 4JVUA 5A2FA 4NKIL 3HA0A 4L9LA 1CGVA 5DDHA 1NJ9A 4X6EB 4JFYB 2E7HA 1DE4B 4M02A 1AO7A 5EA0H 2PF6A 4HF5H 5I76B 4GKNB 1Q1JL 5CHNA 5TPWL 5HHVL 4MDJA 1NCBL 5T3ZL 2DLTA 3LH2H 3KPTA 2OR7A 3ULUL 4W81A 4X83A 1KB9K 1KELH 1LE9B 3D2UD 4DUWA 5E08L 3PWJB 1NCAL 1I7ZB 1HCFX 3MBEC 5E94A 5I30L 5I8KH 3MCG1 5D1QC 3JZ7A 3UAJC 3WFZA 5EU6E 2HFEA 5GSVA 4OI7A 2BC4A 3BAEH 3GSUB 4XPFH 4Z7UE 4L8SC 2AK4D 4WCYL 3V8CA 3SDAB 5K9OA 4HIIB 4YXKL 2C4XA 5DVLA 3T2QA 2OZ4H 3VFNB 5FF6A 5HYJD 2Z91A 4ONHB 4WTXA 4R4NC 4BQBA 5CBAB 1MHEB 4ODSH 4HX1A 1NH6A 3HC3L 1MWAL 2CIIA 1D5ZA 1U6AL 4K55A 2NZ9D 5FYKE 1JRHH 2P5WD 3MJ9A 1RUQL 4MVBD 5F1SA 3F7YA 1WITA 1TTGA 4X80H 1GC1L 3V6ZB 2DQJH 2P45B 1CF8L 1UENA 5E1HB 4DOHB 5CBEA 3D39B 4JCLA 3PE9A 1L0QA 1MCHA 5JW5B 4UB0H 3I6GB 1MJUH 4G8GE 5BQ7A 2EDFA 4OLXL 3NTCL 5AYQA 1TLKA 2OK0L 2HT4D 1Z0MA 3QZWG 5IESH 5SWSE 3OJMB 4BUHA 3STLA 4Y4HD 3QNZA 3MA7A 3MREA 2A9NH 4Z77B 4OCSH 3QUZD 2EC8A 2BXYA 2PXYB 4ORGB 4PBWD 2H2PD 1X44A 4MDIB 5TFSH 1ZLSH 3NA9H 2ZNWA 2QR0A 3UTSB 2GTWA 2CO6B 1Z5LA 4FQ2H 3P4OA 2X4TA 5FYKH 1UYWL 1VFBB 4PJ7E 3VDCA 4WFFD 2CSPA 3SCMC 2MFNA 1XZ0B 5DSCB 1AQDB 3GSOA 3LQAH 1Q0YL 3MC0A 2R2EB 5DQJA 3KLAB 1PZUB 2M8XA 1J8KA 1TIUA 1UXSA 5I76A 5AYUH 4ZUVB 4JB9L 2B20A 1BM3H 5DJ6A 5GJSL 4DKDC 1MY7A 1NJ9B 4TSCH 4M7JL 1Y6MR 5I1EH 3BPOC 1E4WH 2AV7A 3FRPA 4K9EL 4LLYB 4KDWA 4AEHH 3GKWH 5A2KH 3Q1SL 3R1GL 2R4RH 3KYKL 3ZYJA 3G5ZA 2YD6A 3PHQA 1F2QA 5BXFA 5E9DB 4J1UB 5GGTH 3VDAA 3LPGA 5CEYA 1CQYA 4NQTA 4XWOD 1JI1A 2OZ4L 3VXRA 1QHPA 2E7LC 4HEPG 3B6SB 4NZUL 4R7DA 1HZHH 4XXDA 3B9KB 5I1HH 4XNXH 1G7PB 4XTRD 5IK3A 4YR6A 3ARQA 1I3RA 1FV1A 4U7MA 2RAMA 1XF2A 1RHHB 1UA6H 3EDKA 4LDLB 4PB9L 1KSRA 3HNSL 4GW1B 4APQB 2C3WA 3V6FA 2MQ3A 5TE4L 2CIKB 4R4ND 2COQA 4H25A 1OGAE 2G9HA 4FRWA 4YUEH 4EUPB 2EECA 4M7ZC 4M61B 1FYTB 5TQ0H 4U1IA 4HKJB 3O3BA 2MNUA 4JGJA 4DGYL 3ZDYF 3KWWA 3G5YA 4LVEA 2AQ1A 4HWNA 5D70H 5JDSB 1WZ1L 4LCWD 4UV4L 4PJAE 1TVHB 1LK2A 5DGRA 5FA3A 1RURH 2BFVL 2K7QA 1T1XA 1LD9A 3FONA 2FIKB 5DUMH 3U82B 3KPSA 2XG4A 4YE4L 1M4KA 4TSBL 2A0LD 2WW8A 4F2MB 1Q9KB 3T0WA 4LLQA 2EDOA 3EYVA 4ZPVA 4MMZC 4WFGD 3T2NH 4I3RH 4HKJA 2G60H 4GRWF 4EQ2A 2R0WH 4P99A 3ARPA 2ICCA 4MAYD 4F57H 3FJTA 1I1AD 2X5PA 1LO4L 3QH3A 3K8KA 1NFKA 5I73B 2CRZA 3FN3A 4OLYL 1IAIH 2PCPB 2X7LA 2DQTL 5KZCB 4Z7NE 1ROWA 1IGJA 4TOYH 1RPQA 2OI9B 3RWDA 4JZOA 1SY6A 5HSFA 5HYQA 4OUUB 2NR6D 3JTSA 5F7HA 4BH7A 5DVKA 1XF3A 3F6LA 3KPRE 1HYSC 3FFCA 4PG2C 1T0PB 1XGQB 3VGAC 1JYVA 1JYWA 4V2BA 2FYYB 4AEEA 3B9VA 5I1JH 5JNYA 1P4BL 5FM5O 3DRTB 1C1EL 1HI6A 3S5LB 1AGDA 2CJUL 3BGAA 4GXUM 3BD4A 5EBLB 3P77A 4YWGH 1OT2A 1M71A 4PLOB 3SCMA 2UYLA 4YJZL 2J8UF 2VR9A 3V7AE 4HIXH 5GIRA 3P73B 1KEMH 5KVGH 5MEQA 1R3HA 4TUOA 1T1WA 1IC7H 1ACYL 1XZ0A 2FWOA 2AEQL 1OTTD 5CEZD 5C0GB 3QDMA 2R4RL 3KYKH 2R15A 3PABA 4WUKL 3D87B 4ODUA 1II4E 3O6LL 3OGOE 1EHAA 3CDCA 5HHXH 3PHOA 2DDQL 3MRPA 1T20A 1IEAB 1NL0H 2UYLB 4PJBE 2Y25A 4RGNC 5EBLA 3LQAL 4PB0L 4Z7VA 3B5HA 2B2XL 3B9DA 2O5YH 3U2SB 4YDJA 1D7FA 2JB5H 3MREB 4X6BA 1BZQK 4GSDH 5FYJL 4I3SH 1RJZB 3WNLA 3JWNC 2AK4E 4UOW0 4D0DB 1OD7A 5I1HL 4ISVA 3RVXC 1MPAH 2Q8AH 1AI1H 3QA3A 5GRWA 3I6GA 3MSPA 1I7RA 4GRWE 1OCWL 3D39A 2EXWC 3FFCB 4PJEE 4LRIA 5E4IA 5J57B 2X4SB 2YZ8A 3SDDB 3NAAH 1BJ1J 4U6XB 4ZFOB 1ODAA 2A6IA 5IHZB 3IDNB 2X9YA 4NWUH 3I6KB 3WSQH 3G04A 3S9DB 3MZGB 5F71A 2XICA 3HZVB 1BFOB 4WW2B 3MOBH 1CD8A 7FABH 1MRCL 1EFXD 3TZVD 5BVPL 5BVPH 3EKCA 3WIHL 1JRHL 1YMMB 3A67L 3M17A 3QDJA 3QH3B 3MBEA 1RAMA 4S0TD 1WBZB 2MQ0A 2W07A 1EJ6A 5HHQB 1YUHA 1XT5A 4MXVF 4OGXL 3RJQB 5E8DH 3GGWB 4G8IA 5EBWA 4X5XB 2EDRA 2NY6B 3LKRB 5JXED 3B4NA 2G2RA 3G5VA 3SDXE 4EIGB 3JWOC 3QULB 5HY9B 1KGCE 3QRGL 3P9WB 3GMRA 4BM7A 1MFBL 3C8HA 4S1RL 5A40E 4ZUUB 5I8KL 1KN2L 4JO1H 2CKBB 2ZSVB 4HQQH 3WXWH 2J5LB 4POUB 1AXSB 2ZZUT 3VXNB 1QBML 1NGZB 1VPOH 4MD5B 1EX0A 5T1MA 3A6OA 4EI5B 1S78D 2OXGA 2FB4L 3MCLL 1R5IB 3RAJL 1YJDC 4CNIB 5DMIL 5ISZE 1ZAGA 3QG7H 4C58B 2HWZH 2EH7L 4X8JB 2F8OA 5IB2A 1A3QA 4YDLB 4XVJL 1JZ6A 4HBQA 5DURD 3U46B 1KG0B 2WQ8A 2XI9A 4APQA 4LKXB 3S36H 4LFHD 1U92A 2O5ZH 1MCKA 2IAMB 1BVLB 5ICYA 4WEMB 1FYTE 4YAQA 3OKMA 4EXKA 4C83A 3NAAL 4BZ1L 1SYVB 4PRDA 3VH8A 3T4YB 1AH1A 1P6FA 4OLWL 1XGPA 1CE1L 3ARGC 4HXBL 2BY1A 2ZG1A 2JJVA 3E6FA 5IHUH 4MD4A 1YY8B 3MRRA 4I77L 1FFNA 3U7YL 4P46B 4LMQE 5FDWB 1UJ3C 3MRNB 5EUKA 5JHLH 4OCXL 1X5GA 4U7KA 1QP1A 2DJUA 5FYJD 4HBCH 1C5CL 2GTZA 4IS6B 3DJ9A 1RUAL 4PV8A 5T1LA 4HH9A 4S10A 1EO5A 2IQAB 2NQCA 3RVTC 5I17A 3KYMA 5TE7H 2FLRT 4MHHG 2NY5C 2A6JA 3T0EB 3G6JA 1MJ7H 2WBJA 4XT1C 3LS4H 3BIAX 2BSSB 3BQUA 4WUUA 3GMLB 3DRQB 4KY1H 3WKMH 1OGAB 3PDDA 2XZCH 4PG9A 5EBGA 3UROR 3C5JB 1X5YA 3BGMB 5I8CB 5DJAB 3CLFH 4LSVH 5CGTA 5DMYA 1ZWIA 3FN0H 4D0CB 2O93L 1YPZA 2I5YL 5C07D 5IB4A 2V2WB 4YH6A 1GOGA 3S4SG 3ULVD 5HDBE 4GH7B 2F9BT 1KOAA 3O6ML 4YHYB 2QKIA 4IJ3C 3OV6A 3PNWB 5IVZA 1F3DJ 5KS9E 1AIFB 5KSBB 1F4YL 1FG2B 4DGVH 1KIRA 1U91A 2RIKA 3EIFA 3VMOA 2EEDA 4KDTC 3QXAB 3SQBA 2BOCB 4S1DD 3HN3A 1X3DA 3AS0A 1UWXH 1QSED 5D96B 1GL4B 4UINH 1MRDH 3GBNH 4JM4H 5E2WH 1OAKH 1WWAX 4GOSA 1MHCB 2PW1A 1EBPA 4JHAH 1AJ7L 4MNHB 3IETB 3MLWL 2DQEL 4JRXD 4NQEA 2W60B 2NYYD 1TTFA 2VL5B 1ZHNB 5GZNC 5GGVY 1I8MB 3TZVC 4UBDC 4OV6F 4OAWA 3UC0H 5FGBA 4LL9A 2A77L 3BKCL 5C0AD 1ZGLP 2A6DB 1A4KA 5GS2H 3RAJH 2NMSA 1FN4B 3B2VL 3UBXI 5K9OB 4IIQB 5ID0A 5T1DL 4Y1AD 1TJGH 5D7IF 1FLRH 4F9PC 3V0WL 1MCLA 1KF9B 4JO1L 5DK2B 1NUDA 1CICD 3MUHL 3G5XB 4R8WL 1MQKH 4LRNL 5EOTA 4RRPA 5F7DB 2P47B 3AVEA 3FOLB 4ZG1A 4M4PA 1IAIM 4M3KB 3RWJB 2PETA 4OZIA 2JK5A 2G75B 4GKOA 3HC0A 3TBTA 3ARFA 4JFYA 4Y19D 4G9FB 2ITCB 5BRZB 1BQHB 1QFWH 4KGLA 2XNAA 5T1KD 3QUZC 1D5MB 1ZGLM 4L9LB 5EIIB 5JZ7D 1ZMYA 2PYFB 3C60D 4NQCA 5IF0B 3O0RH 3TBWA 3KYOB 3MNVA 3PV6A 5MENA 1DQJA 1FVEA 5E6IA 2HVJA 3V0VA 1N0XL 4K94C 2R2HB 2D2OA 3RWFA 3DVGA 3LRSA 3RVWD 1NSNL 1WT5C 3VMPA 1H3PH 3FQUA 3G08B 5GRUL 2BNQA 4YFLI 3W81A 3X13B 1KENL 4AYFA 2EKSA 4HHAA 2VLKB 4NZUH 4OZHA 4DOHE 5AG9A 2YUZA 4F15C 1KACB 1DLFL 1MFCH 2R29L 2ZUSA 4QOKB 3BUYA 3WNOA 1HHGB 2DL2A 4YXLL 3ZT7A 2P5WA 4OFIA 1RI8A 3S36L 4PS4H 4HKBB 4Z0XA 3KDMA 5IOPA 1YYLL 5C86A 2Y36H 5HVWA 1B0GA 1WEJL 4WI3A 2HVKA 5C0RL 1JZ3A 1KYOK 2VZOA 3NFSH 1MSPA 2PKDA 1WTGT 2J5LC 3DVNA 3LRGA 4NO3A 5FUOL 2X4PB 4ODVH 3QR2A 5D7SH 5JHDA 3SE4A 1RZKL 4Y5VC 3K2UH 1U8IB 2VLME 4KPHL 5TPWH 2NY3C 4XNMB 2QBWA 4ODSL 4Y2DC 1GPOL 1IGMH 4UT9H 5CFHA 1LDPL 3PL6C 2EH8H 3OKEB 5FYJU 1A3LH 5D7JC 2XTJD 4P4KD 1KPUB 4TPRL 1TNNA 4TQEL 4P3CL 2BSTB 5SV4A 5DRWB 2APWA 4KK6C 3NPSB 3KPMA 3SPVB 4N0UE 5I75B 3O2DH 1KB5H 2FEEI 4PRBA 1JNLL 3VXSA 2GKIA 5T5NG 1UC6A 4OM0H 3VWJB 2VLKE 1DFBL 3BPNB 2ENSA 2X4QA 3UYOD 5ALBH 3CSYB 4KZEH 3M07A 4V1DB 4NQDD 1WFTA 1KELL 1U93B 2GK2A 5I2IA 4GLRH 3FO0H 3U9PH 5D93C 4D9LH 3DO7B 1A7NH 4R26H 5GPRA 2ZCHH 5DA4A 1JPTL 4XZUB 4QRQB 2VH5H 1UEMA 3HTLX 5GRJL 1LEIA 3X11A 5DD6B 4PV9B 4UIKL 4LOUC 4WWID 3C60C 4ZYKA 5EA0L 2D03H 3ARZA 3PDGA 4ZD3H 1J1XL 3L5XH 1DEEA 1NMCC 5IQ9A 2J6EH 1WICA 5I16B 2ZUVA 3IDJA 4YWGL 1MWAA 3EOBB 5GGRA 3HZMB 1CG9A 1K8DB 3Q48A 4XC1H 2BVQB 2AJSH 2QQNH 1M05B 5DMKA 4F7EB 3P4MA 2IPKA 2DM3A 5L8KB 5ISZA 1I8LC 4A6YB 4E41B 4UI2A 3ILPA 5IBLD 2A73A 3VXMA 3RVUC 5GGTA 5GS0H 1AGEB 4JFQA 4MLIA 4JREC 1MH5A 2NY2D 5D7LB 3VFVB 4NCC1 4NT6B 3LKSA 5F89A 5IB5A 1NCCL 5MERA 4R90L 2P8MA 3H0TB 3HR5B 4Y16D 1FNSL 3R8QA 1CLYL 4EXPX 3PIQB 4LHUA 1JTPA 1E4KA 4PREA 1K5NA 2KKQA 1RIHH 4PJ7F 3BXNA 4UUJB 3QUXD 3ZE0E 2A74B 4QRPA 3W2DH 3V95A 3UTPE 1J5OH 1C1EH 4X6DE 1GVIA 2HTLD 4X4ME 1J8HA 3IRPX 2V7HA 2V9RA 4PYHA 5B39A 4X98B 2GJ6B 1CWVA 3BN9C 4TTDD 3VFTA 4G6JL 3LEYH 2I60H 4EDXA 1CVSC 4L5FL 4Y4FC 3N50A 5D1ZC 4PJBA 3IFNH 4OM1L 5EH1A 3LN4B 2Q76A 1NKRA 2NLJB 4WHYH 4MXWH 3U0TB 5IFJB 5KSUB 5ACMA 3QUXB 2YPLB 1I8KB 5IMMA 3KXFA 4LHUD 1QPPA 3T3ME 4FTVB 3MRMB 1N5YH 1J0ZA 1YYML 3INUL 4NNXB 4WI2A 4UNUA 1UXWA 3GSXA 4I9WE 2NX5B 3SDCD 3FL7A 4PJIF 3DV4B 4YDKH 2YD3A 3CDYA 5D93B 3S98A 4L29A 2EYRB 3D0VB 4G8FB 4WFFE 5D6DC 1Q1JH 3QIWD 1J1XH 3IVKB 5C0BD 2V5YA 4JM2B 4NNYB 2GT9A 1KN4H 4BZYA 5SWSB 3LKQB 2YD5A 5D2LE 1OPGL 5C0NC 5I1DB 1E6OH 1CE6A 1NFDF 5HGGS 2W9DH 3ZTJG 1QA9A 4MQXD 2BMKA 5CSGA 1QO3A 4MD0B 3DHMA 2VDLH 5MENE 2X10A 3GZKA 1OTUD 3W0WE 1QNZH 4XNUH 3FQTA 2CMRL 4FQXC 1J0IA 2EICA 3DI3B 4KRMB 3H9SA 1XH3B 1WBYB 1RZ8A 4PUBH 5D7JA 4P4KC 2X1PA 4C56A 2HP4A 4PP2A 5ICXB 5CEXB 4QRRA 2NY3D 1PQZA 4Q6IB 2Q6WB 1MUJA 3L3OA 4I18B 4A2LA 1FFOA 4GLRI 4YDIH 5JPNB 4DKEH 2VSCA 1Z6JT 1AE6H 2J6EL 3MR9A 3PWLA 2B4CL 3V4VL 2GSIB 2EXYC 3IFOB 3OX8B 2HN7B 2QQNL 3LMJH 4F7MA 1IGIL 3IT8D 2BVTA 1W8NA 2YBRA 4B41A 1QQDA 4PRNB 2BNRE 5F8QC 1NFDB 3K4DA 4AT6A 4MCZB 4NRYB 3U7WL 3W9EA 4ZNEE 4AZ8A 1EAPA 4GBXA 4L8DA 1TZGL 4NQSA 4HT1L 1G7QA 1A0QH 1ZVSB 4LKCB 2VUOA 4LPWA 4ZS7L 5GJTH 2CDFA 4XWOC 4FMFA 2R1YB 3TBVA 4QHMA 3UJJH 1LO5A 4PJ7A 3DTXB 5EO1B 2QHLA 3T65B 2B4CC 3RX5A 3MRJB 5FYKL 3WBDA 3WMSA 5DHYB 1CFNA 1MCSA 3IFLH 2JJTA 2X2YA 2VXTH 3FTGA 2CR3A 3NH7L 3ZE0F 1HQRA 3OKKA 3FZUD 3CX2A 5D1ZD 5GS3A 5L88H 1OP5H 4E0RB 3V6OE 1IARB 3R0MA 2ZCKH 1F4XH 4KV5E 5BV7B 3QUMA 3JUYA 1K2DB 3OTTA 4KHXH 2W0LA 4DZBB 2PO6B 1SMAA 2R1XB 2CH8A 2OTWA 4QLRA 5IT2L 1BBDH 1K4DA 3IU4L 3GMMA 2XTJE 5BZDA 3ULVF 4XH2A 3F58H 1FCGA 1N7MH 1BIIB 3QIWC 3ARSA 4JFDD 5D7IB 1LGVA 3U6RA 1S9WA 4KK8D 4NM8H 4M8QB 1XR8B 4OF5A 2PO6D 3AY4A 2APBA 1ADQA 1S7WB 5F9JA 5JOFA 1IGYB 1GIGH 2VLKD 4NM4H 1ZOXA 3S6CA 3QPQD 3L3KA 3VFUB 5HI5C 2C1PA 4XAWL 2HJKA 3QG6A 1KB5A 1AD9A 1Z9LA 4ORZC 4JPVH 2EDWA 3EOAA 3ZKND 1CDHA 5DVNA 5C1MB 1P7QB 5EC1B 5FFLA 1U8PA 1KJ2H 5IFAL 1RIVH 4HK0B 4X9IA 1DANU 5HTSA 2H9GB 1I1CA 4OM0L 2D0FA 3JWOL 5FUCE 1DN2A 4PJFF 3MV9B 4PJ5B 4WEUD 4XRCB 2DQDL 4H8WH 1MI5B 2DMBA 3EZJB 1WZMA 3RDTB 2B0SL 4JKLA 3MFFA 5DRZB 4DZ8A 4OGYH 1SJEA 4WFHE 5KVGL 4NRZA 3HE7D 3MV7A 4TVPD 4X7TB 3BIBX 2V6HA 3VXSE 5CWSB 3OB8A 1VDGA 3OKDA 5HHNB 2R56L 4PTUA 4IRSA 4GRMB 4G9DA 4S2SA 3F6IA 1EFQA 1RK1A 1L9NA 3O9WB 2ZWLT 4TYUA 1XGTA 3E2HC 4LHUG 4P59L 5C6WH 1FSKC 4NO5A 4QRUA 3VWJC 3D3VE 2P24A 3UJIH 1NBZB 1H8SA 4NBXB 5HI5D 5FV1L 4K8RC 1VESA 3BT2L 4PJFE 3SKOB 2FIRT 1WLHA 1HHIB 1U3JA 1WK0A 3CZJA 4P2RA 2DLFH 2W65B 2X1OA 3LN9A 3B8SA 1MFEL 3S3SA 5KW9L 3NIGF 1J10A 2FLBT 4HCRL 4HZLA 3L7EA 1ZHLB 1N7ML 3IKCB 1T5WA 3AXLA 1IGTA 2L4OA 3FQXA 4WWKA 5CZVL 4GFTB 2HFFB 43C9B 3CDGA 3OAZH 4KJYB 4HT1H 5ESQB 4J4PC 4IDLA 2J12B 1A3RL 1E4XI 4HULB 1QKZL 3K4ZA 1Z0NA 3WEXB 1BVZA 1W0VB 3GHBL 2GJZA 5ADOL 5FUCC 2AI0H 3BWAA 3TNMA 1OSPH 4K8RL 4ETQB 3H7BB 3SGJC 2QL1A 3PWPD 2H1PH 4YBLB 5HBBA 3DYOA 3L3GB 5DJCB 1CGUA 4U6HB 5HVHC 2SEBA 4H20L 3RDTC 1WCQA 2WV3A 4OLEA 2CLVB 2WLZA 4YO0B 1AC0A 4ZQKA 3LD8C 1QVOA 1VACA 5F88A 1D6VL 4ESKA 2VDOH 3MUY1 2X4OA 2YSSB 2YRLA 4UTBL 5FO7A 4O4YH 4L1HA 5CJOH 1XCTA 1F02I 4QY8B 5SWZB 5SWZE 4JFPA 1NAKL 3VRIB 3UXFA 1IGML 2R9HC 4UT9L 1XCQA 2EDXA 4DN3L 2RGSA 1DJSA 3LEXB 1T66D 2Y7QA 4BSVB 3IJSA 1A2YB 4ODXB 1A9BA 5EZJB 5GSRB 3DMMA 2JJTC 1QLFA 3P9LA 3SDDC 1UACL 2WWKO 1X5FA 1MRFH 4XNQA 3TA3D 4EN3A 1OAKL 3OXSB 4LCUB 4A6YH 2HA1A 4DQOL 4K2UL 4YHPA 2AV1A 4IMKC 2H32A 1NCDH 2FHFA 1NAMB 3QCVH 3VXQA 4Q0XL 4NN6B 3BDYH 3TP4A 3ULUC 5GSRA 3NCYS 3I3EA 1A1MB 5DJ2A 1EA9C 5B4MD 2Y7QB 2MHAB 2OP4L 1CFQB 4WV1A 3T0XA 1IZKA 1PX3A 1BF8A 2NY1C 2D7MA 1I9JH 5C08B 5DEGB 4H26B 1CFSB 1G6VK 3KPSE 2A1WL 1NGWA 2B1AL 3BEVB 2XTLA 4ZO9A 2CXKA 1G7HB 4PJAA 2E7BA 4Z7WA 2CLVA 3CSBA 2FL5A 4K3JH 3NACL 4I8DA 2FBOJ 3LMJL 5LWYL 5KOVC 2SEBB 4O2CA 1QD0A 4CVXA 4LF3B 1PW3A 2D31A 4PGDA 4WU7B 3IDGB 4XP4L 1RU9H 3L1OH 2Z31B 4NO0D 4YX2H 1PFCA 3FB8B 1SBSH 5DA0B 3T8XA 3QEHA 4OD2B 3PHSA 3FQRA 3SO3B 4RQQB 4EDWL 5KJRL 5JXAL 3HUJB 3W9DA 4F3FA 1OAZH 3O2VH 1KJ3H 2YPKA 1OAQH 4WUUE 3DARA 3QT2A 3O6MH 5DJDA 2CLRA 5D2NE 1FL6B 4NNPH 4UT7H 5B4MC 2H1PL 2Y4SA 2R0KH 4R96B 1J0KA 3QEUB 4WTWA 2YPVH 4G6MH 1YMMD 4LEXH 3OR7A 5IW6B 4QEGA 4LLWB 3OR6B 2AK4A 1LILA 5INDA 1H3UA 4KAQL 5KN5A 3UDWC 2UUDK 4K71B 3VD3A 1KLGA 3S88L 4FQLL 4MJIE 3ARDB 5H35B 3CFIC 4TUJB 2VISB 1KCLA 5C9JA 2ENYA 3U1SH 2O5ZL 4GG8B 4PYGA 4WI8A 4L3CA 4NO5B 3SDDD 5GGUA 5HVGB 1NANI 4PY8J 1YYLH 4S2SB 4BJLA 2DWEA 3TA3C 4KTEH 5AG8A 4EN3C 3N9GL 1IAKA 1KIUA 1O7VA 2VN7A 3VFPB 2FNBA 5MHSE 5CWSA 4XVSH 2AVGA 1FNGB 1RUKL 2GUOB 5FYKU 1AFVH 3MRGB 3TYGH 5T5FH 5T5FL 4JPKL 1DL7L 5D6CB 1NBVH 5T3XL 1S7UA 4UDUA 2F19L 3A6BH 1O5DT 3QUZA 4F37K 3F12B 3RKDD 5CGMA 3TCXA 1CU4L 1G7IB 3VG9C 5K59E 5DZNA 1CK0H 1JMZA 4U6YA 1QPXA 3DX8B 2H2PC 3STZB 2GCYA 2PTTB 2R2BB 4Z6AT 4XCCL 3MYJB 5HJ3A 2XY2A 3QXUA 4QXTB 2W9EL 4FXKB 4ZTPH 2W9EH 4BQ9A 5DJXB 1BVKB 2CKBH 1U42A 4UILH 3NFSL 4WHDA 5DRXA 1DCLA 3ECBA 3L3KB 1FLTX 3KPPA 3AM8C 2B1HH 2R2CA 4H88L 3P30H 4OGYL 5BW7A 3VFMA 5GGSB 1C5DB 5FGRA 2KUTA 5CJBA 4ODBD 4ZTOH 4AH2B 3CFKA 5CD3B 4WHTA 4P2QA 5J1TC 1FJ1B 4GKSA 1HYSD 4Y5XB 4LIQH 4POZC 1C12B 3BUTA 4JO4L 4OZGA 5EU5B 4UIMA 3IJHB 4X7EC 5IM7A 3QUMB 1OOAA 1D5IH 3C87A 4K7PH 5GRVL 2BK8A 4TVSa 3HPLB 3W39B 3QQ4A 5C0FA 4WENB 3U9UB 3GIZL 3RWEB 4XCEA 3B43A 2GI7A 3R4DA 4LP4A 3QJFB 1RURL 2BFVH 4AJ0A 5HHMB 5C8JB 1NQBA 3QIBB 1I75A 4QHMB 4TRPL 3ZDYE 1JN6A 1SJHA 2E7LA 4FQQA 2RFXB 4PJGB 3UTTD 3DOSA 3GSNH 4IRJA 2XYCA 4ZSOA 1J11A 5J9PA 3RBSA 4LCCB 3BZEA 1TQCB 4BFIB 1AHWB 5ERWB 1LMKA 2JCCB 2YBRB 4JJHA 5SX5H 3O3UN 1W0WA 2HFGH 4LCWE 4WO4A 1VEOA 1OAYH 3RUGF 5ESAA 3QFJD 5F6HI 1Y6NR 3DETD 3OX8A 1UKSA 3HCVA 4N1HB 5T3XE 1AD0A 4G7YL 5LVEA 1TZGH 4RAUB 1AGFA 4XVUD 1U2HA 4Q74A 1OGAD 5KJRH 3O11B 3ZKMD 5EDXA 1VFUA 4QYOA 4R97B 5DJ0B 1BBDL 2GITB 1CGSL 1VFAA 2HTKC 3O0RL 2XN9B 1A6VL 1Q94A 3WN5B 2X89D 4C56B 3IXAA 5CGYC 5D8JH 4L4TA 2NPLX 1XH3A 3FAXA 3OAZK 3MJ7A 4N0RA 4JY5L 5C09D 4WHTB 4P9ML 2AXJA 3DV6A 4C56D 4X0KB 3BESR 3RY4A 5KS9F 2X70A 1LK3H 2BMKB 3RL1B 1C16B 4CN4A 4YPGB 3GBNL 4KK9C 1IKFH 4I77H 3ZYZA 1E28A 2CUHA 4Y1AE 3SKUD 1SJVA 1ED3A 4NSKA 2P8PA 4QXTA 1E28B 2ITDB 4OCRL 3TO4C 2GSGB 3ZTNH 2JTDA 3REWB 4JRYA 4PJHF 5IVNA 2EYRA 4L29B 4OM1H 4YBHA 4CMMB 3DV4A 1MJ8L 2OJEA 4KC3B 5DHVB 2NX5A 1UKQA 4P5TA 3TVMC 5E9DE 1V7NL 5FUZL 3WHE0 2YPLA 3MUZ1 1T89A 3U0TA 1MLCA 4CMHB 2VOTA 3M8OL 3HG1A 4NDMB 1X5KA 1UACH 4BZ2L 3LKNB 1FL3A 1FDLH 4JJ5A 4RNRB 2MPAH 3L95A 1TQBB 3O41B 1MHPH 4KKAD 3MYZA 2Z92B 4MSWB 3ZE1E 1OAUL 1P4IL 4U05A 3FHAA 3CMGA 5E70A 1FNSH 4Z7UB 2K3TA 3MLWH 4DVRL 2C1OA 3H9HB 4YHMH 4DK6A 1CLZL 2VABA 4XB8A 4DGVL 3MACH 3RZCA 5DYOA 2PN5A 4HCRH 3OAUH 4PJIE 1LE5B 1DN0B 4FQCL 4R3SA 4FMKA 4PJHE 5HGAA 1QFOA 2VMFA 3CUPA 3QI9A 5ETUA 5E1AB 1C7TA 3BP4B 4CJ1A 1IVLA 2GIYA 3UBXB 1T7YA 4LCCA 5EBMB 5DI8B 3QNXA 3U4EA 1T0NB 5T1DH 5F7MC 4WCYH 3CLFL 1FNEA 3WIIH 4M9OA 3MOAH 4J6RH 1FFQA 5D71H 4CGTA 2DQIH 3ARGA 3OR7B 1WZKA 2O5XL 3RIAF 2HFTA 4U0QB 5EFIB 4LLMA 4WRLA 5FHAH 2R56H 5SX4H 1NEUA 3H9YA 3EDJA 1AGCA 3RZCD 3VXUB 1NDGB 4EVNA 5MEOB 3PJSB 3WHE1 1UJ3B 5IV2B 5EZLB 3LAFA 3PXJA 1QKZH 1F6LL 3U9UA 2Q3ZA 3ZHLA 1EEYB 5DZLA 1CD1B 4LQFL 3W39A 1MRCH 1UM4L 5I16A 2OL3A 5IMOB 3T8XB 4MJ5A 4LCCC 3VXUA 1KNOA 5MP6L 1A1NB 1R3LB 4M62H 4PRHD 2V17H 4PV9A 1CFTA 4FHBD 4LF3A 4CVXB 3WXWL 2L7UA 1F5WA 4BZ1H 4JQIL 1YN7A 5E5UB 2Q7YB 1CR9H 5HDQL 1E4XH 2NW3A 2YKLL 1G7HA 4OTXL 1G0YR 2AJ3A 3DYPA 2BVOB 4D2NA 4TRPH 3U4EB 3P11H 3VFMB 5I2IB 5DI8A 2JE8A 4U3CA 4PP1C 3Q5YA 4KPHH 1A02N 2M26A 1V7MH 2DKSA 4PJEB 3HE7A 1BD2A 2KL6A 4K8RH 2IQ9H 5DHVH 4BSWA 5BOPA 1CLYH 4YFDB 5I9QC 1A4JB 4U3XA 3RZCB 3HMXA 3QXDB 5IWLA 1RQ5A 1YJDH 5HHXL 3RIFK 5I66A 3QUXC 1XF4A 3C5ZB 4TSAH 3IKKA 1J0YA 2EH7H 2VZSA 4U1KB 2DQDH 1FO0L 3QUKB 1FGVL 4HXAL 5E7FA 3VFOA 5BVJB 1L4IA 3F12A 2B5IB 5ABDE 2BNRD 4ODWB 2YD8A 2ESVE 4HLJA 5F1IB 5CJOL 4Z95L 4NP4H 4ZAKB 5KVMC 5JHDB 3MX0A 1P1ZA 1OM3H 1XGUB 5EO9A 4LARL 1BJ8A 1W0YT 3L3JA 1IAKB 4MZ2A 4W70A 4G5ZH 2GSGA 3OXRA 2VXTL 3RGVD 4NSKB 3GJFH 3EO0A 4LVHC 2Q86A 1NFDE 4M48L 5KG9A 1D3CA 3MPCA 3SOBL 3S37L 4FQXA 4RMWA 3SGDI 1AHWC 2P7TA 1CXFA 43CAA 1T2QL 3LN5A 4LEOB 1N59B 2H3NB 4CU7A 5FCUH 3HNTL 1DUYA 2DBLH 1WFUA 2BNQB 1CL7H 4RA3A 4E9LA 3LRSB 1H15B 1TETH 4GQ9L 3RHWF 3OZ9H 4Y4KB 1MIEL 5EU6B 5M94B 3U30B 1SY6H 4CDGC 1YMHA 4DJMA 1KLUA 1XGYL 4NQDB 3D0LB 4NWUL 3FT4B 3QIUA 2I27N 3QQ9C 3WN5C 1KGCD 4KRPD 4N8CH 2PYFA 1HINL 4CAGA 2BSRB 1JCKA 4WFED 1QRNE 3MGOA 5I6XB 5INCA 3O3EA 4DCQB 2FO4B 2F8VA 1RMFH 1M7DA 2WLYA 4ZTOL 3MJ8A 1Q9LA 1QRKA 5DC4B 2IG2H 43C9A 2ZOLA 3C9NB 4LRNH 3VFWB 3TT1H 2LVCA 2OR8A 4GS7C 1MVUA 1H15A 1FZKB 3BZEB 2AJVH 3BP6B 5DO2D 4S1DC 5DT1H 1W72L 1MAMH 4KWUA 2WNGA 3MV8B 5L2KB 4YX2L 3U7WH 2H3NA 4RA0C 4I2XA 5JLZB 2ZNXA 43CAB 1MFAL 4FQXB 1V3MA 2PO6C 5FEBA 3U1SL 1I3VA 1PVHA 3D3VB 2DIAA 4K9EC 3VI4E 2YXMA 4AM0A 1N6VA 4NQED 1XGTB 1CIUA 5JOPD 3NVQA 4XCEB 3K80A 5D5MA 1WCBA 2BRRL 4AG4H 4ZUTA 1AXTL 4DW2L 5C0FB 2FATH 1L0XA 4PJXE 4OAWB 4XHQA 4RFOH 1XGUA 4YDKL 1RUKH 3IRZA 1MFDH 3VXQB 4N5UA 3NCMA 3NOIA 3V0WH 3QXTA 4JFEA 2AV1B 5CEZL 4WI6A 5FYLD 4JQVC 1PZ5B 4Y2DA 3QUKA 4WU5A 1YNLH 5TF1H 5E9DD 4F80A 4U1KA 4Y5XA 5K9QG 2H9GA 3HZYB 3GI8L 4RBPK 1XF4B 4G6KH 2I9TB 4ZXBC 3FRUB 4LRIC 3U4AA 1IJ9A 2EIZA 4G8GB 1P7QA 3GUTB 1A4JA 1U8JA 2R69H 4Z76A 1PEZA 5C0EB 5E8OA 4U1LB 4GAJL 4YQXL 4NWTH 4WFHD 3VJ6A 1KB5B 4FS0A 4QF1A 1U8QB 5IB4B 2R0ZH 2YN3A 1B9ZA 2MPAL 5E8OB 2WWMD 2AEIT 3R8BB 1X4ZA 1KBGL 4MWFA 5DJAA 3TNNA 4Y2DD 2R2BA 1ADQL 4PGBA 1F2XK 1K85A 5HYSG 5AZ2L 4URTB 5TDNA 4PJ8D 2DOCA 1NLDH 5IEHA 1PZ5A 4Y2DB 1MJ8H 3EUUA 4NQVB 2DWDA 5IB1A 4M43H 1CXLA 3Q6FB 4NC2B 3MNZA 4YDVB 2J1KA 4MNQD 1KTRL 4HUKB 1X5IA 4PJDA 2AJXH 3TBYA 1UZ6E 1T6VN 1T4KB 3V4PL 4DGYH 2FEDC 5KSVA 1YY8A 4MA8L 4G6JH 3SKJH 3EGSA 5C0DA 3D2UA 4ZOBA 4LVNB 4H8WC 3AC0A 4PY8I 2YEZB 3O9WD 1INEH 3S35H 3S3JA 3ULUF 3EYFA 4TVPL 3ZDZE 5GGUB 1H5BB 3QHZH 3SE8H 5FHBL 4JN1H 1DQQA 2FB4H 3MCLH 4LLMB 1JI2A 3ARTA 1GC1H 3DTXA 4PRIE 3D3VA 5LAXA 3ZKXC 3RFZC 5D1QA 4TUJA 1YQVH 1HSBA 1Y6KR 1OWRM 2W65A 4I3RL 3CFCL 3OB0H 5E8NB 3EYUL 3QNXB 3OR6A 5IEKB 4Z0BH 1UQSB 2IG2L 3W9EB 1FL5B 2XY1A 1XR9B 5LAXB 3UZQA 3DUSA 1MVUB 1P9MC 4Q9BA 4R96A 4JDVB 3SHSA 2ZOLB 3C9NA 1DN0A 3IDIB 1NFIA 1RK1B 4QGTA 3MBXH 4ELME 5IBLC 2ATKA 2BHUA 2C1OB 1L6XA 2V5TA 2GSIA 1M6OB 3MGOB 4FFYH 4ZMAT 2DLGA 3O41A 1EO8L 1JNNH 4PJDB 4UIKH 2R0ZL 1SJEB 3SKNA 4Z5RA 4JM2F 4Y4HA 4YDVA 3FB8A 3H8NA 2XQBL 2XKUA 2AI0L 4Y4KA 5EU6A 1MLCB 5H8DA 2VXQH 5CEXA 3Q3GA 4PGDB 1QSFD 5D7JB 4J3XA 4NZDA 1ORSA 3QZWA 4F58H 5TF0A 5B21A 4Z7OF 2FL5B 1JHKH 4HK0A 3GI8H 2XV6B 3ARWA 3BEVA 4ZDHA 5B3JE 2P7TB 3B5TA 5IHBA 1S78C 1WEJH 3MBEB 3LKQA 5I1DA 1ZKAA 1ED3B 3GJFA 2LVEA 4JFOA 2ADIA 3IVKA 3OXRB 1S7RA 1ZVYA 2C1PB 4U2ZA 2J4WH 3MXWH 3WUWG 5SX5K 4G7VH 5DHXB 1BFOA 2MHAA 1NC2D 1S7VA 1EZVX 1EERB 1HOCB 3Q1SH 3R1GH 3GRWA 2R9HD 3IS0X 4MQTB 4PJDF 3VXMD 1TVBA 9CGTA 2BRRH 1S9WB 4XCYB 3QWQB 5HHOB 2E6PA 1CGXA 1T21B 4N0YH 5FYLE 5BZDB 1T1YB 1TJIH 1TXKA 3LQAC 4TSAL 4XX1G 2B2XH 4RGNE 3UTTB 4PB0H 1P7HL 3MLXH 3VFSA 1QYGH 3QB7C 3RQ3A 1AGFB 5CSZB 2APVA 3FMGL 3RGVB 1OAXL 1LWRA 3DO3A 1P4IH 2IQ9L 1B0WA 3KPLA 3QIBD 3SKJL 2D4FA 4KVNH 4WI9A 5E5RB 3IJSB 3K3QA 3ZT5A 4DFIA 4J3WA 1BX2B 4L9LC 4BFIA 4NQUA 4BUGA 3UX9B 3QFJA 4ODUB 3AU1A 5C0ND 4X9BA 5C2BH 1YEJH 2WK2A 4JGMA 1WISA 4UV7L 4XTRC 5I71B 5JIIA 4PJEF 1QHOA 5K9KA 3NZHL 4H0GA 4I13B 3V5HB 2IMMA 3WIIL 4LSPL 2MSPA 5EORL 3V5KA 1J0HA 1UB5B 2MKWA 3SCMB 3LPFA 2HT2C 3C5ZD 3IB4A 3QIBA 1A1NA 1R3LA 3V8OA 2XZQH 5C8JA 1FZOB 3SE9L 2ZG3A 4HFUL 4AK1A 1CI5A 5JOPE 4Y89A 3DBXA 3K8LA 1A7PL 2FYYA 3VI3F 4LSQL 4RIRB 3F5WA 1RK0A 2VLRA 3O3EB 1KLFA 3SN6N 4MA1C 5F7NC 2OCFD 4Z7NF 1VGEL 3KPRD 3MO1A 3RNKB 5IQ9B 5D72L 3TLRA 4NZTH 3OBAA 4QHNB 2W9LA 4MA8H 4OGAC 1AGCB 2Y9RT 4OIBA 4J6RL 5LXGL 4JZOB 4L1DA 2X44D 2HJFA 2LTQB 1AE6L 1MCWM 3MUJA 4PP2B 4PRHB 1MQKL 1G1CA 1JPFA 1E4XL 3H9SB 5T3XD 5A16A 1ZLUK 3FQTB 4MJID 3ZKNC 3IGAB 1C5DA 1HEZB 3TYFA 5FO8B 3AB0B 1I7TB 1QO3B 4IOIB 3PP4H 1TJGL 4MD0A 1OF2A 4LBEB 5DD1H 5EBMA 4NHCL 1IGCH 2VLRD 1KCRH 3ESVF 3ECBB 4JZJC 4ZD3L 5EZOL 3KPRA 3CUPB 5ETUB 4HKZB 4NQXB 5C0IA 4XCFL 3MUGA 4PJCA 5KOMC 4K2UH 1OY3B 1BLNB 2VWEE 2X4QB 3GK8H 1LE5A 4JFEE 3EFFA 3TEUA 2VABB 3SQOL 4ONFH 1ITBB 4LSDA 2YRPA 3L3JB 4M5YL 4HWBA 2YHGA 1VSCA 4EJ1C 4F7TB 3GFUA 5ACZA 1UXWB 2P46B 1BPVA 5FO9B 4P48A 1QFWM 3FONB 4OZIF 4G7YH 3LRHA 5KSUA 3CX5J 5EUOB 3NH7H 4NC1E 2DM2A 3I02A 3I9GL 4HXBH 4PBXA 3EOTH 4KJQD 2DM4A 3MRGA 3L6FA 5D9SB 3DVNB 4MXWL 1RSFA 3Q6GL 1LQSR 5DHVA 3FB7A 5I1CL 2BNQE 4I0PA 4CMMA 4O2EB 3QDMD 4NYLA 1NCDL 3Q0HA 2X4RB 5HYEA 1JGUL 3QCUL 4FQJL 3WUWB 1F8TH 2A74A 4BSWB 2CPCA 3HE7B 2CMRH 1BOGA 1MRFL 2VIRA 4GG8A 1HHGA 4LHJB 3WKML 5LGKA 4LBEA 2AKRB 4L8CB 3B9KA 5DK3A 4NZTL 4GRLD 5CIPA 1MCEA 1E6OL 4ODVL 3BN3B 5D7SL 5KZCD 1R3KA 4PJ5D 5DMGD 3P30L 4H88H 3U6RB 3ES6A 3EJJX 5CUSH 3VFVA 5JOEA 4D9LL 1WWCA 4AQ1B 1W2KT 2XZAH 2Y36L 1UVQA 5FHAL 3ARBA 3LQMA 2OTWB 4MVBC 4RGMB 3E0GA 4LAQH 2F54D 4P23D 3OWEA 2R1XA 5EUOE 3SY0B 4JAMA 2VXSH 4NN7C 3RY5A 1K2DA 1OW0A 1IGCL 3D1MC 5ELIA 4Q9CA 4KQ3H 2XNAB 4RIRA 4G9FA 1EEYA 3ARFB 5IESL 3EFDL 4Y88A 3NGBB 3GIVA 4S0SD 4XC1L 1E6JL 2G75A 4Y4HC 5MP6H 1INQB 3BPCB 4NN6C 4OGXH 4ZAKC 1QSVA 4FQIL 2XN9D 1T2JA 1LO5B 4PJ7B 4Q6IC 1LEIB 3MRLB 1Z5LB 2BOBB 2AXHA 3V5KB 4HG4K 4ELMA 4OV5A 1HSAB 4JQXC 5B22A 5L8JB 1VGEH 4GW5B 5BO1L 4YXHL 3GMNB 1P84K 1T7XA 5HI4D 4HCRA 3MODH 4BZ2H 1ZT7B 1XIWD 4MCZA 4IOFC 4MS8C 3O6KL 2XQBH 4V1DE 3P0GB 1RUMH 3QJFA 3WIHH 3WFHB 4FQLH 4TSCL 1QBMH 3VWKB 4J23A 2XZQL 4Y5VA 2HKFH 4Q97A 5F6HJ 2LAGB 2HN7A 4IRSD 5EOQL 3VXSB 3MROA 4ZS6C 5C6PB 1QFPA 2VL5A 2QJDA 3PL6B 1RZGB 4IDJL 4KTDH 1JHLH 2AEWA 5CSZA 2FO1A 4M5ZL 1CR9L 2F58H 3L95B 4YHPB 3FB5A 1FGVH 2YZ1A 2H8PA 4BK4A 4GG6F 5FM8A 2VXVL 4Q6IA 3C2AL 3CC5B 4L3EE 4EQ3A 1FZJB 1A22B 3JSSA 4RMVA 1VFMA 3JV5A 2XOTA 3JWDC 2BHZA 1RZ8B 4EIZC 2KBGA 3LKOB 3SDAA 1NKOA 1QLFB 2HTLC 2N4IA 2V9QA 2WAHA 15C8H 1JK8B 1A9BB 1YC8A 5D8JL 4BSVA 2NY1B 2HVKB 1NAMH 3BPLB 1ZHKA 3PWPB 4TVPE 1YPZF 3H2WA 5DUBA 1CE6B 3BW9A 3GMPA 4HPYL 1C7SA 4JFOB 5DWUH 5I74C 4EBQH 4JM2A 5I1IL 2FECI 4Q9RL 3DGGB 1XIWC 3LSOA 4IMLA 4PLNC 2X4OB 2YSSA 2ERJB 3C5JA 4XGZB 3ULSA 3UTZB 3DRQA 5ITFA 4XCNB 3UMTA 1ORSB 1VEMA 3QZWB 1U8LB 5DJ8B 5C09E 2F5AL 4FTVA 4O5LL 2ZOKB 4L4TB 3L3GA 1U8NB 1A64A 3MLSH 5J6GA 5JO5A 3WN5A 3H42H 1BQUA 2PXYD 1JRHI 2ZSWB 3DVGB 4OGZA 5LGJB 2HT4C 4KRNA 1EEUA 4U31A 4IS6A 5E6IB 1BREA 1NUGA 1SM3L 2JCCF 2OP4H 1G0DA 5DJ0A 4Y4HB 1XF5B 4LAQL 1KT2A 3CU1A 4QHKJ 1L7TH 1JF6A 4EDXB 2XA8L 5IIEB 1Z3GH 4PBVC 5SX4I 1FFNB 4LSVL 1V3KA 3VMNA 1WWBX 1BECA 2B1HL 3HS0B 1IM9B 3U0PB 2D0GA 2DWEB 3D39D 5ESQA 5D5ME 1T2QH 5B3NA 3NCYP 1RUQH 2G5BA 4PLKC 1P5VA 2NY1D 4FTVD 4YGAB 4ELKA 1HIMH 3QEQE 3GJFK 5AAMA 5J9PB 3FOLA 4M43L 4WW1B 3CCHA 4KXZI 2CRIA 5F1NA 5E2VH 3TA3A 1HSBB 4EN3D 3TZVA 4YFEA 2AJUH 2AJXL 3MRDB 4HC1H 2X42A 5J4MA 2IH3A 4JDZB 1FBIH 3D85A 4KK5D 4JKPL 2CDEA 6FABH 1FN4A 1T0MB 3VG0H 3BGFB 3G6AA 1P7QD 3KPOA 4PTUB 3D2UB 1NGZA 3QQ4B 2DICA 1YNTA 4NIKB 5EC2A 3WS3B 3O8XB 3WXVH 5MEPA 2CKBA 2I07B 3RPIB 5K93A 5ENWA 3IDJB 7CGTA 4FABL 3QEHB 4Y1AA 4ZOAA 2MWCA 5AAWA 1UB6B 3CH1A 1UM4H 3K2MC 4M6OL 2X4UA 3B8YA 3CK0L 4PJ9D 4JE4B 1C12A 3GK8L 1KCSH 1KN4L 4P57A 3WFEL 1QFUL 5IEHB 1RUPL 1OB1B 4P2YA 4NGHL 2DQEH 4Q6YA 5C0JA 4HIXL 4XPHH 1FHGA 5B38A 1FNFA 5T5NF 3T0ED 5BJTB 4E41D 1F4WL 1A6WH 2P5EE 4H26A 3GSNB 1H3XA 4IIQC 3B2UC 4OLUH 5E56A 1AD9B 2FDBP 2HJKB 4K3DL 3CSYA 4S1RH 4UOW1 4AENB 5K9JL 4Z76B 5LXGH 2EIZB 4HV8A 4OI9A 4PG9B 3PQYA 5GQBA 1WAAA 4DQOH 1OLLA 2I9TA 1OP3K 2Z8WC 1GGBH 2AW2A 4U6YB 3ZE1F 1D9KA 3FQNB 4L3ED 5F7KC 1K4DB 1NUNB 5I75C 3NFPB 4K7FB 3LS4L 4TNVF 3WLBB 3QDGA 4Z7OE 4ISVB 3PGFH 5F1OB 3H3BC 3TCLB 5EUKB 4XCFH 1MCDA 1OGTA 1FNGA 1CXHA 1J88A 4QTHA 1JF1A 4ODXA 1IBGL 1A7OH 5JW3H 4LVNC 1T6WA 1HK6A 1T5XA 2Z9TA 5F8RC 1I9RL 4OFKA 1S9XB 1N5AB 3IFPB 1DQTA 1YYMH 5E4EC 3PABB 1N5YL 4QY8A 4ONGH 3BQUD 4WUUD 5LBSH 4NOBA 5M95B 5EIVA 3KR3H 3OAUL 5IMKA 2NW2A 3AREA 3BUYB 4G6FD 4YAQB 4DVBB 1I1FB 1IAOA 3EOTL 1IC4H 1H3GA 4HS3A 5FYJH 4NQSB 5ID1B 3CK0H 1KG0A 3U46A 4A6YL 5I8EB 2AXGA 1BFSA 3LZFH 3EO9L 3QPQC 2R2HA 5E4EB 1D5XB 1DQJB 3VD5A 4QO1A 2A38A 3H7BA 3ZDXE 5DQDH 1R5IA 4MA3A 1URLA 3TGXA 3MLTB 4CVZB 1CZ8H 1H0DB 3IFOA 5EIIA 2NCMA 4PRAB 2XWBA 2BSRA 3JTSB 4KZEL 1BZ9B 4Q9QL 1K4CA 2XN9E 4OIIL 2AXFA 1KLUB 4NQDA 3RZWA 1I9JL 4NQDE 1DVFA 3WHXB 4M1GL 3RWDB 3CVHA 4PY7B 1KJ2B 3WIHA 3HC3H 4ZO6A 4OZIB 4HZLB 1UCBL 1WBYA 4JPVL 1MCJA 4YHKL 4X9GA 4TQEH 5F6IB 2Y6SD 1WUNT 2DQHL 4XNYH 4X5XA 3F7PC 1KJ2L 4OFPA 2IALB 1J0JA 4KRLB 3VGHA 1JNLH 3ZLQC 1CGTA 2HLAB 1B4RA 1WBZA 1JV5A 3N9GH 1S7XA 1U8MA 2GT9B 2ED8A 4Z0BL 4ODHL 4U2YA 3MZTA 3KJ4C 4HK3N 4IIQA 5F9AC 1D9KC 4OZHF 1V3JA 1NUFA 1CFQA 1RZKC 1G9NL 2J7LA 2NXYC 5JHLL 5J3HD 1AQKL 5IHZA 2A6KA 3T77B 2HRPH 3FT3A 3MV7E 4N8PA 4X4MA 1NAMA 3WLWD 1NMAL 4HIJA 2FJGB 1X6NA 2H32B 4PGCB 4PGJA 2XWTB 2GYSA 4KKCD 2HTKD 2AEPL 1IGFL 3EDEA 5T1KA 3GO1L 1I7RB 1IM9D 3C08H 4P5KA 3O3BB 4EOWH 1F4XL 1F3RB 2DM7A 3BT2H 3C5ZA 5CILH 1Q0XL 4C4KO 2J88L 3RI5K 2J88H 1XFPA 4JVWA 3QCVL 4Z7VB 3UTQA 4UTAL 3WE6A 1BD2B 4UOJA 2VXUH 4KTEL 5F21B 4JFPB 1RZ7L 3PIQA 2V2WA 3A0OA 4NM8L 5SWZA 2FD6H 12E8L 4JRXB 3PP3H 3O4LD 4Y16C 5C0GA 3U83A 3FB6B 1IEHA 1S7WA 1D5BB 3AAZB 4O51A 2MCPL 1R3HB 4TUOB 4Y2OA 5H2BA 5MEQB 1MLBA 4JKWA 2LU4A 1NDMB 3C6LA 1KIQA 1QSEB 3KPQB 2AEQH 5D7LA 1DSFH 4JHBA 5J3HC 2EYTB 4G6AC 4U6HA 4HJGB 4JFQB 3EJYC 3S5LA 4HJ0D 2FECL 1KNOB 1OCWH 4PV8B 3KR3L 1BQLL 3SGDH 1P4LA 4LNRA 4KKAC 3BSZH 4YHYC 1RV6X 1IFHH 2W0FA 3VGBA 1ZA6A 4AIXA 5HYFA 3EOBA 5GGRB 3QIWA 4QT5A 1ZANH 4AQOA 4RDQF 4GBXC 5BZWA 1WJ3A 3TC9A 4KJYA 3AMLA 3JXAA 1K3ZA 1Y18A 4PRDB 4XPGH 4JY6B 2I24N 4LDOB 4C83B 3DX7B 4QXGL 4JANA 2X4TB 4P5TD 4XZUA 3VXSD 2C5DC 5FHBH 4YHML 1A14L 5C09B 2ORBL 2FJHA 1U92B 4S1SL 4TUKH 4D3CH 4ORGA 3SKOA 4LCWB 1OHQA 3C2SA 4LQFH 4K94H 1IEBA 1WBXB 2B8OT 3BX7C 2AK1H 3KHQA 4PRNA 2P24B 5CJXC 1W8OA 2YR3A 4JDTH 1HH9A 3V4VH 3U0WH 4NZJA 2G5RA 3SBWC 4CNIA 4DAGL 4YFLF 3H9HA 3PGDB 2Z4QB 1KJVA 2IBGA 1HKLH 4WW2C 4Y4KC 5MI0C 4PUBL 1BJMA 1MUJB 4MA7H 4YHIB 2VITB 5F1KC 5SWQB 5ALCL 3LDBB 4GBXD 4BFEA 1GZPA 3ZT6A 1HXYA 1ZGLB 5HI3D 3MRKA 4MNGE 3WL9B 2EZ0D 4QCIB 3KWWB 4PJ5A 2X4PA 3QHFL 5A3IC 1UM6L 3BKJL 35C8H 3GSUA 1OSPL 1JGVH 4X9HA 1IM3B 2UUDH 3CH8A 5LCVH 1X5ZA 4NC0B 4CBPA 4OB5H 5L6YL 5L6YH 1B0GB 4JRYB 5KSBE 2GFBB 3STBA 3V6FB 1S7SB 2F54A 4P23A 1A7PH 3QUMH 5IOPB 1KPRB 4JRXE 1TDQA 5IBTL 4Z7QE 3CMOL 3DX9A 4OKVB 3BKYL 2ZG2A 5EZOH 4QOKA 1IT9H 4TN9A 3VXME 5HGBA 1CE1H 4HKXB 3ARDC 4K3DH 1RVFL 4NFBA 3G04B 4MNQB 4O4YL 2XWJB 4TTGA 3GSXB 1DE4A 2HAZA 4G7VL 1Y0LB 4UBDD 4GW4B 3T08A 1HZHL 5E8PB 3QUXA 3TWCL 5I1CH 2NLJA 2GITA 4NUGH 4Y7MA 4OCNC 3PV6B 3TT3L 4DW2H 2APXA 3O11A 2PO6A 4YK4B 4X98A 2DI9A 1RIUH 2RBLA 5C0BB 1G6RA 2DMCA 4MXQD 3KLHC 4FOMA 1XIWA 3WKNA 3QFJE 4YGVB 4YUEL 1U8HA 5IROC 1K3IA 1KFAH 1YEIL 5BRZA 5ESAB 4YDJB 3FMGH 4WGWB 2ESVD 1LDPH 3UCRA 5F44A 1GGCL 5CP3H 4NO2B 4UDTA 3C09C 1E4WL 1BQHG 2DQGL 2R2EA 5DQJB 4FQJH 2WUCL 5IMLB 5CD5D 1B88A 1MF2L 5C07E 4IRJB 2XT1B 4Y5YA 3JWOH 3QEGH 2QR0B 4P5MB 4JO2H 5C0RH 5C2BL 3G5XA 12E8H 1JN6B 2VDRL 3BH8A 4MDIA 1ZVSA 1CTNA 3UPAA 4WNQB 1EHLH 4XHJD 1YECL 2UWEA 3QIUC 4OSUL 3P77B 4L8DB 5HPMB 2DTMH 1N2RA 1YY9D 4PJBF 1FVDB 4U6VH 5DJZB 2VLRE 1JGEA 4B5EA 3GSNL 3MLVH 1L7IL 3MLUL 1T03H 5A43C 4PD4K 4AL8H 3D69B 2EDQA 3ET9F 4XBGB 5I18L 4B7IA 2BVQA 3H9SD 3VD9A 1CDUA 5E2UH 1S3KL 5I15L 1MWAB 2J6EA 3L3DA 3WDHA 4RMUA 4YHLH 4X5WA 1N3NB 4IRZH 3F7YB 4YNYB 1GOFA 5ICZA 3BVNB 2XACC 2Q6WA 3SBWA 4ZUSB 4OZGF 4L8SB 2JCCE 4HX1B 3VCLA 4X7FC 3GMQB 2B5IC 2DYPB 1A3RH 3WO4C 3ETBF 2V7NB 1MHHA 2Z31C 2FJFA 3WCYA 2XQYK 3F7QA 1H3TA 5FECB 5ESVB 2XXCB 3BWUC 1ZT1B 1Q8MA 3TF7C 4N9GB 1ZLVH 2B4CH 1G1YA 1REIA 2E27H 1D6EA 4KZDH 4G80B 2ICWA 4HJ0C 1GH7A 3P4NB 3CXHK 4RFEB 1U93A 4Z18A 3OAYK 4ODTL 4ENEC 2RCSH 1ZLWH 4P46D 3NN8B 2FGWH 2P43B 3SCMD 3V9FA 1CD9B 1IAII 1TQBC