2IG2H

Dir primaerstruktur des kristallisierbaren monoklonalen immunoglobulins igg1 kol. ii. aminosaeuresequenz der l-kette, lambda-typ, subgruppe i (german)
Total Genus 39
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
39
sequence length
238
structure length
238
Chain Sequence
EVQLVQSGGGVVQPGRSLRLSCSSSGFIFSSYAMYWVRQAPGKGLEWVAIIWDDGSDQHYADSVKGRFTISRNDSKNTLFLQMDSLRPEDTGVYFCARDGGHGFCSSASCFGPDYWGQGTPVTVSSASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPQPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKRVEPKSCDKTHTCPPC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The primary structure of crystallizable monoclonal immunoglobulin IgG1 Kol. II. Amino acid sequence of the L-chain, gamma-type, subgroup I
pubmed rcsb
source organism Homo sapiens
molecule tags Immunoglobulin
molecule keywords IGG1-LAMBDA KOL FAB (LIGHT CHAIN)
total genus 39
structure length 238
sequence length 238
ec nomenclature
pdb deposition date 1989-04-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
H PF07686 V-set Immunoglobulin V-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2ig2H02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2ig2H01
3QUZA 4NKMB 4PJEE 3VGGA 1UA6H 32C2B 4S0TD 1OGTA 4Y5YA 4EBQH 2YA2A 4MCYA 3BVNB 3IFLL 2XY2A 1R3HB 4MB5A 5FOBA 2GUOA 5IK3A 1NMAL 3WHXB 1JWSA 1HH9B 4Q9QH 5IT2H 2GW5A 4RCAA 1SEQH 4NPYB 3U9PL 4Q9CA 2PXYB 4EEEA 3MRNB 1LP9A 3VRIB 1RZ7L 1OP3H 3L5XL 1XFPA 5EBWA 1BGXL 4FQ1L 4UILL 2A1WH 1FL5A 3T3ME 4X6BA 5IB5A 4RQQA 3KVQA 4UTAH 5HHOB 4X7TA 5C6TL 4NRXB 4QTIL 4EDWL 1I1AA 1IQWL 3U2SB 1FZKB 3MRCA 4D9RD 2VLRB 1OQXA 3CH1B 4QXTA 3QIWD 2ADJB 3HAEA 4Z7NF 1VFUA 3B6SA 5L88H 1U91B 1C16B 1QQDA 4JDVB 3ZL4L 1QR4A 5TE7H 4OLWL 4OD2A 5EZOL 3LEVH 5F9WB 3IFOA 4DKDC 5GJTL 2G9HB 2YK1L 5C0RL 1KEGH 4NQDA 4LGPB 1KN4L 4YHNA 4PJ7E 1BQHG 4XNQA 3TJHC 4JZJA 3O9WB 1H3GA 3BXNA 1GC1H 1DQQA 2XFXB 2IPUG 3GEWB 3BH8A 3MLPA 4NQXB 2FB4L 1Z3GH 4Y1AA 5C0AB 4UDUA 1MJJA 1I4FA 3MNWA 3MXWL 5T3XD 1DBAL 1N4XH 3O3EA 4CW1B 3RZCB 2CIKA 3QPXH 5E4EC 1YNLH 2WBKA 3GMRB 3BZFB 4XMPL 3NIGE 1ONQA 5E9DB 3R06B 4Y2DD 4IBLT 3T0EA 3TIDA 3HLAB 1FIGL 4ZO8A 2WUCH 3TBTA 4LSSL 5LJYH 3KS0H 4APQB 1J05B 4I0PC 2XICA 3BPOC 4D9LL 4MMZC 4PG9B 4BSVB 1DEEB 4ZTOL 3DBXB 3OMZA 1S7RA 4FTVA 1JF1B 4JVPA 4Z0BH 3BEWA 3P9MA 3G6DL 3F62A 3UBXI 2F5BL 5CZKA 4Y4HD 2PO6A 1FFNB 1U2HA 4U7KA 2HG5A 4HKBB 5GGVL 4YR6B 3S35H 1NCAL 4Z7UB 4HWBH 4L4JA 4U2YA 3QRFM 4HS3B 1U8QA 1C5DA 4X7TB 2CDGA 4TOYH 2JB6B 3L5JA 3VXOA 4WHCA 3O4LB 3GSQB 3QIWB 4KAQH 3DYPA 4DGVH 5KW9H 1GVIA 2PW1A 3K2UH 3DV6B 3VE0B 4TN9A 2CMRH 3BGFC 4PJFE 3MUGA 3D69B 5E56A 3U6RB 3OPZL 4Q9RL 5TF1L 2JIXD 1EPFA 3D2UD 4XCCH 2P5EA 4P4KA 1AE6H 1E4XH 3RVVD 2HA1A 2CR3A 3KYAA 3PHSA 1J8HB 2RQ8A 2A6KB 5D8JL 4KVCL 2I07A 4EN3D 2BFVL 2FR4B 1T4KB 4Z7QF 5HDQH 3V4UH 4P2RA 5I18H 5DRWB 3VXMD 1BFVL 3EDFA 3SDCC 1J12A 5C86A 1EVUA 3UDWC 1QFHA 3LEYL 1LEKB 1KCVH 4X7DC 3VWKA 1IZJA 1KB5A 3IKKA 5ADOH 4ELKB 1Q9KB 2CKBH 4YEEA 2DQGL 3R06A 4J2XA 1T1YA 3H9SE 5T1KD 4Q9BA 1KIUA 2IBZX 4QXGH 5FM5O 1OVZA 1E28B 2YOCA 1FNGA 3PGDA 4M93C 5DVOA 1CE1L 1P69B 1PG7X 4G3YH 2AK4E 3VFOA 4DEPB 3GJFB 4GW1A 5EU6E 2V7HB 5FOJA 4LSVH 2IG2L 4XBEH 1KXTB 5F1IA 1AGFB 1QPPA 2BSRA 1T1WB 1QTYT 5L2JB 1TETL 4R4ND 2P8MA 4RFEA 3ULUE 1R3JB 1G1YA 2GK0A 3LEYH 1NMBH 4C83B 1WTGT 4EZMA 1CWVA 5EN2B 1LP9B 1FORH 2DLFL 3C2AH 5D7IB 2AEIT 1T2JA 5KBNC 3IXAA 4YXLL 3OAUL 2VLME 1WZMA 1VKXB 4IRJD 2O5XH 4HV8B 5HGDA 2X4SB 3OJDA 4WUUA 1KPUB 2H45A 3MMEB 4I4WB 5BCAA 1U95A 1YY8B 1OT2A 4R7NB 1P53A 2JCCA 1EFQA 2APTA 4MYWB 1I3RA 2R4RL 1BD2D 1RZJH 3OGOE 5DZLA 4HJGA 2RCSH 3FO1B 4HIEB 2W60A 5SWSE 2APVA 2BNQD 1HHJB 1WCBA 3OKMA 1ZLVH 2E7MA 4P4RA 4BFBD 3MOAL 4PRDA 4X9IA 2J5LC 3LKOB 3GHEL 2NNAB 3RDTA 1R3IH 2HT2D 2ADGA 4PB9H 1M1SA 4HWZA 1YJDH 1ZLUH 4G9DB 1AI1L 1T7ZA 1C12B 1QR1B 4JFFB 3GBNH 2G60L 4OV6F 2R1XA 3NZHH 1NQBA 4Q58C 5GGVH 5IFJB 3PWLB 3TVMA 2DQEH 3O2VH 1F6AA 4OF7A 1B6DA 4Z5RB 5MI0B 4IIQA 4F9PA 3D0LB 3TH3T 3UTTA 3QXWA 1MRFH 5HHOA 2VE6B 4KTYA 4OLZL 5KW9L 1UZ6E 2OX5A 4FQJH 2D0FA 1DE4A 4RMVA 4P46C 5IMMA 3PDDA 4LBEB 2VMFA 3QNZA 5GXBB 1OB1A 1HWHB 3BPLC 5LG1A 4LEOA 5E8OB 4PJ8C 5CP3H 4R4BB 4QHUB 1TVHA 1WJ3A 4YZFE 5I1CH 1FYTA 4Q7DA 5CEXB 3ZO0A 1VACB 3C87A 3BP6B 4QRUB 3VRLF 1LO4H 3MRFA 3VXRA 4RGMB 3VFTA 2Z31D 4NJ9H 3RZCA 3PP4L 3CXDH 5GHWH 4UIKL 4HS3A 1RHHB 2FX9H 1X44A 2XA8L 5SWQB 2AXGB 3M1BB 4OZHA 4RMWA 4L4VE 2X9WA 5ALCH 3MXVH 4X6FB 5HGGS 4V2BA 5HDLA 3QPQC 4TSCH 4OTXL 5C71A 5IVXB 4U1HB 1MJ7H 4XH2B 4HC1H 3DBXA 1EIBA 5ITFB 4JFHE 3GI9H 1LDPL 1EJOL 4HLZH 4NQED 4L8BA 4KXZI 4K71B 2GJ6B 2AI0H 1KFAH 3MNVA 3FAXA 1IEHA 4N90D 4XMLL 3VXSB 4AQ1B 5IJVA 3GRWA 3QPXL 1NEZG 2JB6A 3GI8H 4QXTB 4WHYH 3WXWH 3TBVA 2E9IA 3VXSD 2QSTA 4NDMB 3WXWL 3FQTB 2R29L 3OKEA 3HZVB 1EDQA 2FHFA 2FJFB 4ZSOA 4KJPD 2FL5A 4BFIB 4YDIH 4Y5XB 3EIFA 3T0WA 5DO2C 2BVUA 2AJXH 1G84A 4XNUL 3VDAA 3BEWB 5HHMB 5FF6B 2WWKT 2J88H 3WL9B 1ZEAL 3TO4B 1B6UA 4Y1AE 5FDWA 3EO0B 3DO7B 5FYJU 3EDJA 2NXZD 5C0FA 5IESL 2DTML 3CMOH 4RMRA 3O3EB 4QCIA 3G5XA 4MA8H 3QIWC 1ITBB 1T1XB 4K8RL 5EO9B 3MACL 3W9EB 1A6VL 4NQXA 4Q6IC 4RSVA 3MJ7B 1SY6H 3IJHB 3MLWH 4NZTH 1MJUH 4IOFD 4KVNL 1EVTC 2MQ3A 1E4JA 5KOVC 3SO3C 1WBYA 3FN9A 1R24B 1BFSA 4Z8FH 3PXJA 3KYOB 4MHHI 4WW2B 4RGNE 2BXZA 1MRCL 3RIAK 5SWZD 5GSVB 1I9JL 5ITFA 5F3BB 1DANU 1A7QL 2DKMA 1U8LA 3SDXF 3RA7H 3RL2B 4U1IB 1CXHA 2IALB 3OJVC 1MJ8L 1C5BL 5AZEH 3AS0A 3HG1D 4CDHA 5AYUH 4IRSB 1BQHB 1Q9WB 3X3GL 3RUGB 2CKBL 1IEBA 1MREH 4LFHG 1BBDH 1AGFA 3EYVA 5CSBA 3ULVL 2K7QA 3STZA 1INEH 3SOBL 1KJVA 3R0MA 1BX2A 3DI3B 5JHDE 5LXGL 1LD9A 4PV9B 2DIBA 3KPRB 2CLVB 1U0QA 3UC0H 2I26N 4PJ5D 3O4OC 4L8SA 1JWUB 4U0RC 1R0AL 4FS0A 3I2CH 4DVBB 2A1WL 2XZQH 3FB5A 4FQHA 4NO0A 3ZTNL 3GMOA 5DQ9B 1A64A 1MCPH 1NCCH 4GBXA 3WXVH 3FAWA 3EYOB 4G8FA 1FL3A 2QQLL 3BAEH 4XGZA 3WFBL 5HYEA 3WXVL 5SX5H 4LLWA 1TQBC 5KS9A 4NNXB 2DB8A 3CU7A 5DJDA 4I3RH 5A2IH 4WO4B 2NY4B 1GZPB 1CIDA 4E5XA 4WI6A 3CH8A 4KZDL 1ZSDA 5E6YA 2R1XB 4MA7L 4I0PD 1JGVH 5CMAB 1O0VA 2EDWA 5SX4I 2F5AL 5CEZD 2VDNH 5CHNA 1VACA 5HDBE 3BZ4A 3ULUL 1CE6B 3MOQA 4Y0GA 1MAJA 3FT2B 5DI8A 4PJIE 4LARL 4G6MH 5JMOC 1NGZA 4QXWA 2V2TA 5DUML 1CBVH 3CMGA 1RJLA 4JFZH 3GGWB 1ZVSB 5DF0A 1D5XB 4G6KL 4TSCL 3Q6GL 3U7WH 5GQBA 2C3WA 5C0JA 1MIEL 1KN2H 2VZ3A 2AJSL 2EEAA 4PFEA 4FFZL 1OAZH 1RY7B 2DICA 3DV4A 4NO0D 2NXYB 4EXPX 5C08B 4HKJB 3GMLB 4UIKH 1FO0A 3W39B 1KCKA 5EOQH 5T1KB 5KSAA 3D0LA 4LEOB 2ARJQ 4ORGA 4FQPA 4R7NA 3MLZL 4G7VL 2IAND 1ZTXH 5EU4A 5D7KD 3DGGB 4NSKB 3LV3A 4HV8A 2VITB 4LLQB 3LRSA 1KBGL 3R4DA 4ZUVA 3V7AG 2VDQH 1CF8L 2HT3D 2IWGA 4CMHB 3UTTD 5D8JH 4I0PA 1BQLL 1IM3B 4J3OC 5GS0L 2JJTC 1X4ZA 3TA3D 4U1KB 4ZUSB 5EU3A 1OWRM 1BLNB 2DMCA 4H1LH 4OLZH 1BF2A 1HHKA 3FB8B 1W8OA 4KROD 4RWYL 1WVZA 4N5ED 1SEBA 1OARL 3LDBB 3ZE2F 4XVJH 3OX8A 1G7JB 4YUEL 1JNHA 1H0DA 2F74B 3OKNA 3HR5A 5I6XC 5JDSA 2YPVL 2BRRL 4P23D 5HHQB 12E8L 3PWUB 5EBMB 5GGQL 1CXEA 1T7YA 2A77H 3CSBA 2Y6SC 3UBXG 4Q6IA 3VXUD 1D6EB 4EUPA 1JTPA 4X4ZA 4XNXL 3PHOB 1F58H 3LKNB 3UTOA 1B90A 5FO9A 3OKLB 2FHCA 3LD8C 2E7BA 3BDXA 1QSEA 4Z5RA 1I8MA 3PIQB 2HMIC 5C07D 2WUBL 1NJ9B 5ETUB 1IFHH 4X6DB 3ARFB 4P23B 1IM9D 1OTUD 2OL3B 4QGYA 1D9KB 2ITDB 3RBGA 5DRNB 1KIRB 1G9EA 4P3DA 3G5ZA 3ARYA 4PREB 5T3ZL 4XVUC 1HHGA 3TYFB 4QT5A 3O2DA 2EE6A 3HUJA 2VRAA 5MEND 4IRJC 2EDKA 5C8JA 3EDDA 5DURD 5CJXA 5MP6H 1W0YT 1ACZA 2VIRA 3GRWL 5F96L 3LMJH 1YPZE 1XIWC 1NBZB 3W0WD 2NY7L 3C5ZD 1N7ML 5A43C 5EZJB 4JRWA 1EFXB 3MBEB 3CSYB 4OI7A 3OR6A 4MAYB 4R0LB 4ZUUB 4M5YH 3ZHDA 2FNBA 4S1SH 4E41D 4YPGB 1KTRL 1AGCA 4YDJA 3P77A 5IROA 2HFEA 1A6ZA 3E3QE 4DGIL 4JM4L 1ZHKA 4G8GD 4M6NL 4WU5B 5IVZB 3O8XD 1PLGL 5EUOE 5J6GB 3O0RH 3TT3H 1UACH 3MRRA 1IKNA 1JF1A 3U9UA 2Q87A 5D5MF 1FZJA 5JA9A 4M5ZL 3P0YH 5I66B 3ZT5A 2NLJA 4O5LL 4BZ2L 1BECA 1UA6L 1AHWA 5DC4B 4NN6C 2FO1A 3MGAA 4KKAC 4LVNC 5SWSA 3RGVA 3HFML 5DJ8B 1RI8A 3NCEB 2FJFA 4E41B 5HHNA 4QRRD 4FG6D 4N8CH 3MTRA 1CL7L 1RUPH 5F9JB 5L9DL 4W68A 2Y7QA 5IBLD 4YXHL 1FSKB 4I18B 3C5ZB 4QRSB 1T21A 5ESQA 4XNZC 5D2NE 2EYTB 1BX2B 1ETZA 2EDBA 2DQEL 4P49A 4FQ1H 3O81A 5DTFB 3EO0A 4GRLD 2XWJA 2YK1H 3LSOA 4P5TA 5LXGH 4PREA 3I02B 1MFEL 3QQ3A 4KJWC 4MJ5A 4OCNC 2XZAL 5I74C 2X10A 1OOAA 4LCIL 4H0IA 5BS0E 2DQTL 4J3SA 2F8OA 3MRDB 3QUKA 3MOBH 1KEMH 2AABH 2R15A 5I1IH 3IJSA 2VWEE 3ARFD 5EOQL 5I2IB 2X4PB 4HT1H 3ULUH 3IYLW 2BCKA 3RP1A 1MAML 3NAAH 4WY7H 4KROC 2WBJB 3BD5A 2ZUVA 1OWWA 3WKNA 2GKIA 3UO1L 3BH8B 3BP5A 5E2TH 1UM6H 1C7SA 4U49A 1FYTE 2NPLX 4Q9RH 4OJFH 5I1GL 2C26A 2A6IA 1WSST 3Q5YA 2BJML 2KKQA 1DN0A 3H7BB 3MLYL 4LEXH 4EUPB 2V5TA 2P48B 4OIAA 3EGSB 4CJ0A 5CBAB 2WBJC 4YQXH 5D1QD 1MCJA 3ELAT 1AKJB 4R96A 4WJ5B 4WDIB 3IDUA 2BMKB 5CKGA 3GBLA 1G7MA 3T65B 2ARWA 1A6TA 2OL3A 1B0RB 1F3DJ 1U8IA 2AS5M 5MI0C 5CLTA 4LIQH 3P9MB 1NAKH 4PB0L 1H15A 2F8XC 3GSWB 3HE7B 5CIPA 3IF1A 4HKZB 4PS4H 3GMPB 4JJHA 3A6BL 4YHIA 3CLFL 4JM2A 2H26B 1ZLWK 1IM3A 1PEZA 4YFDB 2RFXA 3BIBX 1ETZB 5DUPL 5I17B 2B8OT 2I25N 1K3IA 2GJZB 2OLDA 1R5WB 1UXWB 3ALPA 2X4TB 3BPLB 5I1JL 4JGMA 1QLFA 4FQLL 5C08D 1JPGB 3BPCB 1JNNL 4HHAB 5DHVH 1W72L 1RZ8A 2QKIB 3I50L 1A5FL 1UC6A 1TNMA 3NCBB 2C5DC 1SEBB 4UT9H 3DVNA 3P9LA 1XGPA 3GSNH 5K9QI 4NNXA 1A8JH 3DSNA 4JQXC 1C08B 1FL5B 2DQHL 1EHLL 4YHZH 4UDTA 3QDMD 5I75B 4JY6B 2M1KA 1JYNA 2ED7A 1PKOA 4LSPH 1K85A 1CFQA 4HS6A 1E4XL 1OGAD 3I6LE 1D6EA 4I0PB 2WMPA 4UNTA 4PGDB 3X13B 4PJAA 5AG8A 4ZS6D 3AREC 1NMCC 3VXQB 5I8OL 2VLKB 1NFKA 3O2DL 3ARSA 3I85A 1IGCL 4J6RL 1SEQL 1GC1C 4W6YB 3R8QA 3EJJX 1DBMH 2J12B 2KDGA 4NQDE 3LMJL 3MA7B 3DV4B 1TQCB 1UJ3C 3OTTA 4G6AC 1TCRA 2BY1A 4MJ4A 1G6RA 1KULA 1MNUH 4X6EB 3TV3H 2A6JA 4JG0L 3ZYOA 3UTPD 2VWEC 2FEDC 4ELMB 3QRGL 2G75A 4K8RC 2Z35A 5C07A 3QZWG 3RU8H 1TQCC 4NNPL 1GIGH 4Z8FL 1XF3A 1FLRH 2AEPH 1RAMA 4I5BB 4KUZL 1E6JL 3NPSC 1MCNA 4LQFL 1UQSB 5GGSB 3TYGL 5JR1L 3QULB 2E6PA 2OMNA 1NFDB 2FSEB 4P2QE 2GQHA 2XTJB 2EDOA 4WWKB 5HVHB 1NCWL 1B4JH 5D2NC 4TVSa 1MIML 3CK0H 2R2HA 5EU5B 4QHKI 2JJVA 1SJHA 3LN5B 4PG2A 1NGXA 3UJTH 2V17L 3OKDA 3O3AB 2YA1A 4PJDA 2P5WA 4Q6IB 3BKCL 3NABH 3SDXB 3ARGC 1CLOL 1UKTA 2HFFA 3I2CL 4KKCD 5DJZA 4DKFL 1TTFA 5CCKL 1S9WA 5TQ2H 4YGVA 2DDQH 2Q86B 4E41A 1ORQA 1KPVA 2YA0A 1F4YL 4Y4FC 4QYOA 4OQTL 4K7PX 4OIIL 4PJGF 1KB5B 3BKJL 1LVEA 4TVPL 4JFFD 4I3RL 4JHAL 5D72H 2DBLH 1MELA 2A74A 2X5PA 5CEYA 3QAZB 5JW5B 4N90E 2FZ3A 1DR9A 4OZFB 5HYQB 1WFUA 1XGQB 2MMXA 3FQWA 4K3JL 4UNUA 1KFAL 5CCKH 3PP3K 4DUWA 1BFTA 5GZOD 4K3JH 4P2RE 1RZIB 1NH6A 2ENSA 2DYPA 1NCBL 4EI6A 2QBWA 3QWOA 1PKQA 1OAXL 2GJZA 2A38A 4I1NB 4JDZA 4N8VG 3VH8A 3QZWB 1RUPL 5TPWH 2AVGA 5TH2A 1Z9OA 5FECB 3IAPA 4R90H 4QNPE 1MCOL 2NY5C 1TZGL 3P30L 4K23L 2EDJA 4YQXL 5IVXF 4YLQT 2CDFA 1OGAB 2R69L 3ULUC 4PJHE 5FM4A 5E2UH 3QHFH 3FQNA 3MLZH 2R1WA 3CDYA 4G7VH 5DZOA 3T2OA 4JQVC 5D5MA 2KZWA 1Q38A 3ZKND 3UTSA 2XN9B 3NH7L 1R3KA 3V52H 5E8EB 4M9OA 2WP3O 5JO5B 4U1SB 4Y5VC 3TFKC 3EGSA 1QYGH 1V7NL 1G0XA 5IVOA 4RNRA 5EH1A 1IEAA 3V4PH 5FDYA 2GSGA 2HRPH 1F2QA 2VDOL 1YEJL 2XACC 3TNNB 4AH2A 2JF1A 4GMTL 1HEZA 1HINL 1I9EA 4W70A 3UCRA 1QBLL 4XP5H 3R1GH 3AMLA 1WQVT 1Z0MA 1JHKH 5E2UL 2J6EH 4KKCC 2R29H 2NNAA 3LRHA 2UWEF 1YN6A 1HXMB 2HWZH 3C5SB 3IFPB 4OZFG 4N0UE 1KJ3L 4C4KO 2HVJA 3P3YA 1N2RA 1MCWW 1MHCB 1WZLA 3T0EC 3TIEB 1RK1A 1NAMB 3AAZB 3PDGA 5ICYB 1UWEL 3VRLE 3BN9C 1UKSA 5TFSL 1QP1A 2QHRH 3V5KB 3WJJC 2K9UA 3D2UB 4XB8A 3HMXA 1LE9B 1KELL 2UY6A 2XV6B 3FZUC 5CSZB 5CJQL 4ZFGL 4X6FA 1S9KC 1P4LA 1Y18A 4F8TA 1ODAA 5BQ7B 2J8OA 1YPZF 5IEHA 1H3XA 3N1FC 5DC0A 4K07A 3L7FA 4O02L 2JJSA 3VXME 3ULVH 5DMIL 4I2XA 1KXQE 1C5CH 3BESR 1N7MH 1R3LA 1F6AB 3CSGA 4R4FL 2EC9T 5JR1H 2P7TA 1JPTH 5BXFB 1DLHA 2VISA 3KPTA 1I3RB 2B0SH 3U36A 1XCTB 1ORQB 1RFDH 2WQ8A 3MLRL 1CDHA 3ZYZA 2B4CC 4N8PA 3Q5OA 1FGVL 1CL7H 5JQ6L 1PFCA 1AD9A 3FO9A 4PGZA 4OM1L 1T66D 3DUUB 3BYTA 1MWAA 4JRYE 3QIUC 4QRPB 1YN7A 4X4XA 3QEQB 5FXCH 3RY5A 4GRLB 1HEZB 3EZ8A 2D7QA 3LS4L 4ZO7A 3ULUD 4CVUA 3LKSB 2OQJB 3BRDA 4XWOC 3F7VB 3WIHA 4J3TA 5EUOB 1P5UA 1VEMA 5C0EB 4F8QA 1YNLL 1KEGL 4H8WH 1T3FA 1U95B 1YY8A 4YHMH 2A6KA 1FL6A 1KLUB 4LF3B 3HG1A 2HT3C 4FNLH 1TJGH 3WJLC 15C8L 4U6YB 1T7XA 2Z35B 4LASL 1KTDB 3WBDA 5K59F 4UU9A 4OAWB 4OUOA 2FX7L 1P84K 2EIDA 2FJHB 2VE6A 4X5WB 4EKXA 1UZ8B 4FQXC 1LNUB 1BD2E 3OV6A 3O6LL 4JFED 3KNBA 3CVIL 2YC1B 4PBVC 2XZAH 3IDYC 5T5FL 3HC0A 3QUXC 1EZVX 2VUOA 2VLRD 1OAKH 4U7MA 4URTB 3MR9B 4CGTA 3PHOA 4PY7B 1K4DA 5IB2A 4OB5L 5LGHH 4L9LC 1JCKA 4UBDD 4XTRD 1F8TH 4OM0H 2OL3L 2R23B 1BD2A 4P9HL 5K9JL 3KPLB 2KH2B 1ZGLP 5JW3L 3HTLX 5A2JH 3UROR 1LO4L 3KXFD 1ZLUK 3V6OC 2GK0B 3MZGB 4JDTH 5DD5H 1D5ZB 4HDIB 3C9NB 5T1MB 3OG6B 1J0KA 2APFA 2HJKA 3G6JE 3THMH 5IHBA 4GG6A 2A0LD 5E0QA 2ORBH 2NY3C 3CXHJ 3FJTA 4QEGA 3MA7A 1V7NH 4JQIL 4OLXH 4PRHB 3BH9A 4JFEA 4JZNA 1D5XA 3IRZA 4I4WA 5JA8B 1T83C 4YHLH 4MJ6B 4G6ML 1GH7A 5TGBA 5IMOB 1CDBA 1BBJB 1QG3A 4R7DA 1V3LA 5DD3L 3VXNA 4ZAKC 3VFSB 2H1PH 1ZGLA 3N1QC 5D1XB 3RY6C 4OJFL 1OLLA 3MLXL 2ZP0T 4JAMA 4NO2B 1J5OH 5IMKA 1QYGL 1JF5A 2NY1B 1BQHA 1NAKL 1Q9WA 2X1PA 3KYMB 1UB5A 5D7JA 4NKOB 1LE5A 4U6HB 1W8NA 2VDKL 4WUUD 5FHBH 4XCFL 1IGIH 2OZ4H 4QWWC 3QO1B 1YYML 4EVNB 3QWRA 3UP1A 1A2YB 2R56L 3KPOA 5JIPA 4HUVB 4L8CA 4KY1L 4P5TD 5JOPD 2MHAA 4UT7L 2HAZA 3JWDH 4Q2ZA 3L3KA 3TM6A 3V95A 5FYKU 3T0AA 2P24B 5GS1C 4FTVB 1S7RB 3RGVB 2OR7A 2GTWB 3KPNB 1BP3B 3RX8A 1CDJA 5AUMB 2OJEB 3DRQA 1A9BB 1NUDA 3I9GL 1DQLH 2FHBA 1ZSDB 3RZCD 5BW7C 1I8LC 5L7XH 3KPMB 3ROLA 3D6GA 4I18A 3O6KL 3LKQB 4GT7A 1T4KA 2JIXA 1S5HB 4O00A 4R2GD 1KT2A 3ZHLA 1RZIA 4YXLH 2EYRB 3RGVC 4NYLA 3OR7A 1O5DT 2VDRL 3LQAL 3VMPA 3OF6A 2GT9B 4HAGA 2NX5D 1KYOK 1IZKA 2G9HA 3HFMH 4JB9L 3FOLA 5L2KE 4S1DD 1ZEAH 1A1NB 4I18C 1KGCE 3DROA 5HHME 2BNRA 5DYOB 3QDJB 3WFZA 1ED3A 3CFBB 1M05B 4XBGB 4PLJC 1KB5L 1RK1B 4JO3L 2FD6L 3IVKB 4PJHA 3VH8B 2R1WB 1BOGA 4GQPH 3I6KA 3RA7L 5GS1A 4MJIE 5TE4L 4RMQA 2CIKB 4NZTL 4HKJA 4EIZC 3V4VL 3F12B 1I1YA 4KKLD 4V1DA 4YX2L 2EE9A 3B9KA 3K46A 1CL7I 1EEUA 2Y07L 3HPLB 2HJFA 4K9EC 5L2KA 3QRGH 3SO3B 1DQQB 1VGEL 1FO0H 2XFXA 3HR6A 4Y16C 3T0VA 3U4AA 1GOHA 3QO1A 1DTUA 1NLDL 3QQ9D 2NY5L 3JBG7 5DI8B 1NC4D 4BSWA 2QJDA 1F8TL 1Q8MA 1T2QL 5SWZE 5FOBB 4HXBH 4LVOB 5K9KA 4W4NA 4HGKC 3PDOB 3SDAB 4NPYA 4YHPA 5LKNA 5GSRA 1OM3H 4OM1H 3VFGL 3N1MC 2IBZY 4HBQA 4JO2L 5HYSG 3QG7L 5B3JF 5FO7B 1YN6B 5ERWB 2ZG2A 1S7WB 1MY7A 1MCHA 1PSKH 1GSMA 1I1AB 4WTZG 2IADB 4F7EB 1V3MA 3PF2A 4R26H 1NLBH 1HHKB 3DO7A 4TOYL 5IOPA 2NZ9D 4OFPA 3W11C 5L0QB 3RIFF 2I9TA 5DMGD 1WC7B 3N0PB 1ZOXA 4Z76B 1G7JA 1LDPH 1WFNA 1E4KC 2EDXA 3W0WE 3WJJA 4A6YB 4JO2H 4OTXH 4DUVA 1G6VK 1NDGA 3HB3D 3IKCB 4RX4A 1EHNA 5D7JB 4GG6B 2YEZA 4UINL 5IP4A 1KTLA 2F54B 5ALCL 1B2WL 3L9RB 1WWCA 3SGJC 1AIFA 5L0QC 1JPST 2CRYA 4FQ2L 4XXDB 3C09B 4ZOAA 4K94C 1X6LA 3QUKB 4R0LA 4LLVB 3EDKA 3BPOB 4HH9B 3CVHH 3A6BH 2W0KA 5J89A 4G8IB 1WZ1H 2VO5A 3DX6A 4D8PB 3VXNB 3FRPA 1XF1A 3KPSD 3BP7A 4IMLA 1AXSB 2ICWA 5KSBA 2XTLA 1RJLB 2Q76B 3UTZA 4OAWA 1FCCA 4ODXA 5GRXG 3VFOB 3FO0H 4MXQD 4ALAH 1BVLA 3KR3H 2C3XA 4ZOCA 3LN4B 4F7CB 5JXAL 4AEEA 4QOKD 2GITB 2YC1A 4W81A 4QY8B 1JNHB 4Z7VE 1YNTB 4QRRE 4YAQB 2B4CL 4P5KB 4RWYH 4PB0H 4QOKA 4EI5C 1K9TA 5SWSB 4OLUH 1P2CB 1KENH 5GRVK 2HJLA 5I73C 2L4OA 5JIHA 1U93A 4KTDL 1F6LL 3W2DH 5ITBH 4L9DA 3BPNB 4XC1H 4MQ7B 43CAB 3OKLA 5HHPA 5LAXA 1T5XA 3OJDB 2IANE 4DVBA 2C1OB 3NCYS 4R4BA 5DK0B 5FYLE 4X7CC 2W0FA 3W5MA 1VHPA 5BJTB 4X8JB 3UTPE 1JGLH 5JHDB 4OKVB 1BBJA 2UZXB 5I8CA 1DBML 3HZYB 3RBSA 2ZG1A 3ET9F 3ZDZF 2IQAB 4NO5A 4Z76A 5DHXB 4GBXC 3RIFK 4PS4L 3MUGB 4AL8L 2XOTA 4X5WA 1NSNL 5L8KB 3HNSL 4BSJA 4C56D 3WS3B 2O61A 3C6LD 1Q9LA 2ZKHH 5GGTA 2JJSC 1P5VA 1I7TA 3E2HB 4L8DA 4P2QD 4HHAA 2IANA 5J3HD 4PUBH 5LBSL 5D93C 2VIRB 2BVQA 1Q0XH 4HEME 1FNEA 4YXKH 5F6HI 2AJ3B 3FQRA 1I1FB 1CE1H 1R6VA 4LVEA 4D0BA 6CGTA 1JGLL 1M05A 4XBGA 3ULVE 4F80A 4K8RH 5TJWK 3VXUE 5JXEA 3TPKA 3W9DB 2X44D 4XVUD 1PVHA 4MAUH 4JRYB 2F15A 3EO9H 1T0MB 3OZ9L 4HS6B 4P23C 5BO1H 4XP6L 3IDGA 2X6MA 2KZ1B 1F4WL 5EC1B 4N0CD 1CICD 5HGHA 4P9ML 1OP5H 2RBLA 4JFFE 5DTFA 2X40A 4OCLC 3TZVC 4I3GA 4MDIB 2W91A 4XZUB 5ANMB 1BZ7A 3GJFK 1IAIL 1JMXA 4XCYA 4IHOB 2QR0B 5IM7B 2ICWJ 1DQLL 2VQ1B 4LASH 4JZJC 4HIIA 3VG9C 1N0XL 3BUTA 4KGLA 4N0UA 2GYSA 2RCSL 3G04B 3BYYA 7FABH 4LDLB 3NVQA 5FKAB 2F53A 1OP5K 4S0SD 3EJZD 5E5RB 5IMMB 3FN0H 1G9ML 5C0IB 1RUQL 1ZE3C 3SKJL 3KDMB 2CPCA 4PYGA 3PWVB 1QOKA 2BNRB 2YUWA 4JY5H 4W6WB 4MD4A 2OJZL 1MVUB 4BH7A 4D3CH 5J6GA 5DT1L 1MQ8A 1TJGL 3NTCL 3V8CA 3ZZ1A 5E8PA 3PJSB 4NUJA 4J3VA 4PJ8D 1LK2B 1T0NA 4MJ2A 1MHPH 4TUJB 5GPRA 5IB1B 3AS1A 1QLFB 5EO1B 3UJIH 1ZGLM 2IPUK 5DD0H 1K8IB 3QCVH 1G7HB 1S5HA 5T1LD 1T2QH 4BFGA 3BZDA 4OFYA 1X7QA 3TO2A 3N9GH 4WW2C 3H9YA 1VESA 2P5WD 3RDTB 2OTWB 4G80B 4HUMB 1F4HA 5GS3A 2NR6D 5EFIA 3BKCH 3NABL 4MS8D 5LGKA 5EOCJ 2DKSA 3SGDH 3D85B 5TF1H 5E4EB 2DLEA 2H2SD 2ZUSA 3RWHB 3MYZA 1NCAH 5HD8D 5EC1A 2KUTA 3C5JA 4FFWD 4X99B 4OGYH 5IGXL 5KG9A 4ISVA 3MV7E 3QUZC 1EMTH 4B50A 2C1PB 4PJXA 1U9KA 4KK8D 4LOUD 2NY4C 4U1MA 1CI5A 4ZUUA 2VXUL 1HN1A 4MNQD 1WCQA 1F3DH 4GW5A 5IOPB 3QG7H 5IF0A 1EO8L 3EYSH 1H5BB 3H0TB 3F58L 1A7RH 1X3DA 5KANG 3BDYL 4KDTC 3O8XA 3WD5L 5F9OH 5LVEA 1HILB 1AO7B 3AU1B 3R0NA 3ZE0F 1PZUB 2VDML 4HGWA 1ZT4B 4U3XA 1LGVA 4ONFH 3WMSA 3DETD 5HYJA 1J1XH 2VN4A 4DW2H 4YHKL 2IGFH 2P8LB 5BZDA 5CEXA 3IAQA 5JPNA 4ODVH 2QQKH 2DTSA 1JPSL 4TPRL 4KV5E 3OKMB 1F3RB 1FNSL 1NUGA 2IMNA 4MLSA 1PQZB 4FTVE 4L5FH 5CJOH 1TVBB 2CIIB 2YPKB 3J8F7 4F7CA 2XTJE 1N5YH 4EOWH 1P7QB 1F90H 1U8OA 3T4YB 4F37K 4IRSC 2ZNXA 3AY4C 1MRDL 4PRIA 4JKLA 4J23A 3ARWA 4HJJL 4QLRA 3KYKL 4NHUA 6FABH 1W72H 1H3PH 1BBDL 3QG6B 1A1MA 3V9FA 3B3IB 1Q94B 3HE7A 2X7LB 3KJ4C 5D70L 1CQYA 5MEQA 2O5XL 1ZWIB 4HKXA 5F89A 5IFJA 5I76B 4YDVB 3HR5B 4MB4A 1U8MB 3Q3GA 4QTIH 3BKYL 4EUPH 4KWUA 5KSAB 1X5AA 3CLFH 4CVXB 1HQRA 3MA9L 2VL4A 1ZHBB 2F54E 3VGFA 3IDNA 5JOFB 2XZCH 3WE6B 1Y6NR 1A6UH 1I3GH 1RU9H 1BVLB 5DHVB 2DIAA 3ARDA 5TE6L 1DFBH 1AJ7L 1G0YR 2OTUA 1KCLA 2E7LA 5CGYD 3OKDB 3L5WB 5F7UA 2HVKB 1SJHB 4D9QD 2Z91A 4UTAL 3GSVB 3WS3A 1E27A 5K59E 2NY6B 3UC0L 2LQRA 4NOFA 4X0KB 5E94A 2WIIA 2JK5A 1SJXA 3BWAB 4JVUA 3TO4A 4KHXL 1DDHA 5I0ZA 5IQ9B 1LO5B 3QDME 3QUZB 1XF3B 2JB5H 1MCPL 4NKMA 4BJLA 5IESH 3JVGA 1ULVA 4PRNB 2ZCKL 5BJTA 4JFZL 4RFNB 3RI5K 4OT1L 1B4RA 1TPXB 4BQCA 5DMGC 2XNAB 3PUCA 4LCUA 3UX9B 4QHNA 2VR5A 1JTOA 3QISA 3GB7A 1ZA3B 3GGWA 4GSDH 1S7TA 3GZKA 4HUXA 4Y5XC 4M7JL 1GHFH 4MJIA 4HMEA 3PGFL 1RIVH 3TBTB 1NBVL 3ZYJA 2DOCA 1CU4L 1UEYA 4ODHL 2VZ1A 1P9MA 3O3AA 1OAKL 1OP3K 4C4KT 3FB7A 1XCTA 1A7PH 4ENEC 2J5LB 2PTTA 4MNQA 4OQTH 3JV4B 1JK8B 3OXSB 3UTQB 4YK4B 5F7MC 5C0GA 1KNOA 3LPGA 3V5DA 2X4TA 1P4BL 5IFAH 3ARRA 1HNGA 4LSSH 5IMLA 3FQXB 1J88A 1I7UB 2X4NA 4MQXC 3QQ9C 3TN0B 3TP4A 3EOBB 1P1ZA 3PXHA 5FCSH 3WLWC 1MIMH 4JM2D 5I1LB 1MJ7L 5F7LB 3A0OA 5GZND 3ZE0E 3QUXB 4HF5L 1IGYA 3LY6A 4PG9A 1CLYH 1WWBX 2NMSA 1SJVA 3SKNA 3T3PF 5AD0A 2FYYB 3KYNB 4PY8J 2P5ED 4P4KD 1QRND 4ODVL 3MBEC 2HT4D 3QSKB 5FEBA 3QFJD 3NFPA 4YHLL 3T8XB 1RUAL 5HI3C 1WISA 2EZ0C 3KR3L 3V6ZB 2BOBB 3SCMD 3OPZH 4G43B 1FE8H 1QKZL 4PPTA 5FB8A 5ADOL 1T0MA 3MZTA 5HPMA 3AXLA 2YKLH 3OHXA 3ARZA 3O3DA 1LEKA 4HAFA 3MR9A 4M1GH 1IKFL 2EKJA 2CRZA 5IW1A 2R8SH 4R2GC 4LMQE 2VQUA 5ESQB 3TGXA 5T1LA 4ZOBA 4Y4KD 1S9VB 1CD0A 3GIVB 4RWHA 3KLHD 2VR9A 3FOMA 3KXFA 5ENWB 3QEUA 2NY1C 1UADC 4P2RD 3KDMA 5HDBF 3VXMA 1HYSC 1GRWA 1X7QB 2LU4A 5CBAA 2VLLB 4QHMA 2F53B 1R24A 3ZTJG 1BOGB 1FFQA 3BEVA 2HLAB 3RHWK 4JFQA 1HYSD 3WUWG 4HD9A 3T4AA 3DURB 4MD5B 2QHLA 5H2BA 1W0VA 2ED8A 2VXTL 2GY5A 3PJSA 1S9XA 2P8PB 4Z7WE 5F7EH 1URLA 1A22B 5E2JA 1A4JB 1JWSB 1FV1B 2UVFA 5B38A 1RJCA 2J4WL 4KGJA 1G9MC 3GMOB 3RTQA 1MFNA 3HUJE 4JFXB 3SKOB 3HI1A 4KQ3L 3OGCA 4WV1C 3ILQC 5BRZB 4QNPF 4EQ2A 1XR8B 1YDPA 3MACH 1FC1A 3LKRA 5E95B 5FUCC 4HXAH 3QUMA 2OTWA 4G80A 2HLFD 4XCFH 4U6XB 2D9QB 1I9RL 5FYJE 5ILTH 1K5NB 4Y19B 1FZKA 3QCUL 4D9RE 5DD1L 4FZEH 1FH5L 3DVGB 1IAII 2W92A 4XAKE 3MV7A 1FGVH 1CD1B 2VH5H 1WIPA 4RQQB 1I7RB 1DANT 2YUVA 3VXSA 1ZLSL 3HUJF 5EOTA 3ESVF 1XEDA 5F9JA 3C60B 3HKFA 1YMMB 1DQJA 3HZKA 3OKOA 4OGXL 1KTDA 4IIQB 4YWGH 4ZFZB 4M7LH 5L7XL 4YHNB 4X6CF 4MGXA 3TN0A 1DCLA 1I1CA 1ZA6B 3OWEA 2Q3AA 3MNZA 5I1EH 4P3DB 5E2VL 4ODWB 1AGDB 5DEFA 3O6FA 3QT2A 5GJSH 3TH2T 2FR4A 2DYPD 5IT2L 1J7VR 1FVCA 4X7FC 2Q1EA 4JKWA 1J86A 4R26L 3SGEI 1HZHL 8CGTA 1AD0A 5IQ9A 4KUCF 4JRXD 1S9YA 4LLDB 5JLZB 3MFGB 2QSQA 2J1KA 2J3SA 4LEXL 4OB5H 5DGQA 2R2BB 4NN5C 1A7PL 5F88A 3CC5B 3RQ3A 5TDNA 3QIBC 2ZCKH 5E99L 4WVRA 3VFSA 4OCRH 2I5YH 3QCTL 4YHOL 3O9WC 3LVEA 1YEGH 4H8WC 5JDSB 4RISL 4ZPVB 4HPYH 1ZVHA 4KTEH 4GSDL 1I8KA 5D2LF 2NY6C 4S1RL 4QTHB 35C8H 5DMKB 1S7XB 1BWWA 2PYED 4S1RH 4LHUB 3S34L 2P42B 3BQUA 4AY0A 4X5XA 1TQBB 2Z8SA 4DN4H 5IMKB 4EQ3A 2A6JB 4CNIA 1NJ9A 5ETUA 3HAEH 3K4ZA 5IJVB 5I15H 4JDTL 1CZ8L 1J0IA 2NX5E 2COQA 3IDJA 5JNYA 1H8NA 4JHAH 4XI5C 4Z0XB 2HVKA 2VKWA 3I3EA 1FRGL 2EC8A 3A67H 2XT1B 5F9DC 4MXWL 2OSLA 3LRGA 5BVJB 1FVDB 3ETBF 2QKIA 1G7IA 5HYIA 1A7OH 1TXKA 4YNYA 1WGOA 4QT5B 2KQNA 1U3HC 1X5KA 3PV6A 3SDDD 2YN3A 1CQKA 4NNYA 2IMMA 1HKLL 3ZDXF 4NZRH 1GOFA 4PBWD 3EYFA 2E9WA 4GAYA 5I17A 1JGEA 4RAUA 5FYKH 3GSOB 2PETA 4FHBD 4MA3B 3S96B 5HPOA 2BC4B 1AFVL 4GBXD 5DHYA 1JN6B 1WZKA 3BO8B 1BVZA 3K2UL 3TCLA 1S9YB 4LLDA 5I2IA 4GBXB 4MXQC 1XGPB 1X5IA 1JZ5A 2DQFB 3S8WA 4C54A 5I19H 1PAMA 4NQEA 2AK4D 4HUWB 2CRIA 4JHBA 4MWFA 4P46B 5DJCA 1FYHB 3SHSA 2HLFC 4Y5YC 1A21A 1D7FA 3P0GB 2FIKA 1KJVB 4S2SB 2ICWB 2E6JA 2A6IB 3C2SA 4FQQB 2DQCL 2VLJB 5EOTB 4ZXBB 1GIGL 3FOMB 5CJBA 5HY9B 3BX7C 4PD4J 1YECH 1N64H 5H94B 5F97E 2V5YA 5GZNC 4V1DE 5E00B 5DFVD 6FABL 3MJGX 3VXRD 5K9OB 3E1F1 4ONGH 1M4KA 2VR4A 4PRIE 1PDKA 2LVEA 3EOAB 1KPUA 3MMEA 3ZDYE 4KQ4H 4C57C 1IARB 3V0VA 4ZS6C 4EOWL 4PJ9A 4V2CB 4D0CB 3QEQE 4GAGL 4G6JH 4LLMB 4WFFD 2G75B 3MFFA 1IGJA 4WCYL 1N59B 2BNQE 1J11A 2VSCA 2EDLA 1GGBH 1MFCH 3GUTA 2YXFA 4GS7B 3S3PA 3WO4C 4H88H 4ZNEA 2Y36H 5F9WC 3EJYD 2Y7QB 4HIJA 5FM5M 1ZVSA 2EH7H 2NYYD 3GMQA 3ZHKA 4LSUH 4O4YH 1WIOA 1MWAH 4U6XA 3RX5A 1D5ZA 3LKPA 3O6MH 5T1DH 1GYAA 3LS4H 3TNNA 5MERB 3C6SA 4LSDA 4JKPL 5GRZA 2EXYD 1BQUA 1GZPA 1VB9A 1GAFH 4BK5A 3RHWF 1WLHA 2VLJD 3GMMA 3IFNH 4YBHA 1GZQA 4BUHA 1I7ZB 2AJYL 3TBYB 4ZNEE 1JNLH 3A6OA 2WZPD 2BVEA 1CBVL 1CS6A 2F8VA 4LVHB 4FZ8L 4X99A 3VFMA 3JV6A 5KSUA 3SDCD 4M00A 1L7IH 1JZ3A 4M6AA 2AK1H 1IQWH 2DI8A 5FYKD 4C58B 4YHYB 1H9VA 2AK4B 1FRGH 3A67L 3SBWC 2FX7H 4Z7UF 3DURA 35C8L 3U2SA 4UBDC 1KB5H 2BSSA 5EZLB 3NGBC 5D7LE 2VYRE 1RZ7H 3MV7D 5C0NC 4DKEL 4F9LC 4HC1L 5EA0H 3HPLA 4WI4A 5IFHL 2A9NL 3W11D 5DT1H 3ARGB 2ESVD 3VFVB 3WNKA 4NC0B 5EUOA 4HX1B 2W60B 4HIEA 4Q0XH 4JZJB 2C3HA 1TZGH 2ZZUT 4ZS7L 5J57B 3O2VL 1I8MB 1PKQE 5SWQA 3QUYB 5IEKA 5KZCD 2ADFH 4M62L 4MCYB 4NZRL 3ARFA 5DJ6B 3W9DA 3T3MF 2F9BT 2HH0L 1IKNC 5JHLL 2DBJA 1MIEH 2V5MA 5KS9E 1OAUL 3OXRB 2XKUA 4M7KL 3LV3B 5HHQA 3VFRB 3VRIA 3VXSE 4G6AD 4XPGL 1MCKA 1TJHL 4JFOA 1JF6A 1MPAH 1UWGH 4R8WH 3HZVA 4LHUD 3LIZH 5D2LE 3MCKB 4P57B 3M45A 1VENA 3WFHA 4RBPH 4Z0XA 4DAGL 4MDJB 1A3RH 1ZT1A 2R2CA 1ED3B 1KCSH 2DBLL 4F9PC 1WWAX 1JYVA 3PL6A 1PYWA 1KELH 4HUUB 1MCEA 4ERSL 2F19L 1QFWM 3KJ4B 2R23A 2YPLE 4HUWA 1KENL 3PNWB 4JFPB 3QIUA 4AK1A 3KHQA 4XBPB 1B9ZA 2BVPA 2R69H 3QXUA 3SJVB 5BS0D 4OD2B 5C2BL 4WEBH 5DJAB 1MF2H 2HFGL 1RJZB 1RURL 1AE6L 3BO8A 1BFOB 4HH9A 1AR2A 2FO4A 2JJUA 2YD9A 3PABB 4ZFFB 3FO2B 3HE7C 1DFBL 1NFDA 3SDAD 4K7PL 4X98A 2ZUTA 2XWTB 5HGBA 4RAUB 1ZHLB 1TCRB 2EECA 1OAQH 2CO7B 4DN3H 4NFCA 5CJOL 3T2PA 1QA9B 2R2BA 5M94B 2D7PA 3IDYB 1NGZB 4NHCH 5HBBA 2ZOLB 3LQZA 1GJIA 1T7WA 3KPSE 3PV6B 3BGFB 4HBCH 2H6PA 4PLKD 4XP9L 2NQCA 3PWNA 5L8LB 2QSCH 4PJ9D 1YA5A 1B0GB 3S3SA 2I9LB 4UZGA 3MRJA 1ACYL 5KSBE 3U4EA 5I71C 4HFUL 2Z8WC 1JZ8A 4NIKB 1AY1H 3E3QC 5C0GB 1P4IL 2A9ML 4NRYA 2R1YA 1P6FA 4KRPD 5DUBB 4HWEH 1Q72H 1N5YL 3BPNC 1XH3A 4XNYH 4X9HA 3W39A 1K2DA 2E9BA 4YR6A 1J87A 3WNOA 3T0DA 3FTGB 4QRRA 3PL6D 4IMKC 4KVNH 3CX2A 5DC9B 3RVVC 1QD0A 5FGBA 2FX8L 3KYKH 4HJ0D 1BM3H 2FBJH 1XGRA 3LRSB 4LPCA 3WIIL 5JPMA 2ESVA 2NTFB 3DHMA 3HNVH 3IDMB 1I8IB 5FYLD 4OI9A 5K9OA 4KQ4L 4Z9KB 2Y07H 3GSUB 1FVDA 5C08E 4OD3H 2D4DA 1BAFH 4FABL 4PV9A 3DECA 3D39D 3ES6B 1UB6A 5D1ZA 1PX4A 3TN0C 3SE9H 1IAOB 4M6OL 4P2OC 1LO3H 2FJHA 1WFOA 3KLDA 4GMSL 4FFWC 2FO4B 3PABA 3OKYA 1G7PA 4J1UB 2WLYA 1HIML 4MWFB 1U36A 4Z7WA 1ZT4A 3WIHL 2ADIB 4N1EA 1OM3L 1DSFH 3VFGH 1X9QA 3C8KA 4E42B 2GTZB 1H5BA 2VDPL 1GGTA 2ORBL 4GLRH 1GZQB 2Z8RA 4CU8A 5JUEH 5J6HB 2JTDA 2Y9RT 1ZTXL 1P2CA 1P7KB 4YBLB 2NY2C 3MSPA 3QXAA 1KIPA 3V8OA 4LPWA 3KHOA 1E4WH 4KRMB 2C3VA 3PWJA 4JHWH 4M4PA 4NQCD 4OGYL 3SKUD 4OCMC 3VFWB 4FXKB 2HJFB 4X6CB 2MNUA 2QADB 3WFHB 1FPTL 2NY0C 3VFUA 4EN3A 3BPCA 1UGNA 1S7UA 5IVNA 3U0WH 3B3IA 1TDQA 3RNKB 3KWWB 1AO7A 3AU1A 3BQUD 2R9HD 4LMQI 3FQUA 1MFDH 1N6UA 5IB4B 5I76A 3SCMB 3H0TA 4JPIB 4PRPD 4J7RA 4ETYA 5DYOA 3GMMB 3NCMA 5GJTH 2F5AH 4G8EB 1N59A 5EN2A 4ZG1A 1PG7H 5EU4B 3BP4A 1L0QA 1S78D 2D2OA 1JI1A 4GOSA 4MNGE 1P7QA 5KG9B 3RL1A 1NL0L 2Y25A 5B39B 1DBJH 4CUCA 2FX9L 2R2EA 1ZANH 1HOCA 4G42B 1L7TL 1CT8A 2XQYG 3NFSH 3ISWA 5JXEC 4OLVL 1C8PA 3S97C 3C6LA 4RGNB 3WNLA 4OFKA 1A9BA 4HF5H 4F7TB 5HHNB 5EA0L 4IDLA 4ONOA 4FFZH 5I8EB 1KCSL 4KKBC 4KJYA 4ELKA 3DX9B 1NDMB 4N0FB 5EORL 3H9ZA 4OCXL 5E2TL 4RDQG 4YGVB 3VGDA 4LPYA 4NCC1 3RWJA 2MCG1 5FO7A 4U6VH 3GSXA 4N9OB 5JXED 2GAZA 4AMKL 1X5YA 5A16B 1QRKA 3CDFA 5GGTL 1RK0A 4AT6B 4HBCL 2IGFL 2C4XA 4K55A 3DPBA 3FO0L 5IMLB 2AKRB 1AJ7H 5C09B 3PIQA 4POYA 4QRPA 3RKDC 4ZAKB 1F45A 1IGTA 5D7LA 1I75A 4XAKD 4A2LA 4J4PD 4DFIA 2B1AL 1G9NH 1FNHA 1JUFB 4PUBL 5LBSH 3V0WL 1SMAA 2DF3A 4BQ6A 5LCVL 1YQVH 3TFKD 5DDHB 1H5BC 2E27L 2FJGA 3UPCA 4M61A 3MRFB 5JW4R 4LLQA 2J8UA 4LSVL 4LBEA 4N68A 4PRAA 4PY7A 2UWEB 3DMMB 5C6WH 3VGAC 5C2BH 4KRLB 3DX8B 3MCKA 4JDZB 1VA9A 4KY1H 5KJRH 2PF6A 4FQCH 1SM3L 2R9HC 5TFSH 3QNXB 4GJTB 3UTSE 2LABA 5IB1A 1YEFL 2NY0B 5EOCL 3QUML 4YFEA 4ZMAT 3LS5L 1W72B 1EHXA 3QNYA 1QO3B 4N8CL 5T1MA 3B5HA 4M4RA 5E8DH 3SDAC 4MS8C 3UJJL 3OZ9H 2DWEB 2PYEA 2AXGA 4X6DE 5FYLL 2VL5A 4B7IA 4PJCB 1IQDA 5I8CB 1ZHKB 1DUYA 3P0YL 4WU5A 1Z5LA 5F1NB 5CEZH 2A2QT 1PSKL 4WI7A 2WIMA 4F7TA 2DLFH 4AG4H 4JCMA 3CUPA 4YC2C 4FZEL 4XP4L 4PJAE 5E99H 3WSQH 1A7QH 5F1KC 3PE9A 3MJ8B 3IDXL 3MA9H 4KKLC 1Q9OA 3G5YA 1Z3GL 1EBAA 3B4NA 3BIAX 5IQ7H 2PUQT 4KHTH 3O11B 3E2HC 5J1TC 5HHVH 1RMFH 1U58A 4PJ8A 3FHQA 1P7QD 2JELH 1YUHB 3RTQD 3UEZA 4OKVA 5E2VH 3WIFB 5FGCE 1BFOA 3EYQD 5E6IC 2W38A 3QCVL 2A9MH 5D72L 5IKCA 4B53A 1IBGL 2PXYC 1DP0A 3QQ3B 4HK0B 3PQYA 1IAIH 1GAFL 3O45B 4MVBD 1U8PA 5D9SA 3AM8A 1S5IH 4GLRI 4KRNA 5C9KA 2EDEA 2E7LC 2CUMA 5EUKB 2GCYA 5FA3A 4CBPA 1U3HB 3MO1A 2BVQB 1NGQH 5EDXA 3BRGC 2NZIA 1QLEL 4PP2A 4LRIC 3ILPA 1A7NL 5EBLA 4N0UB 1SYSB 4RA3A 1DSFL 5KSBF 5GJSL 3S98A 2WAHA 2V9TA 1K4CA 2CO6B 1NGWA 5SX5K 4Y19A 1EGJA 5I73B 3MRQB 2VXUH 3O4OB 2GTZA 3SQOL 2VDLH 2CRMA 1Z5LB 3TJEH 4XP1H 1XF4B 3U0PB 5CMAA 1F4YH 1HE7A 3TEUA 4IRSA 2D0HA 1G7PB 4J1UA 5I1CL 4UQ3A 3BE1L 3CFEB 3H3KA 2R2EB 2DD8H 5F9AC 5DS8A 3FKUS 2WUCL 2YUXA 1BF8A 3GKWH 3H42H 3KPPB 4JFDB 3VXPA 1WT5A 1MEXL 4XMKL 3P0VL 1OD7A 4LHUA 5LCVH 4FQJL 4PJBF 4HG4K 4GRMA 4NSKA 3NIDE 4QGTA 4KKAD 3DYMA 4PJ9C 5CP7A 3O6FB 3B9KD 1A9EA 4PYHA 1K5NA 1RZ8B 4YE4H 3GMLA 3SGKA 4MQ7A 1I8IA 2I9TB 5LGJB 1S7QB 3NFNB 3SDDB 1UWGL 4M1GL 2O61B 3EYOA 3ILQD 1Q0XL 4YXKL 1XR8A 3JTSA 1H3WM 4XWGL 4LKCA 1CFBA 3DUSB 4Q6YA 2FWOB 4UAOB 4UU9B 2DMBA 3L9RA 3PWPE 1HHHB 3CFKA 5JIIA 3U9PH 4YDLC 4ONGL 3QAZC 2HKHL 3EW3B 3LOWA 3NCCB 5IVXE 2NW2A 4G9FB 1X5LA 3UPRB 5J6HA 2BVTA 3STZB 5D7JD 4DQOL 3GJFH 4LNRA 3OAUH 1RJYB 4ZPTB 5CD3B 4TUOB 1P4IH 5ALBH 4LCWB 3O3BB 3SJVE 4WFHE 1YMMA 1IGCH 1TZHA 4J6RH 1EEZA 5CWSA 5E8DL 3UJJH 5TQ0L 1GGCL 4WEBL 3OGCB 3FQTA 3QYCA 3U0TA 3WHE1 2IALA 1MJJB 3MNWB 3QNYB 4OZFA 5HYQA 1BEYH 4WUKH 3RWJB 3FO9B 3QA3B 4PGEB 4N0YL 2AEQL 2NY2D 3MLSH 1HHIA 4V1DB 3R1GL 4D0DB 4GRWF 3GMRA 1S7UB 3O6KH 1I9IH 4LRIA 4KJYB 1FG9C 4Q97A 1OAQL 2OK0L 2UWEA 4PRAB 4NZJA 1R3LB 5FDWB 4GS7C 5JNYB 3NACL 3SPVB 1S7VB 1RZJL 2Y06L 4G8EA 1JNLL 3QDGD 1KLGB 5GGUA 2YPLA 3RGHA 3ZKNC 3O0RL 3G5XB 1RIVL 1BIHA 1QO3A 4JFXA 3BN3B 3SKOA 1IGTB 3FCTA 3IDIB 5D6DA 4ELMF 3IKCA 5E9DA 3Q1SL 4DK3A 3UYOD 2VLKD 5I74B 2V7NA 4WEUD 5MENA 5F6HJ 5LWYL 1RD6A 1LE5B 3C08L 1VCAA 4BSVA 4GRWB 4AIZA 5INCB 3KLSA 2ZUQC 1RIUH 3O9WA 2PYFB 4TULL 1NAMH 5CP3A 1NCWH 4HT1L 3T2NL 2UYLB 5EBMA 5EO1A 3M8OH 5CD3A 3AMKA 2KBGA 4P9HH 5D7LB 5K9JH 3MOBL 4R97B 4UV7H 4UQ2A 4O2FB 3UJTL 1T0PB 4U1JA 2AEPL 4KDWA 1U91A 4Y16B 3D48R 2YD4A 5A16A 3L5HA 1MI5A 4EUPG 1DBBL 5J7CC 2Z93A 4NQDB 1KCUH 2BNRE 1WAAF 4IOIA 4PRID 2OCFD 3TJEL 4D0CA 3OKKA 3JV0A 4XCEA 3TH4T 4AZ8A 1Z2KA 1WAAA 1U92B 3O6LH 4ISVB 2XG4A 2QSVA 4WFGD 4ZUVB 2BVOA 1DVFB 3FONB 3P11L 5KAQG 5FGBC 2VAJA 1JK8A 3OXSA 3WNMA 4YDJB 2P43B 1BIIA 5E03A 4K9EL 15C8H 4MJID 2FWOA 1FZMA 3UAJC 1K6QL 4NKIH 4CU7A 2IFGA 3NPSB 1D6VH 1IM9A 5AAWA 4I2XB 2R2HB 4FQ2H 1NCNA 4TUKH 1OW0C 2DQIH 3MRMB 5IHUH 5EU6B 4WI8A 2Y72A 3DXAE 1IKFH 1H3PL 4PJDF 1U3HA 3MO1B 5IHUL 1KJ2H 1C1EL 2DLIA 4X7SL 1EAPA 5ISZB 1T0NB 4GKZA 4P2OA 5IVZA 1AXTH 1XF4A 4K7PH 3O45A 2RAMA 3ARED 5IG7A 4RAVB 1JYWA 1JHTA 3LH2L 3ZDZE 4WV1A 3QI9A 2FATH 5DFVC 5JIKA 5DSCB 3LAFA 3RZWA 5BZWB 2V2WB 1IILE 3ECBB 5F7KC 1S8DA 2BSRB 4HIJB 5DRWA 4YHZL 4PJCE 3FL7A 1N6QL 3OR6B 4MAYA 2QTEA 2EDTA 3QA3A 4M7ZB 3GHBL 4PGEA 2R56H 4X4YA 1SYSA 4P5MA 3U0PA 3LKOA 5I1DB 3KPMA 4E9LA 5H35A 1KC5H 4UTBH 4MXWH 4UMGA 4PRHD 4LCWD 3C2AL 3JWOC 3I50H 3REVB 3Q5TA 4ERSH 1ZWIA 4HKXB 3HRPA 2M8XA 1F4AA 1CE6A 2O5YH 5FUOL 2MQ0A 3N85L 4TUOA 5D9SB 1YECL 5D7LD 4M7ZC 1LK3L 4ZUSA 5ADPH 4L3AA 1FZJB 4FQCL 1AP2A 3ARDB 3X3FL 3MV8A 4WFEE 3CZFA 4K94L 4XCNB 1HHJA 3X11A 4FXGB 5KS9B 5F8RC 4XNXH 3PP3H 5CINH 4LIQL 3TCXA 3FN3A 4C83A 3QDJE 4ODTL 1KG0B 4AEIH 3QQNA 2OS7A 2O26U 4U3HA 5GS0D 2BCKB 5F9OL 1M6OA 4GQ9L 4HWZB 1CU4H 4JO1L 5KJRL 4XPAH 3U82B 3B9KB 2X89D 1PGRB 3WEXA 3MV9E 2WK2A 5FYJH 1PQZA 4O2EA 1BHGA 3VFRA 3U4BH 2EDDA 4EXKA 3MQIA 5F6IB 5BXFA 4JEGB 1AXSA 4QOKE 4YJZL 5MHSD 2CIIA 5GISH 3WFDH 3S88H 4PP1D 4U1GC 2RR3A 1LQSR 2CDGB 3IU3A 2Z0BA 4M48H 5D6CA 1UWXH 1MUJB 3D9AH 2E7CA 3MV8D 4UT6H 3QUYA 4JFYA 4KV5F 5IEKB 1AI1H 4MCZB 5ID1B 4WI5A 4NQCE 1FAIL 3TF7C 4HKBA 1HSBA 5K93A 1VKXA 2NY2B 4V1DD 3U4EB 3VDCA 1ADQA 2E6QA 3OXRA 4XVSH 3OR7B 4N8VA 2X1XR 4HS8L 3MFFB 3UZQA 1WT5C 3LKNA 3O3BA 2NY6D 4Z7VF 4PJIA 1NPUA 4L3EE 4F9LA 3F7YA 2C1PA 4K8RD 4LCIH 4PJXB 5DVLA 4OZIF 3LSOB 4P5TB 5C0EA 4YHOH 2Y5TB 3L3IB 4LCCB 3K1DA 2YPKA 4WFFE 2IQ9L 3T2QA 1WUNT 1CGTA 3EYUH 3D18B 1ZT7A 1NC2D 3VFNA 3OX8B 5AYQA 4TSAH 4Z7QE 1T6VN 2XWTA 5HGBB 4MD0B 4HK3N 3CFKB 3GMQB 1RIHH 4KTEL 4MQTB 1D5MB 5L9DH 3EBAA 3N06B 2BY0A 2CLRA 4YIQB 1BAFL 2O5ZL 2Y06H 3SJVA 1A14L 5TPWL 2CK0H 4K2UL 3RJDA 2QADC 4O5LH 2MCPL 1SJEB 2IPKA 2FEEI 3HCVA 4L3CB 4HULB 4Y4FD 4JFFA 2HT2C 5DEGA 2ITCA 4RGNC 1UEMA 3GHEH 3DVIA 2UZYB 1SBSH 5SWZA 3OKEB 4R96B 4LVNB 1MWAB 2IPTL 3U0WL 5KVFL 4UIMA 4PJFB 43C9B 3VG0L 1CLOH 1MUJA 4JRXA 3WO3B 3MROA 2CGRH 3EFDL 5HGHB 1F3JB 1ORSA 3G6DH 2PKDA 2F58H 3I6KB 2BVOB 2ARJB 1AC6A 1CDIA 2NW3B 5J4MA 8FABA 2VXQL 2JLLA 3BHBB 3EOTH 3KPSA 4KDVA 5CZXC 3BZEA 4JKMA 4MX7B 3OQ3B 4JN2A 5T3ZD 3EOBA 1BPVA 1T1XA 4DN3L 4ZTPH 1G6RL 1JBJA 3RY6A 4Z7VB 5ECJE 3GKWL 2B5IB 3RIAF 5DR5H 4PJDB 5I6XB 1T7VA 3VG0H 1OAYH 1FN4B 2O5YL 3QDGB 3MRKB 1A7OL 1AXIB 4JRYA 5ID0A 2EDFA 1QFWI 2H32H 1C08A 3UTSD 4JGUA 1RURH 3AS3A 3D25A 3DARA 4G6FD 2BHYA 2UYLA 3D3VB 1IC5L 1IEAB 4YK4C 5HHOE 1YPZA 2PYFA 3FMGL 2NY4D 4PJBE 2CLVA 4M1DL 1NFDF 4ETQA 5DJ2B 4MA8L 2A77L 3EYFB 2D03H 3ARPA 2J7LA 3L3OB 3UTSB 1I1RA 1K6QH 4NKIL 2FATL 3NBNA 2W0FB 4P57A 5FCUH 3TBVB 4U05A 3AS2A 1MLCA 3FQWB 3P4OB 4GXVH 4ZSOE 3O11A 4XVJL 4F2MA 3MRPB 2APXA 4JPWH 5L2KD 3VW3H 5FO8B 3VI3E 5EZIL 2WINA 4NZUH 1DDHB 2J2ZA 3JTTB 3S36H 4WTWA 3QJFA 1SY6L 2W0LA 4U0RB 5T3ZH 5BVPL 3OBAA 5I0DA 4PJIB 5DQDL 1KTLB 4JM2C 2HRPL 4IM8A 3EYQC 43CAA 4OF3A 4X6DF 4NNYB 5GS2H 3SDXE 2VERN 2ZSVA 2QLVB 3NIDF 4J3UA 4A6YA 3MLRH 1DUZA 4IRSD 4D0BB 2XKNA 1I8LA 2WUBH 5HYJE 1KPVB 1HDMA 2G2RA 5IBUG 1RMFL 1OB1B 1FJ1A 5FIEA 4GW4A 3RJQB 4DZBB 2VAAB 2N7BA 3CFIC 1A6PA 1HOCB 3UZEA 4QO1A 5EBLB 1CDYA 1Q72L 2CXKA 3AB0B 5JORA 4I3SL 2D7OA 2FGWH 2E27H 3B8SA 4CN6A 2AGJL 2YD7A 2AQ1A 3MRLB 4M48L 1KPRA 2MQCA 2O5ZH 3VFWA 2EEDA 4WHTA 4U0QB 5BQ7A 5BS0A 2VLKA 4Q2ZB 2R0WH 5IG7B 4ELME 3VMNA 4K3DL 3L95A 4BQ9A 5IVXA 1QBMH 5JW4N 1KXVC 2G5BA 2HN7B 3DMMD 2VH5L 1L6XA 5C6TH 3SCMA 1FIGH 3AREB 4LU5H 2ZSWA 3QH3A 3QIBA 1KG0A 3RVTC 3H9SD 2ADIA 2OM5A 4UDTB 1DBBH 4WW2F 4ZAKA 1PW3A 1VFOA 4M43H 5CGMA 1NC2B 5SX4H 5INDB 1S7XA 3V2AR 5D7SH 4MNGA 4LK4A 3WDIA 3CFJB 5F1SA 4MAYC 2GAZB 1Y0LB 1B4JL 1IC4L 2DAVA 1XIWD 1S7WA 2DWDA 5C2UB 1WC7A 4IEFB 3HZYA 4XVSL 1T20B 4ZS7H 3KAAA 3BKJH 1CD1A 1CDCA 5LGJA 3BISA 3QI9C 3TJHD 3KPRA 3G9AB 5KVGH 3NN8A 3HRZA 4GFTB 1SBBA 2NY3B 3CXDL 2V2XA 1C5BH 4LLUB 5AZEL 1MCIA 1P84J 2NY5H 3MNZB 4R90L 3QDJA 4I9WE 1AR1C 1DEDA 3EYUL 3FB8A 2PW1B 3DVFA 2ENYA 4LSTH 4WIQA 4EIGB 1H8OA 2ZUXA 1XGTB 1MREL 5IEHB 4Z7WB 1FGNH 3IJHA 4NP4L 2VABA 4OGAD 2DQDH 3WNPA 4M6MH 4F3FB 4LPUA 1T1ZA 4HQQL 1U2CA 4GAJL 1QNZH 4Z78A 1AD9B 4ZODA 2C4FT 4KTDH 3ULSA 3G08A 4NKDB 5CZVH 4OLXL 5I1GH 1UM5H 1NAMA 2ZUQB 3AAZA 3D5OF 4OLYH 5ICYA 1DQDL 3ARBA 5HI3D 1F90L 1WBYB 3KLHC 2XNAA 4FMKA 1HQ4B 1CTOA 5HGAA 5FUZL 5DHVA 4ZXBA 2ADFL 4Y4HA 3E6HA 2MKLC 3MRNA 1A7NH 3KS0J 1L6ZA 3CXHK 1JUFA 1G7QA 3H8NA 1INDH 2YUZA 3SDCA 3BQUB 2AV1B 5ERWA 3MODL 1XIWA 1DUYB 3HI6L 1YYLL 4G8GA 1MCCA 1R5IB 3QWRD 4NCDA 1VDGA 2IH3B 3GK8H 4JANB 1WBZB 3MJ9H 4KZEL 1T22B 1U42A 2DIJA 5AWNH 2Y5TA 2FRGP 2GJ6E 3L3IA 5BRZA 4MD4B 2OQJA 4JN2B 5DMYA 1Z6JT 1JPFA 1JFQH 4L1HA 3GI8L 2XQBH 5CILL 5DK2A 1A1OB 3QEHB 4QRQA 2QQQA 2AKRA 4XMLH 3WCYA 1FNSH 1EAJA 3H9HB 5FV2A 1ZANL 1LEIA 3FQNB 2GI7A 3QDGE 4JQIH 2K7PA 1ZKAA 2DJUA 3PHQA 3GMNB 1X5JA 4LHJB 5J1AB 5I30L 3DX9A 8FABB 5EU7E 1RUML 3JUYA 5F7DB 2NR6C 1G9NC 4FQLH 4JO3H 4RFOH 3ZKXC 4YBQC 3IXTA 4TVPE 4H1LB 5T33L 3DRTB 1QQDB 4JDVA 4KI5C 3ULSB 1KIQB 3HHRB 4PJFA 5DJ0A 2X4UA 4M6NH 1YEEH 4HZLB 5DMIH 1G7MB 3CNKA 4LNRB 3W0WA 1VADA 5ABDE 5D7IF 5DRNA 3LS5H 1VGKA 4JM2F 4JZOA 4P23A 3T1FB 3WIIH 3GJEA 3VA6A 3F7QA 1BVKB 1U3ZA 3LKQA 5H94A 2AP2A 5AD0B 5FKAA 5FECA 1MAKA 3MRJB 3NFNA 4U2ZA 3O2DH 3FRUA 3D3VE 2VLMD 2G2RB 3T0EB 2ZJSL 1GGIL 5IM7A 2AJVH 2RJMA 3L3DB 5GRUH 4PJ9B 3K8LA 2X4NB 2GUOB 1A6WL 4OSUL 4XXCA 1NMAH 2VSDA 3L3JA 1OLZA 4D9LH 2VN7A 2YZ8A 3MPCA 4NM8L 5IBLC 4YDLB 3NIFF 1WV7T 4NKOA 1S9XB 1R3IL 4U6HA 2AXFB 1UB5B 3I3DA 1J8HA 1FNFA 1II4E 4Y2DA 5B8CC 1DEEA 2DLTA 3F7PC 1RJYA 4NHUB 4ZPTA 4UILH 5C7XL 3TO2B 4RAVA 3L6FA 1B3JA 3U7WL 3TBWA 1LWRA 1OTSD 5HI4C 1NCCL 3QB7C 3DV6A 3VE0A 3SJVD 5AZ2L 4QRSA 1QSFD 1T04A 4H1LG 1UJTA 3RGVD 3ILPB 3U83A 2YR3A 3ORJA 1J9CT 4UB0L 1AKJD 1CGSH 1DL7H 1NGWB 1DQML 2BJMH 4JPKH 4MA7H 4PJXF 2NYYC 4FQIL 1J10A 3GIZH 1M7XA 1ZHBA 3DO3A 1VADB 2X89A 5KVDL 1J0ZA 5HVHC 3BOVA 3DOSA 4LF3A 3V52L 3SKMB 4WUUB 4KI5F 4MA1B 3P4NB 3VXQA 4NZDA 5IHLB 3QFDB 5ESAA 1KB9K 4LPTA 3LEXA 3H9SB 3HS0B 2AQ3A 4YXHH 5D7JC 1DVFD 1UG9A 3VWKB 5FKPB 1TENA 1EO5A 3E6FB 4IOIB 5I16A 4F3FA 4RIRB 3L7EB 3ZSTA 4XCCL 4JRXE 4KK5C 3GIZL 4FQIH 3FT4A 3PG2A 2AJSH 4LCYB 4WFED 1XCQB 5DJXB 2IPTH 3PQYE 3NA9L 3ARGA 2HKFL 4L4VD 2VLKE 3SKNB 2GJJA 1NCBH 4N9GA 4M8QB 5TDOB 1ZS8B 4L1DA 3G6JF 1NKRA 1IC7H 2O93L 1C1EH 3T1WA 1EV2E 3MRQA 3RNQB 4J3WA 1GGUA 1IC7L 5I18L 4O58H 1YEJH 7CGTA 1D5BA 2Y6SD 5IIEA 1A6VH 4HUXB 1RVFL 3KXFB 2JCCE 1DBJL 3TA3B 5KS9F 1NCDL 2VDKH 3D0VA 4NP4H 4LP4A 4R3SB 4UUJA 2KPNA 1JE6A 3UTTB 5C0AD 3S5LB 1NMBL 4YDVA 3TC9A 5CEZE 2VNCA 5DFWH 5CIPB 3QIWA 1BOYA 3LKSA 2HWZL 3LB6D 4POZD 4Z77A 3FTGA 4QRRB 2J6EA 4AEIL 3UTQA 1KC5L 5MHSE 1CLCA 3U4BL 2VXSL 3RWCB 1TJHH 3IJYA 4DCQA 3F6IA 5L2KB 3LPFA 3LHPH 4P99A 5M7QA 3HRZB 3W2DL 5J1SC 1E6JH 2Y1VA 4HJJH 1CVSC 2XTJC 1FNAA 4TTDC 2ZKHL 4LHQB 1GGIH 5GIRA 1LO3L 2IJ0C 2A6DA 5SV4A 1HSAA 4H26B 3HMXH 4WI9A 3CVHA 3I6GB 4L5FL 3S4SG 4KK6C 4UAOC 4F33A 3QUMB 1ZA6A 2FYYA 1YEIH 5F7WC 5T33H 1KSRA 5IJKA 3GMNA 4NM8H 4OD3L 2FEEL 5DO2D 5DZNA 3I84A 1BJ8A 4P5TC 2V9QA 2N1KA 4Z95L 3DX7B 5D5MB 4G6FB 4GXUN 4P3WA 4ZFFA 2M26A 5F6IC 4KMLB 1RJZA 1X6NA 3L1OH 2IC2A 2HTLC 1I7RA 4MA1C 1WEJH 3MREA 4H1LA 4QRPD 3LN4A 4L9LA 1CDGA 2W9LA 3C60A 4GH7B 1MHHA 4PJ5B 4PY8I 2OJZH 4N5UA 5ICZA 1I1FA 1IM9B 3ZSSA 4KZDH 3F5WB 1F97A 1W72A 4UV4H 3EKCA 1RUQH 3SKJH 4PGCB 3S5LG 4Y5XA 3MJ7A 3P40A 4O02H 3KWWA 3GJEB 4K3DH 4Y8AA 2FB4H 3FONA 3L3KB 4H5SB 5JZ7C 4CDGC 4WGVB 3DTXB 5C07E 4FQQA 3DNKA 5ANME 2AJYH 2ATPA 3V4VH 2B0SL 3JVGC 4APQC 2A0LC 2UVEA 3WSQL 3EAKA 3QEHA 2CJUL 4QRQB 3WLBA 3BP4B 3CFBA 5KN5A 4OZIE 3JSSA 2P8PA 2GSGB 3DGCR 2BNUA 3EYVB 4XB7A 1D6VL 2EKSB 5H37H 3VRJA 4HLJA 2GFBA 4PJ5E 2XPGA 4I5BA 1MHPL 4GG6E 1QRNE 2M2DA 2X1OA 3SY0B 3D85D 2AJUL 3C6LC 3F6LA 5GS0C 3TV3L 1MVUA 2FL5B 3KYOA 4WW2A 5T3XH 5D2NB 5C0CB 1NGYB 2VDQL 5I1AB 3PHQB 1VEOA 2EDQA 5T3ZE 4X9BA 5A2FA 2P5WB 2VJXA 4OF8A 5C0IA 4DZ8B 1YJDL 1R5VB 3BD3A 3TZVD 3ULVF 4POUB 1JGEB 4EDXA 1Q9LB 4E41E 1LD9B 5I8KL 1NLDH 4QCIB 3LH2H 5BOZG 3ULVC 2VDOH 5HI5C 2MCPH 5C0FB 4M6ML 1OAYL 3BAEL 5EO0A 3BKML 2Q76A 1IEBB 5F7HA 4JR9H 4R97C 4S1QL 3ZKSD 1J1PH 2ZCHH 1OL0A 5JHDA 4M7LT 4KPHH 1QNZL 3NH7H 1G9NL 4Y4KA 4AM0B 1REIA 4PJIF 2VXSH 3MV8E 2R39A 1CR9L 5C9JB 1MCQA 3TPUA 4PRBA 3TNMB 1KNOB 2HYMA 4QRUA 3ABZA 3IVKA 3NA9H 4U1NA 3DMMA 3MV8B 4F57L 5HXMA 3T4AB 4OBRA 1ES0B 1UH4A 4JPIA 1INDL 3QWOB 3RWDB 1TNNA 1YZZA 1G7LA 4WO4C 1FHGA 3TVMD 3MGOB 1INQA 3T0XA 5FUZH 3HA0A 3RTQB 2IADA 5JXAH 1ZS8A 1LHZA 4XH2A 3RWCA 4XNQB 1YYMH 1OCWL 5J3HC 3HPJB 1I7ZA 2OP4L 2OR9L 2GJ6A 3QEGL 5BRZE 5BVPH 4F7PB 1IAOA 4F15C 3JWDL 3MC0A 4QYOB 1OY3B 1I9IL 4I77L 3MLWL 4R3SA 3VWKC 4RGND 5E00A 1NDGB 3P2TA 5ADPL 3ARBC 2B5IC 4G43A 1JGDA 1OSZA 4NT6A 3ARDD 1HINH 4ORGB 3PWUA 3C6LB 3GSUA 3IT8D 5D4QA 1I3GL 4EJ1C 3QCUH 4NRXA 1NCUA 4JQVA 1E6OL 1Y0LA 5EORH 2FGWL 5CLWA 2AGJH 3ES6A 2PN5A 3GFUA 1JZ7A 3B9AA 1QSFB 4M1DH 5I1KH 4PRHE 4LCWE 1MJ8H 2OYPA 1ITCA 5LQBL 4PLJD 1BLNA 4QXUL 1MWAL 1SYVB 3DMMC 5CD5D 1NUNB 3D0VB 3GRWH 4NBYB 4U6YA 4L3CA 5J13C 1MFAH 4TUJA 4IDJH 2WWKO 3G5ZB 1T89C 3X11B 2X70A 2Z91B 3EOAA 5DDHA 1BQSA 5DRXB 1LO0H 3QJHA 1VERA 2FBJL 5DJ6A 5FA3B 4RAHA 5J0BA 4M8QA 1YMHB 2UZIL 2FH8A 3HC0B 4WCYH 3BKYH 4ZTOH 4LQFH 4Z95H 4NQVA 5MP6L 5FO9B 4OCWL 1CIUA 1Y6MR 4FN0A 3RU8L 3JZ7A 4EDXB 1UVQA 1KJMA 2PCPB 4UDUB 3EUUA 5JLZA 3M17B 5BZDB 3NOIA 4HEPG 5GS2D 1BD2B 3HMXL 3FT2A 5BMFH 4OZHF 1NGPH 5DGRA 1XR9B 4GMSH 4BZYA 4MJIB 3QHTC 4JG1H 5BMFL 1TZHB 5A40E 1IL1B 5C3LD 2D31B 2I27N 3FT3B 3SY0A 1XGUA 2OMBA 5EZLA 4XWOD 1ORSB 3VI4F 4HK3J 3Q3GB 4NBZB 3IGAB 1HCFX 3MROB 4NQUA 5HDOA 3G5VB 3SQOH 2V5RA 5FO8A 2EEBA 1FP5A 1C5DB 5LGHL 5HYSB 4HWNA 5KVEL 5TQ2L 2CKNA 4PD4K 5GGRA 3CUPB 4NQDD 3QXVA 2D9CA 3HC3L 5JPNB 3C5JB 4WJ5A 3ARVA 3MRCB 4H5SA 4HX1A 4NQCA 5EO0B 2OXGA 5KVFH 1DQJB 2WLZA 3HZKB 3OKOB 4ZFZA 3CSYA 4DTGL 2JJWA 2WQRA 5HTSA 5F8QC 3PL6B 4NM4H 2BSSB 1NUFA 1O7SA 3TIEA 3V7AE 1XGRB 5JPMB 5DD0L 2H8PA 3GMPA 4X9GA 1SY6A 1CLZH 3BSZH 1WCBB 1FGNL 2EYSB 1UM4L 4JRXB 2FGZA 5IGXH 3F12A 3D39E 4OFYD 4XVTL 1D5MA 3QBTB 3RAJL 1LO5A 5GS0H 1C7TA 2FCBA 5J1AA 1UJ3A 1XF5B 4OCXH 1HDMB 2IF7A 5I1JH 1RZFL 2I07B 2BX5A 4LVHC 4X7SH 2X4PA 3CU1A 3S34H 2W9DH 4W6XB 4NJ9L 1QRNB 1HXYA 3U46B 2EKSA 5BW7A 3DRTA 2XWBB 5HI4D 3BN9D 3QHFL 2DWEA 3ROLB 4NGHL 4F7MA 1KN2L 1U8OB 2DQDL 4MMXC 3K81A 3T4YA 5D6DC 12E8H 3UMTA 1PJ9A 2HH0H 3MRPA 2WBWB 3UPRA 1X5XA 3P77B 5KSAD 4HFWA 3MRRB 4RZCB 1DQTA 4XX1G 2ATPB 5F72S 1S3KL 1U8KB 2WBJA 3RVUC 2Q7NA 3V5DB 1KCRL 1N26A 4K7PY 3K8KA 1N5AA 5HDQL 2QR0A 1JTTA 5EZJA 3V6BR 5F89B 2DM3A 2W9EL 5GGTH 1UWEH 2AK4A 1CDUA 4WI3A 3S4SB 1QUNA 5HHXL 4NHCL 3QHZH 2GTWA 3KPNA 4IMKA 3VWJC 4GQ9H 3HB3C 2R0KL 2YBRA 1FFOA 5IF0B 4X9FA 3UBXB 2Q8BH 4OQTA 1YEDB 3TNMA 3V4PL 1TMCB 3TBSB 1YQVL 2Q8BL 1A5FH 2J6EL 1RVFH 4AL8H 1A9EB 3U9UB 1IAIM 2CMRL 5D1XA 1FN4A 2IH3A 4JANA 1Y6KR 3VGBA 3VXTB 3MODH 5LQBH 1A6ZB 1MLBB 2PW2A 4LPXA 2W9EH 3CLEL 1AO7D 2CDEA 1L9NA 4WI2A 5F7YC 5HVGB 4EBQL 4G9FD 1LK3H 1OF2A 3D9AL 3ALWA 1E6OH 1N6VA 1VPOH 5DD1H 1MCLA 4AJ0A 5E1HB 4J8RB 2NY3D 4YPJA 1N8ZA 1VPOL 4WU7A 4ZUTB 1RULL 2OJEA 2ZJSH 4DZBA 2NX5A 5AYUL 1HH6A 3RVWD 4Z7OF 3ZDXE 2H6PB 2Z92A 4OFDA 1OPGL 1IGML 4XT1C 4BQ8A 1FBIL 3HZMA 5FYLH 1R0AH 4HIHA 1OPGH 2ZUYA 3MLUH 3ARGD 4L4VA 1FAIH 1T1ZB 3O6FD 4Y88A 4NYLB 2YXMA 2HG5B 2PTVA 1ZAGA 1QSFE 5GGRB 5JQ6H 1L7IL 3JWNC 4G8GB 2DQJL 2Y36L 3DLQR 4G5ZH 4MZ3A 5TDPB 3BJLA 3JWOH 4FQXA 3TZVB 5B38G 1XGYH 4FFVD 1MFCL 4J4PA 4NQSA 4UI2A 1H8SA 1G7QB 4ODUA 1KJ2A 1LEGA 2NY7H 5DWUL 3ARBB 3AREA 2YWZA 1F13A 5ICXB 1BWMA 3B9KC 4N0YH 4Z7OE 1MY5A 2WNGA 3QJHB 5B22A 4AEHH 4BFIA 2X05A 4A2MA 3RUGE 1G7LB 3VXMB 4FMFA 1F4WH 4FZ8H 2OBGA 5TE7L 1FNLA 2ESVE 1FH5H 1ADQL 2IAMB 4XVTH 3RAJH 3SDCB 2D7TH 4HUVA 3MRMA 1UVQB 1BJ1J 4J4PC 4XPFH 5CJXC 1ZXQA 3QXAB 4YHIB 3QUXD 3JTSB 4I48B 4OCWH 4CN1A 2QQNL 4P3CH 1YMHA 1OTTD 2E5EA 2YRPA 4QHLB 1WAAE 3TN0D 1AD0B 1Q1JL 1ZA3A 4RX4D 2EIZA 1U8IB 32C2A 4WW1B 4ZDHB 2D31A 2CUHA 1IL1A 3EFDH 3O4LE 4S1QH 5ELIA 1FYTD 4DGYL 3H3PL 4NT6B 3RZCC 3UYRL 4JG1L 1TPXC 2GITA 1PX3A 3LKPB 3WHXA 2A73A 4K71C 3VXUB 2AV1A 3RWGA 4ELMA 4MNQB 2WIIB 3BUYA 1ZLWH 5T5NF 4NOBA 5DJYB 4P59L 3LDBC 3CVIH 2JKXA 4L8DB 4P3CL 2C4FU 1T20A 3QUYD 3IRPX 5J06A 3UJIL 1W0WB 1CGUA 1BREA 3GB7B 4G6KH 1ZK9A 4XMPH 4LLUA 4KI5E 2ESVB 3LZFH 4KXZH 5DEFB 4ZO9A 4L8SB 4G7YL 4O51B 1CGXA 2YEZB 5DJAA 1DBKH 3D3VD 1YY9C 4UOW0 4DVRH 4AIZB 5HI5D 2P45B 2N7AA 2JK5B 4LLYB 4P2QB 1CLZL 1F42A 2DJ4A 3BSZL 4IRZL 5HYSA 1CLYL 4X6EA 1MVFA 4XXDA 3P73A 4LLWB 2IANB 4YE4L 3MLTA 4PJGB 2F54A 1I85A 3RWEB 3GBMH 3RDTC 4K3EH 1QVOB 2CD0A 3EZJB 3LCYA 5EOCH 4TRPL 4IS6B 3FB5B 4FQHB 4NO0B 3LZFL 5CJQH 1MCSA 5FCUL 1RUAH 5GRJL 3E8UL 5E6ID 1RUKH 3Q48A 4HUKB 3X14A 1OGAE 3VFPA 3BZEB 4Z7WF 1FQ9C 1HYRC 1QA9A 2VLRE 1FFRA 4N0RA 1CFVH 3LKRB 2OXHA 1A6AA 3RVWC 3UTZB 4GUPB 3VI3F 3CFJA 4LRNH 4RNRB 3BD4A 3VD3A 1CXKA 1WBXB 3SE4A 3S9DB 4XZUA 3FB6B 1OF2B 2HJLB 2XN9A 3NCJL 1WBZA 4P5KA 5IKCB 2H3NA 1FFNA 1GCFA 5DWUH 3QFDA 5ESAB 4K3HA 2DQUL 2B1HH 2VLRA 2ZOKB 5BV7B 3PGCB 5JW5A 1U8JA