2IMNA

Refined crystal structure of a recombinant immunoglobulin domain and a complementarity-determining region 1-grafted mutant
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
113
structure length
113
Chain Sequence
DIVMTQSPSSLSVSAGERVTMSCKSSQSLLYKDGKNFLAWYQQKPGQPPKLLIYGASTRESGVPDRFTGSGSGTDFTLTISSVQAEDLAVYYCQNDHSYPLTFGAGTKLELKR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Refined crystal structure of a recombinant immunoglobulin domain and a complementarity-determining region 1-grafted mutant.
pubmed doi rcsb
source organism Mus musculus
molecule tags Immunoglobulin
molecule keywords IGA-KAPPA MCPC603 FV (LIGHT CHAIN)
total genus 21
structure length 113
sequence length 113
ec nomenclature
pdb deposition date 1992-03-30
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2imnA00
1MAKA 2CLZB 4MD4B 4RGMB 2UYLB 5J7CC 1E4XH 3EYVB 5HYEA 4ZS7L 1OD7A 1L9NA 2VLME 3DSNA 4X6CB 2NY0B 5IFAH 2X4OB 2V5TA 4PJGA 4ONFH 2DN7A 4BM7A 2YPKA 4C56D 5I2IA 4PRBA 2YC1B 3TBVB 4DN4H 5T3XE 2W0PA 1DBKH 3C8KA 4WENB 1DEEA 3MJGX 5GSRB 1IQWL 3BH9A 1I9IL 1L6ZA 5GHWH 1OP9A 5L8KB 3IFOB 4FQXC 4TSBH 1VEMA 3NGBB 4CAGA 4P9MH 3BP4A 3FFCA 3QI9B 1XFPA 4MMXC 3WL9B 3VXOA 5HDBE 1TZIB 5J13C 3MLYH 4X9GA 4YXKL 3S34H 4XVJH 3TZVC 1N26A 4XB7A 3O4LD 5E08H 1J11A 4XNUL 5D7LE 1MFCH 5ACMA 1L7IL 2EE9A 1Q94A 1AGBA 4OFVA 3WV0A 3QQ4B 1YNTB 1S8DA 5T3XD 4YFLF 5FYLD 4ZFOL 3WO4C 1RJZB 3WFBL 1KULA 3RVVD 1K5NA 2JB6B 3P77A 3LPGA 4NRXA 4UILH 3QXDB 1G7HB 2DQDH 1NC4D 5LG1A 5TQ2H 4MLIA 3RTQC 4UV7L 2FJFB 3D3VB 1AXTL 3BKJH 3QQNA 2AXHA 3LH2L 4YDKL 3VRLF 1RULH 3EFDL 4WI3A 2IMNA 2X4UB 2OL3L 4HULB 2BZDA 5MEOA 3MX0A 4LNRA 1KB9K 4WGWB 3K2UH 3ILQC 1B0RB 4MAYA 3U48A 2HJKA 4U1GC 5ADPL 2G5BB 4OLXL 1LMKA 4JPIA 1FCCA 1MUJB 5EBMA 2V7NB 3X3GL 1KCUH 2DI7A 1OAUH 2EDNA 1YEKH 4TUJB 1RFDL 3RBGA 2L7JA 2BSSB 5I1IL 1NGPL 2X5PA 3EFFA 4OUOA 5D96B 1U3ZA 1EFXA 2CXGA 4G6FD 3D39A 4R7DA 3PUCA 3V7AG 1IQWH 1P9MC 2FGWL 3KG5A 2NY2D 2MFNA 3EUUA 2JE8A 5AUMB 4UUJA 1SHMA 4U1HB 5EC2A 3QNZB 1NPUA 3BPLC 3KXFE 4L5FL 4D0CB 1HDMB 1PW3A 4XWGL 3ROLA 2FWOB 1DQLH 3GB7A 2D7PA 3GMQB 4KUZH 3T1FA 4NM8L 3WS3B 4NKDB 1GC1L 5D7SL 4CU8A 1OTTD 4ZO7A 2WNGA 3L95A 1VFUA 3MA7B 5F3BA 2BHZA 4M9PA 3LZFL 4UBDC 3OG6B 3TP4A 2Z31B 2NYYD 2VO5A 3R1GH 1B4JH 3RZCB 5K9OA 4XBEL 1SJHB 5HY9B 4CJ1A 5K9QG 3CFBB 3HPJB 1FRGH 4FQIL 3L5XL 4XCFH 5FUCC 5HHNB 5HYJE 2FLRT 1U6AL 1MWAB 5A2FA 1ZLWH 1UZ8A 4X7TA 5F3HB 1F4YL 1KCRH 1QFWM 2WWKO 3X11B 3BZEA 1R3LA 1G6VK 5E7BA 1IC7H 4I18B 1BLNA 1IC5H 5K59F 3OAUH 2YD3A 3FFCD 3CPLB 4HIJB 3NGBC 4FQIH 3BMWA 1I85C 3E2HB 4FFVD 1KXQE 5LBSH 2YPLE 3I02B 4HPOL 4HCRL 2DLGA 1BVLA 1RULL 1OD9A 5T1MA 4GG8A 4KVCL 5CEZD 5F70A 2DQUH 5FF6A 4ENEC 3BISA 5B3NA 4DJMA 5IK3A 1CFTB 1N64L 3TZVA 3OKOB 1NUNB 2R9HC 1CVRA 1RIVH 5B38A 4D0DB 3FQTA 4H20H 1JWSA 2X89D 4OKVA 1A1MB 3VXQB 5IBUG 4TSAL 4CKVX 4TPRL 4PRDB 4JFZL 5K9KA 5DJXB 4U6VL 5KS9B 4MGXA 3DRTA 1IAIL 4WEUD 5E08L 5JXAH 1CXEA 1XGQA 3KYKL 3WE6A 1Y6KR 5JHDA 2XYCA 4LF3B 3WIHH 3SKNA 1OAKH 5FHAL 3Q3GA 3PWNB 35C8H 5DJ0A 3M1BB 2FJHB 2E7MA 2B5IC 3IKCB 1UXSB 3Q5TA 4ZNCD 1CS6A 1KGCE 1IM9D 1QSEA 2WQ8A 2DLFH 4GBXC 3FT2A 3P11L 3NAAH 4G6KH 1QHPA 4P23A 4P5MA 2B1HL 3BSZL 1GOGA 3PG2A 5GRWA 4G7VH 1Z0NA 1P6FA 4QHKI 3VG0L 1BJ1H 2NY7L 2B8OT 1RUKL 4JVPA 1OM3L 2ARJA 2MPAH 2VLMD 3QO1B 2EZ0D 2YUWA 3BFOA 3CFKB 2QR0B 5GGSB 4FQQB 3RY5A 1WLHA 3KLAB 1KEGL 3M8OL 2DQHH 3CK0L 2VABB 3O4OC 3ZLQC 2W59A 3AC0A 4HJGB 3U9PH 1BJ8A 3K7UA 3WLWD 1SJVA 4NHUB 2Q76A 2X09A 2OL3B 1IAOA 4XP4L 2HTKD 2QKIB 1OT2A 3GMNA 4Z95L 4LAQH 1HEZA 5FB8A 1HEZB 4Y16C 3ZDYF 1UJ3C 3HUJF 4M8QA 4HPOH 4U33A 1KLGA 2BCKB 5E8PB 1NUFA 3OKKA 3QIWC 2NY1B 1JCKA 4TRPL 4OZIB 2NY2B 3C6SB 4GG8B 5E9DD 5A16B 1PEZA 2MCPH 3LRGA 1U91A 4KHXL 3SDYL 4KKAC 1FYTB 3G5ZA 1WEJH 1BJ1J 1HXMA 4L8SB 5E1AB 2FJFA 3RP1A 4O00A 5IMLB 1JVKA 1UC6A 3QEQE 3E1F1 2YZ1A 5HGHA 2J8OA 3UZVB 1TTUA 4YO0A 4U0RC 4ALAH 1T6VN 2VXVL 2NLJA 3GSOA 1HXYB 4M03A 4K8RD 2V17L 4BQ9A 5D4QA 3MV7A 1ZA6B 1JNLL 1SM3H 4OB5H 5E7FA 3HI6H 5IT2L 4E9LA 2CDGB 1MJUH 2UZIL 1EHNA 3CFEB 3AXLB 3QFJD 3BPNB 1ZT7A 5EN2B 2QJDA 3DO3A 3QCTH 3D3VE 4ZFOA 3OAZK 2W0KA 3C2AH 3TYGH 3SO3C 5DWUL 1QRNB 5BV7C 2AJXH 4ELKB 2DLTA 3VJ6B 5TGBB 3TO4C 2VH5L 1WCBA 3EKCA 4PTUB 4DOHE 1WFTA 2LAAA 4LSRH 1EK3A 2H9GA 4LCUA 3BPOC 2YMXH 4OLXH 3QUMB 4U2YA 5HDQL 3MBEA 3DVIA 3ZE0F 3E8UL 4N9GA 5T1LB 5CEZH 5EBLB 2FO4B 5D6DC 3MRKB 3ULUF 3MRCB 1D6EA 3T0DA 5SWZA 5TE6L 5M94B 1A6TB 1FBIH 4PJAE 2B0SL 3FHQA 2OI9B 4UNUA 3LS5L 1DQJB 5TH2B 3U7YH 3V9FA 5GZOC 4WUUE 2OK0H 5EO0B 3IJSB 2X70B 4BELD 2ARWA 1A1NA 4RFOH 3G6AA 4OJFH 4B7IA 2CK0H 2JIXD 3QHTC 3LEYL 4XXCA 1FP5A 3BGAA 3D3VA 4WV1C 1NC2A 5KVFH 2GT9A 3VXSE 3V5KB 1BP3B 3VGFA 3GSRA 3TBVA 2QSCL 4F57H 2DLIA 4PJBB 4S1QH 1FPTH 1S78D 5I1KL 3GMPA 5AZEL 1MJUL 3LVEA 5EBWA 4Z7VA 2F5BH 5D7KE 1R0AH 1QNZH 4XPFL 2VR9A 4LSUL 3EDEA 4ALAL 4H20L 1ZLVK 4F8QA 5TPWH 1U3HC 4NT6A 3V5HA 1FPTL 4Y2DA 3H9SB 2Y4SA 4ELMB 3EYFB 1KN2H 2XWJB 1NBZA 4PJHB 2NY3B 2DJ4A 4ZTPL 4YE4L 1CE6A 1BQLH 4MD5B 1S9VA 3TO2A 4GSDH 1B3JA 1P5UA 5HYQA 3KPQA 4K7PL 2XTJD 3C9NA 3CX5J 1IGFL 1YEDA 4U1SB 1VADB 4P46A 4Z7UF 1XR8B 2OZ4H 2P4AB 4GKOA 2XA3A 3ARGC 4I0PB 4Y4HD 2IQ9H 4B53A 5TF1L 3T3PF 4AENA 4QRRD 4H88H 4TRPH 3I3DA 4PG2C 1X6LA 2XZCH 4OM0L 4NZRH 5L8LB 5C0CA 4S2SB 1HQ4B 3MJ9L 4NJAL 4GUPB 2YD6A 4V1DD 2V5YA 5FCUL 3NOIA 4EIZC 4NQVB 1D5MA 1JPGB 5DEGA 4DGIL 3LKQA 4OIIL 5HHME 5FA3B 5HGBA 4D8PA 5BVPH 4RCAA 2JELL 3IB4A 3IDIA 3ILPB 2VDOH 2QEJA 1J1XH 4DGVL 4JGUA 1BOGB 4W4OA 4NZUH 2YPLD 4U1MA 3OJMB 4GMTL 5IT2H 1HHGA 1QBLH 1X5JA 1FFNB 4G6JL 5I1LA 3PHOA 5E94B 3ELAT 1A2YB 2NX5D 4XAWL 4I9WE 2HVKA 4GJTB 3I9GH 3THMH 1CFBA 2QHRL 5D7LD 1K3IA 1RZJH 4E0RB 1KCSH 5ID1B 1GRWA 1QO3A 3FONB 5D71H 1YMMA 1YEKL 2W07A 4RAHA 3QULB 5IW6A 3GKWL 3QULA 5IW6B 5HTSA 4LCCB 4Z18A 1FVCA 3KYMA 2BVQA 4RZCA 4HUNB 1K8DA 3DMMD 4NT6B 4IRZL 3MRLB 1KJMB 3HI5H 4NQCB 3BN9D 4OCXL 4RFNC 2OQJA 3TEUA 4MNGB 2VAAB 2ADFH 2DQGH 2I07A 3MV9E 1J5OH 4JFZH 5FO7A 4OZGA 3T4YB 5D1ZB 3H9ZA 1U8NA 3HC3L 3BDYH 1QFUH 4NC1C 4WTZG 3CIQA 1QFHA 5EOQL 2CRZA 4OT1L 4KKBC 3SHSA 5AWNL 1PY9A 1MRDL 2G75B 3IJHA 4DVRL 4LVEA 4LP4A 3KS0H 4N5ED 3T0VA 4LPVA 1RMFH 3JZ7A 2YA1A 5E8OA 5ESQB 2IG2L 2BRQA 2EYSB 4ZO9A 3O41A 5E2WL 4QRUA 2YSSA 4QY8B 2IADA 4JFDA 1KIQA 3CNKA 1NKRA 2X4PB 5F9WB 1MIMH 2G5BA 4F58H 5AAWA 2CO6B 4PPTA 1DVFC 2CKNA 5JDJA 3HRZB 4HFWA 3MJ6A 5I76A 1FZMA 4CW1B 4WI5A 2EC9T 2H6PA 3BYYA 5DK0B 5AWNH 2ICWJ 3SDCA 4RGOH 1B4JL 1TJHH 5I75B 1VACA 1HHKB 4X7EC 2W9DL 4ZAKD 1LO2H 1V7NL 5J1AA 4KK5D 3VXUD 5JZ7C 5F71A 4L8DB 5E56A 2IFGA 4PJEA 5T5FH 4W81A 1HYSD 5BJTA 4F15C 3BUYA 4U1KA 4FTVE 5KSBB 2HP4A 4JANA 3KPMA 4S11A 3LEYH 4D3CH 2BJMH 4L8BB 1KPUA 2HMID 2G9HB 3RUGA 3HR6A 2BNQD 5IK3B 1MCEA 2QSCH 1BVZA 2X4SB 5I66A 4M1CC 2R0ZL 4JM4L 2BERA 2COQA 3VFUB 4PBXA 1OW0A 3ULUH 4PRHE 4Y4FC 4DUXA 2D0FA 1FZKB 1HSAB 2J5LC 3BW9A 3Q1SL 4IOIA 4JFEE 5MERB 4LRNH 1KTKE 1I4FA 4KKLD 3MTRA 4KDTC 1RZ7H 5DYOA 1MI5E 4UV4L 2PTTA 5K9JH 5ICZA 4U1NB 3B2UD 4GMTH 3MLVL 1XGPA 4LAJH 4W6WB 5I6XC 1Q9OA 4LRNL 5C6TL 4MSWA 2AV1B 1WC7A 2VSDA 5SWZD 1MIEH 3O0RL 3VRIA 3WFBH 4JDVA 4YHLH 4WHYH 4MWFA 1B2WL 4HSQA 3CXDH 2DQIH 2W91A 2HAZA 5E8OB 3DTXA 2DQDL 4AZ8A 3BOVA 5LXGL 3QIUA 3RUGE 5GRJL 5D5MF 2Y72A 5AYUL 2C26A 4Z78A 1MFBH 4P2OD 2ARJB 3C6LA 4DW2L 1N4XL 5I18L 5JPMB 1CF8L 4F9PA 2GK0A 4LL9A 1ZS8B 3MMEA 3MNVB 4PJ9A 2EE6A 5J12C 1ZS8A 3MNVA 1HHIB 3IAQA 5ADOH 3ARED 1BGXL 4Y1AD 1K85A 1IGCL 3BKML 4JHZA 4WY7L 3OGCA 3MLYL 4XC1H 3UTTE 1HH6A 2HRLA 4RX4D 4IRJD 5DD5H 5GSVB 1PX4A 3CFDB 3O3UN 1JUFB 2X4RA 3O6KH 1EFXD 4G6AD 3I6GA 4POZD 5GS0H 1E4WL 3RWGB 5JORA 3RWDB 1JGLL 1BQLL 2EDJA 1S78C 2PW1B 1VA9A 4K07A 4F9LA 4JRYB 5CP3A 5E5MB 3N9GH 4HCRH 4KHXH 3SDYH 4L8DA 3MRCA 4C59B 2VZVA 5HVHC 3F6LA 2DQJH 4Q9RL 5DRNA 4RMTA 3IRZA 4JFXB 3WKNA 3MO1B 4U49A 3V0VB 4KQ3H 3IGAA 4LMQE 2XA8L 3QHFH 5JHDE 5IKCB 4QRPD 3TBWB 5ADOL 1HOCB 2NW2A 3CUPB 3EHBD 4X6CA 2F54B 3ZKMC 3CVHB 3QI9C 5GS1A 5I1KH 1H3TA 4MQSB 4XCEB 2VKWA 2ESVB 4FFZH 1L6XA 1KTLB 3HNSH 2HFEB 1YY9C 1XGRA 2IGFH 5HJ3B 4F7MA 5BXFA 2CLVA 4MAUL 3RUGF 1MJJB 3UTTA 4I8DA 3KYNB 1LD9A 2XZQH 1C16B 4OUUA 2OK0L 5BZDA 2DD8H 5KSAC 3O4LB 2IH3A 2XZZA 5C08A 4N0FA 4ETYA 4K3DL 1J5OL 4NQSB 1U8IB 1D5XA 4YGVB 4JPWL 1KJ2B 5B3JF 4OT1H 1YEDB 4U1SA 1BAFL 1XF2B 3MFFB 2F53E 2BVYA 2EDTA 5I8OH 2FB4H 4YHPA 2KKQA 1IGML 1LVEA 3MV8D 1CDHA 2JLLA 4OLZH 1DQLL 3BSZH 5F9WC 1KSRA 2LV4A 1BBJA 2ATKB 2MMXA 2R4SL 4JRXB 1B90A 5D7KD 4G7YH 5LGJA 4KI1A 4X9BA 1DN0B 5DVKA 2EYRB 2B39A 3DX7A 1CK0L 4JFPA 3VFNA 3VXNA 1X3DA 1IZJA 1UWEL 1BM3H 4MZ3A 5ENWB 3LB6C 5ICXA 4L8CA 5KJRL 2R23A 4FXGB 1P4BH 1U8QB 5IMKB 1CE1H 6CGTA 2O5XH 2PO6C 1UA6H 4Q2ZA 4RAVA 5JOFA 3REWB 4DQOH 5B39A 1A4JA 3MCLH 4EDXB 5AUMA 3U4BH 4U1MB 4Z7UB 3V6OC 5K93A 1OF2A 2NY6C 2AAVA 5E9DA 3DHMA 3P0YL 4V2CB 4MX7A 4GLRI 3OKLA 3S96A 2DMBA 1S9YA 3ZKXB 4HS6B 1I3VA 3NFSH 5E6IB 5HHVH 3OR7B 3B83A 4X4ZA 1FBIL 1T03H 3MUHL 5MEQA 2ENSA 3ARTA 3V0VA 3MV7E 4GKZA 1C12A 1MCSA 3T0EC 1CFSA 1NLBH 3NA4A 4ODUA 1XF5A 2AK4A 4HS8H 5BRZB 3WNOA 5MP6H 4EUPG 2IBZY 2DYPD 4D8PB 3GMRB 3ULUC 3STLA 1OAYH 4WCYL 2D7MA 1IEAA 4BSVA 1RHFA 3VFRB 4N9GB 5T1LA 4AJ0A 3BQUB 3T04D 1WJ3A 1T21B 3LQZB 3T4YA 4X6FB 4Y4KD 4XMLH 1A6WL 3SGDH 1HIMH 4ONHB 1CFNB 4GQ9H 1CD8A 5DZNA 1A9BB 1JHKH 2NCMA 1DN2A 4ORGA 1BLNB 4C55A 2Q87A 4KI5D 2FYYB 5EUOA 1E28A 4EXPX 1D9KC 2OXGA 1UKTA 5FEBA 3V5KA 2R0LL 2BVUA 4KK9D 1H3PH 3QQ4A 4MB4A 5T1KA 2H32H 5DK2A 4YQXL 5T1KB 2XXCB 3RWEA 4E5XB 4J2XA 5BQ7A 5I19L 4HQQL 2UVFA 4XXCC 3DWTA 2O5YL 1M71B 2HT2D 1AP2A 1Q9LA 1XF4A 4HLZG 4U3HA 1WV7T 1FVEB 1DN0A 5CINL 4KKBD 1YMME 3TJHD 3BP5A 1RUKH 2CO7B 3PJSA 3VGAB 4XGZA 1MCLA 4K7PX 2DQEL 1UA6L 1R24B 3HRZA 1JHTA 3P73B 2YD9A 3F58L 2YD5A 5IP4A 1TCMA 4RWHA 5KS9A 2C9AA 4UOJA 3LQMA 5E8DL 1LO4H 4GQ9L 3QFJE 2AV7A 1EEZA 2NY3C 3JUZA 5JR1H 5DK0A 1DSFL 5I1GL 1N5AB 5D7JA 5EC1B 3MZTA 4Z7VE 5FO9A 1T1ZB 4LVHC 3SKMB 1S7UA 4XWOD 3WBDA 3KYKH 5E8NA 3MLVH 3LN9A 1RFDH 1BHGA 1AXSA 4XRCB 5A40E 5T3XL 2Y6SC 3B5HA 3NTCL 1OB1A 1H3UA 3E3QE 5DJZA 1PZ5A 2VLRD 2NY5H 3RGVA 1BWWA 3WLWC 2X4PA 3OR7A 2JCCE 2W9LA 3H3PH 3PDDA 5FGBC 2YKLL 4UDTA 3RUGB 4OZFG 1KLGB 1LEKB 4BH8B 2WQRA 1YDPB 2Z31A 4ODUB 1SY6H 5IJKA 3L3KB 3QEHB 1P5VA 2AJXL 3P3YA 4CADB 4UILL 3NPZB 2R2BA 1NC4A 4PJXF 5HGAB 4AG4H 4KH2A 2WLYA 3H0TA 3HC3H 4Y0GA 3UBXG 5FV2A 3WL9A 1W8NA 3VCLA 4H1LH 4XMKH 1GCFA 3HPJA 1KJMA 2P5ED 5C09B 5F1IB 5CSZB 1ADQL 3CMOH 2DI8A 5IJVB 4K71C 4PJ5A 1OCWH 4L9LB 3QZWB 3MRHB 1RZJC 5D1ZA 1U0QA 1E6OL 1Y6NR 1ZT4A 3K8MA 4FQHA 1RURH 1C5CH 4Y5YC 1S8DB 5GGTA 4JRXE 2OTWB 2ZCKL 3MJ7A 2OZ4L 3E2HC 2GQHA 2NZ9D 4Y7MA 3MBXH 1RZJL 5HYSG 4J12A 5C0BD 3SO3B 2GAZB 4QXUL 5D7IA 4FTVA 2Z35A 5CBAA 2A6KB 4G7YL 4PRNB 5J9PA 3MCKA 3P4LA 4PGCA 4ZFZA 2IADB 1MSPA 1ZT1B 4WI4A 3GHBH 3C6LB 5JA9A 4JREB 4LHUA 1RPQA 3MRGA 5DC4B 5IEKA 1P9MA 1WEJL 2ZZUT 4UT9L 4RA0C 5F1KC 3WJLC 3MXWL 3T3ME 3HMXH 1XGQB 3MJ9A 4M6AA 3DUHA 2VE6B 5GJTL 5IB5B 3VJ6A 2MHAA 3EOAB 1INEL 2VB5A 3VWJC 1J0YA 4RMVA 4MQXC 3WNPA 4MXQD 4KJPD 3TPKA 1FNLA 2DM4A 2E27L 4UDUB 5CJOL 5J12B 5JIKA 1CCZA 4JB9H 3IDXH 4Z77B 2QQKH 4RBPH 3BRGC 1A0QL 1CLOL 3LEXB 5TF1H 2IQ9L 3PWPD 3GRWH 4JFOB 3N1QC 4Q9CA 1BFOA 1P7QD 5DJYA 4HWEH 3CFKA 3DHJA 1ZT7B 4C58B 2RB8A 3SDAA 4OFKA 5I66B 4G6KL 1UZ6E 2MWCA 1A7OH 1BX2B 4LCCA 1UJ3B 2ITDB 5IESH 5HHMD 4HIXL 5D9SA 5JDSB 5DRXB 4YHIB 4JZJC 4Y16D 5C86A 1X7QB 2BRRL 2BDNH 4Y2OA 1ORSA 5EFIA 4YR6B 5KSAA 1FNAA 4LLQB 3DVNB 4LLUB 1YYLH 5A3ID 3O4OB 2F58H 4WY7H 4QHLB 1F6AB 1ZLWK 4MDJA 5IMMB 3H9SA 3F5WA 2AP2A 1CWVA 4OKDA 2ZJSH 3RZCD 3L5HA 5C0DB 1N6QH 5IJKC 3FO0L 4U7KA 4YHOH 1NUGA 1SM3L 4OB5L 2PCPB 1ORQA 4OLYL 1DVFD 4OTXH 5ESQA 5I19H 1S7RB 2ZOLB 4Y4KB 5JW3L 3QWRD 5D6DA 1HILB 1YPZB 3VFSA 1RZKH 3NVQA 4ZQKB 1TJGH 3OKKB 2AKRB 4DVBA 3VFMB 3GGWA 1JNNL 4GAGL 4PJ9C 2ADJA 3UTPD 5C0AA 4G9DA 5D6CA 4DZ8A 1F5WA 3TVMA 3VWKC 5TFSL 3FZUC 3HPLB 2VAAA 5I1AB 2AK4D 3SDCD 4OCWH 4N5EC 3DVGB 4EZMA 1UWXH 1CT8B 2R1WA 4LLDB 2AEQH 1F4YH 5IG7A 4P23C 4X5XA 5J06A 1H15B 5IEHB 4OCYL 1ZLUK 1PD6A 4NNXB 3H6JA 3GK8H 2QQKL 1DVFB 1YN7A 4GAJL 1RZKC 5ITFB 4LCUB 1RHHA 3I02A 4GSDL 4P46B 3C60A 1I3RB 4HZLA 4HAFA 3X13B 4NZTL 3C09B 1RMFL 3C5ZA 3MRNA 3TT1H 4HWBH 2V2WA 4F7TB 1M7DA 3TZVD 3CSPA 1KB5B 1WQVT 3BO8A 4PD4J 4LSPL 3NIFE 2Y07H 3DETC 3NFSL 5IF0B 1DBBH 1XCTB 1J86A 3M8OH 2XT1B 1ZA3A 4JFDD 2FR4A 4OD3H 5DJXA 4D9QD 4WNQA 4HXBL 3EO1A 4EDWH 2EDHA 3T0EE 1I1AD 2P7TB 4KJYA 4Y5VA 1QSEE 2P7TA 2EICA 3GMPB 4URTB 4M3JA 1P7HL 1M7XA 2MQCA 3DPBA 5FA3A 5AYQA 1MHHA 1XF1A 3MRJB 5IVXF 1WZ1H 2EIZA 4OGYH 1U58A 5D8JL 1CFNA 4FP8H 1IARB 5DJAB 1CE1L 1TIUA 3EIFA 4U6YB 3HE6D 3VXME 5SX4H 1X5ZA 3RDTC 2JK5A 2VUYA 3D1MC 5ACZA 1CZ8H 2P49B 2YPVH 2ZNWA 3IFLL 2A6IA 3ZDXE 3I6LD 4F33A 1E4KC 1XF2A 1N0LA 2PTUA 1S9KC 1YEFL 2ATPB 1A9EA 2MCPL 3V0AC 5C09D 4LKXB 1UT9A 4BZ2L 1ZHNA 3X12B 2HJLB 1Z0MA 1A9BA 5KSAD 4XAWH 4I13B 2FJGB 2CH8A 4K8RC 4OF6A 1UVQA 5F7HA 2JB6A 4FFYL 5KS9F 4PREA 3TYFA 3PV6B 4DW2H 4Z6AT 3PV6A 5C0FB 1FYHB 5DJ6A 1AXTH 3H7LA 1D5IL 3TC9A 4NYLB 4WUKL 3Q5OA 1BREA 1EGJH 4QKXB 1SY6L 1X6NA 4JPIB 2CDFB 3MGAA 2BNUB 3KNBA 2VZTA 3U9PL 1B0RA 1MHPL 1WFNA 2GJZB 3RJDA 3U9UA 1VGEH 1T7VA 4WUUD 4F7CB 3SGKA 3V5HB 4DN3L 4DAGL 3L9RA 3C9NB 3QAZC 1OTSC 2P42B 4KJQD 1NAKL 2YD4A 2ID5A 1AGDA 1NGZB 3QDGA 2UUDH 3S34L 4JPVH 5F96H 3KXFD 3WHXB 4BUGA 3C08H 1HSBA 2NYYC 2UVEA 2GW5A 5E00B 2FWOA 1MJ7H 1IC7L 5IM7A 4ZUVA 1J1PH 3CD4A 3H42H 3QUZD 4HG4J 4YAQB 1HXMB 2D03H 3PWNA 4P99A 4NUGL 3B9EA 2CDGA 3O6FA 2DLHA 5C9JA 2X4NA 2P5EE 2QHRH 4NWUH 4NBYB 4AEFA 4X6DB 2M8XA 3MYJB 2AS5M 3UZQA 4YHYC 2DI9A 3S4SB 3GSNL 5E2VH 5IGXH 3K1KC 3W39A 1T2JA 4KJQC 3TH3T 3RPKA 3C6LC 4M7LL 8FABB 1CYGA 3GIZL 4M1DH 1JPFA 4LFHG 5KS9E 4GRWE 1FIEA 4TSAH 3HMXL 3Q2CA 2L7UA 4R4BA 3FMGH 5KSBE 1T89C 2CRYA 4J3VA 1FGNH 2ZG3A 4Z76A 3O4LA 4UBDD 3ZDZF 2N7AA 3RWHA 5D7LB 4PY7A 3VGAC 2GHWB 3MRFA 3GIZH 5BS0D 1NL0H 3MV11 1BQHA 3QG6B 2CLZA 4X8XA 1UH2A 4U0QB 1Q94B 2HG5B 1YEIH 4GLRH 4MCYA 2HJLA 2FJGA 3I50L 2DYPB 3CDGA 4HGWB 3MBXL 3CXDL 5IKCA 1I8KB 3P9LA 1B2WH 1A4KA 4LKCB 2CLRB 2PNDA 1I9JL 3TH4T 2QADC 1G9MC 1KCUL 4M43H 1ZGLA 2RR3A 5D1QC 1YY8B 1KTLA 1FV1B 4BZ1H 3L7EA 4HWBA 4UIMB 1OM3H 3K1DA 1SJHA 3MRDA 1NMBL 2APXA 2YMXL 1WZLA 5I17B 1GJIA 4X6DF 4O58H 2UZXB 3HE6A 5CBEB 3WFHB 2R56H 3W0WB 4DVRH 4Q2ZB 4RAVB 2NY0D 5E03A 4FQ2L 4JY5H 1B0WA 4PG2A 3BEWA 2VNCA 3BPOB 2X9WA 1ZTXH 2B2XH 1I1FA 3ES6A 3MA9H 1VB9A 3C87A 1PKOA 3H9YA 4YXLH 1T3FA 5DJDB 4R7NA 5EZIH 5JLZA 2UWEE 4PJCB 3ETBF 5CEYA 1KUMA 4K3EL 5A16A 5C70A 1R5VA 4Z7QE 5C8JB 2D9QB 2ZJSL 3BP6B 5B8CC 3NCMA 1GGUA 1MFNA 2XQYG 1NBVL 3IXTA 1ULVA 1MRCH 4S1QL 3MR9A 1S7QB 3WIHA 3GI9L 1MJ8H 4UIKH 3SCMB 5GRUL 3SY0A 3QXUA 2APFA 1GIGL 4A2LA 4OSUL 1ZAGA 4KTDH 3S6CA 4BH7A 4OKVB 1A7PL 5DMKA 2X05A 4B41A 4MYWB 1ZVSB 4HT1L 2YD2A 1HOCA 2NW2B 1RZIB 4WHTA 2VABA 4YXHH 1G0YR 4KHTH 4H5SB 4IDJH 3HB3D 4LPXA 4R4BB 5GIRB 2VR4A 5C2UB 3MGOB 4HKXA 1HKFA 5ADPH 3GBML 1CIUA 5EH1A 4Y19D 4CMMB 5D2NC 3VI3E 1ZHKB 1TNNA 1G0XA 3BKYH 4UU9B 5I0ZA 2FO4A 2Q86B 4R0LB 5GZND 2GJJA 3RWDA 1LK3H 2W65A 4YQXH 1IGYA 4Y4KA 1URLA 4R4FH 4UTBH 2JJUA 3TT3L 3KPPA 3QRFM 3BJ91 1XF3B 2FECI 3R1GL 3TFKD 3X12A 2ICEB 1G7HA 4Q6YA 4X4XB 3BD3A 1A14L 2AJVL 1MELA 3V4PH 3IVKA 1JPSH 2ENYA 3O2DH 1F00I 4H0HB 4MJIA 4PJ5B 4YHKL 3T0EB 3O6LL 4K3JL 3RU8H 1GC1H 3QDJD 3RY6C 5C0ND 1IJ9A 1DTUA 3MLUL 5CLTA 5EU6D 5J6HA 3EJZC 3NPSC 1F3JB 1N3NB 1E4KA 5E6IC 1IGJA 1UM4H 2VDML 4NKMB 3SN6N 5HVFB 1SJEB 5IR1A 4Y4HA 5DD1H 2G5RA 1YEGH 4NQEE 5EWIL 2R2CA 2B1HH 3M07A 3WYRA 2Q3AA 4KHTL 4Q74A 4MNHB 4F7PB 3TIDB 2WLZA 2FD6H 3ZKSD 2D03L 3DMMC 5CFHA 4JJ5B 1JYWA 2VL5A 1E4XL 3H42L 1BQUA 4P23D 1BOYA 5DR5L 1OAKL 5FHAH 2C4XA 3PP3K 4XPAL 5FYJU 5E1AA 1HINH 5IQ7H 3QJFA 2E7HA 3K2UL 1WZKA 2V7NA 4IRJB 1T20A 3G5ZB 3EYVA 3QUMH 2FDBP 5C0CD 2EECA 3PWJB 1B6UA 3MLSL 4TQEH 4PJ5D 5F89B 2ADGB 2VQUA 5JXAL 3GSWA 2X4TA 2EH7L 4NJ9L 4RSVA 2CDEB 1OOAA 4ESKA 1EFQA 5I1HL 4PJ7F 4U6VH 1S7VA 4ZOEA 5JHDD 4Y5VC 4H8WC 4PJIB 5C0BE 3T4AA 1ND0A 3FB8A 2HA1A 2BY3A 4Q6IA 4Y1AA 4PTUA 1MHPH 3L5IA 4HUUA 2P47B 1QEWB 1I9EA 2P5WB 3G08B 3PL6B 1M05A 4J3SA 4XNZC 3SE3A 3GM8A 3OXRA 5BOZG 1XR8A 3EDKA 5E8EB 1X4ZA 2BVEA 4FQ1H 1TZIA 2QADB 3DUUA 4EDXA 4MB5A 4I5BB 4KVCH 4P2CG 3RVXD 5DUBA 5CJ5A 2E9JA 4M6NH 2ED9A 3O3AA 3T2QA 1DP0A 1U8LB 1RZ7L 4L8BA 5C0IB 1FQ9C 3ECBA 5I2IB 4H88L 5IUSA 4Z7WE 5EU6E 2VZUA 5E6ID 4G42A 1T5WA 1VFBB 1SYVA 4PBVC 2F8XC 3ULUL 5D71L 1ZXQA 2VQTA 3WXVL 3UTPE 3K74B 1RVFL 1BJMA 5EDXA 3IYLW 1KT2B 3EZJB 4HJ0C 3RAJL 5DD3H 1M6OA 1HHHB 1H5BB 3NCFB 3V5DA 2AJYL 4M1GH 5LKNA 1YJDC 5FOJA 4LNVA 3VXNB 4TQEL 3AMKA 3OG4B 3QDHA 5FYKD 4WI9A 1BZQK 3VXQA 2Y23A 4HWZA 4KWUA 1OGTA 1UXWA 5EOCL 5ITFA 2FZ3A 4PJ7E 5DI8A 4FMFA 5C08B 5BZWA 1V05A 5I8EA 3UTSA 3TBSA 1JYNA 5JHLH 3GSNB 1JK8A 4G6ML 4JFEA 2BHUA 2GJ6A 2DBLH 4HEPG 5KSUA 2GCYB 2ADIA 5CLWA 4FQLL 1AXSB 3WFDH 5C0CB 1DDHA 2FGZA 4OJFL 5H35A 3VW3L 3BH8A 4LLMB 1JNHA 2Q7YB 5K9QI 5F6IB 1A7PH 1DANT 3DARA 3JVGC 5C92A 4F58L 4X9FA 2AI0H 3VD7A 2AXFB 4CVXB 5INCB 1XCQA 4JFQA 5KN5B 4XC1L 4NKQB 4BFGA 1HHJA 4OGXH 1DR9A 5JQHC 3P73A 1VCAA 3TO2B 2ARJQ 3PWPE 4Z7UA 4ZPVA 3WJLA 1FNSL 1H3XA 3L5XH 1I7TA 3JWOH 4CU7A 3BD5A 1HI6B 3RX5A 43C9A 1LO0L 5B38G 4LLVB 3GMMA 3DX8B 3HLAA 3BHBA 4PJEF 3VWJA 4G8EB 3HC0A 3DX8A 3QXVA 5IHLB 4ONGH 4XVTL 5EOQH 3HC4H 3TCLB 1R3IH 1P84K 3T2PA 3UTQB 3D9AH 3VXUB 3WN5C 4Y16A 3MODL 4LEXL 4XCYA 3QXAA 2Y7QA 3T8XB 2DQIL 5C1MB 5JW3H 1LK3L 4L4TD 4TVPE 1EMTH 4HKJB 1NFIA 3U36A 2H1PL 3MYJA 1YMHB 2HTKC 4LSUH 4NRZA 3BUTA 4JDTH 5D7SH 4KRNA 1A3RL 5KANG 4DTGL 1WBYB 1ONQB 2MPAL 3KR3H 3W2DH 3RNQB 5JMRA 1ZGLP 2HJFB 1SVCP 1CFQB 4F3FA 4J4PC 2DYPA 5ELIA 4ETQA 5F6HI 5IB3B 3LIZH 1W0VB 5D1XA 5DEGB 5INDA 3IKKA 1FVDA 4HBQA 5AD0B 4XXDA 2GSGA 4UTAL 1U8JB 4XCCL 5BV7L 1B0GB 4NQSA 4Z0BL 3OAYK 4TTDD 3DX9A 3LS5H 2P8PB 4TSCL 4WW2A 4LLYB 4FQXB 1O0VA 3O45A 4AH2A 1OGAE 5IVXB 5L8JB 1NEZA 4DFIA 4IRSC 4YBQD 1WCQA 3BRDA 1IGMH 2N56A 2DQFB 1CQYA 4JFFD 3GRWA 5IMOA 4JFEB 3AMLA 5GJSH 3BGFC 2NY0C 4P57B 3T2OA 2CUHA 1T1YA 3QXDA 1AGFA 3RIAF 1G7QB 2N1KA 1G7MB 3LEVL 5K33A 3R8QA 4OD3L 3PL6D 4DKFL 3MGTB 4KPHL 3D9AL 3LRSB 2NY6D 5EN2A 3SCMD 3ZO0A 4I3GA 1L7TL 3KPSE 1I85A 1F58L 4Z7VF 1I4FB 3SDDC 1F11A 1BIIA 4DOHB 1K4CB 5L9DH 4NIKB 1NCNA 4YFLI 2JIXB 2YHGA 1Y18B 2A9MH 3ULVF 2ZOKA 1H0DB 4R97B 1T83C 1MREL 3HZKA 1H0DA 1QLRB 3H3BC 4QHMA 1LO5B 3PWUA 4PB9L 2GITA 3VWKA 1QSFD 1IEBA 4JM2D 1VEPA 3K46A 4BQCA 3O8XB 1HYRC 3VXPB 4OCYH 1UM6H 1MCOL 4ZMAT 4A6YL 5J57B 4TSBL 1Z5LA 1TMCB 3RQ3A 5IM7B 2XKNA 1U8HB 3BHBB 3VWJB 2KDGA 2W60B 4OD2A 2PETA 4JRWA 5DXWA 5JHDB 4OD2B 4TYUA 4QRRA 4QXTB 4WU7B 5CJBA 3R06A 1FFNA 5I1LB 4PJEB 4I0PC 2YWZA 5TDPA 2DM3A 4PV8B 1LEIA 4OZIE 4JHBA 1YN6A 2E9BA 2IBZX 3L1OL 4G3YH 1NC4B 5ESAB 3RX7A 3IVKB 2H9GB 2X89A 2CIIA 3NN8B 2CKBB 1XIWD 4PGDA 5TGBA 2EH7H 4NJ9H 4R96B 2HTLD 3AY4A 4ZTOH 4GRWF 4JCLA 4QCIA 2ADJB 3IF1A 5ETUA 4YJZL 2YWYA 4UU9A 5C7XL 3J8F7 2XV6B 4LEOA 3BJLA 2IALB 3FRUA 3QUKB 4YWGH 3ZE1F 3QI9D 1S9YB 3L3HB 1GOHA 4XP4H 3EYUL 3QHZL 4OF0A 3LY6A 3FT4B 3T0BA 2MNUA 3F65A 5KOMC 2FEEI 3KPMB 3BQUD 1SJEA 1BPVA 5HDLA 1F4WH 3SDDD 3KPSD 3HZMB 4ODHH 4OAWB 5IQ9A 1ZA6A 3VFTA 3D85B 4A2MA 4H0IA 3MR9B 3FL7A 3O4LE 1FFPA 1QRND 2HYMA 5F8QC 1QHOA 5KG9A 4P3DB 4F80A 1FIGL 4G6JH 4OI7A 4R90H 4GRLC 1GPOH 4Z9KB 2J1KA 4OF3A 2Z93A 3D0LB 4F37F 5CJXC 3GUTB 2X1OA 2XICA 3PWVB 4CMHB 1M71A 2ESVE 1J1XL 1JZ8A 4L3EA 4FG6C 4YHML 2FNBA 1AHWC 3X14A 3IETB 1FNGB 4JFPB 1ZA3B 2OBGA 3U2SA 3OGCB 5C0RH 4XVSH 4L3CA 4YWGL 4MS8C 4HMCA 5A2LH 2AXFA 4CVXA 4V2BA 4XVUD 4XBGA 4Y5XA 4AIZA 4L8CB 3D2UD 4LVHB 3T65A 3PQYB 5DFVC 1SEBB 5F97E 3DI2B 4LARH 4Q0XL 3CXHK 4RMUA 1Q72H 1X7QA 2GSIA 5HGDB 5I1DB 4GAJH 3MACH 3MXVL 2V5MA 3DMMB 1U95A 1N2RB 4Y88A 4KROD 2QADD 1EX0A 4P5TC 4X8JA 1JZ3A 5C0IA 4V1DE 1RUQL 1F8TH 1DQQA 4MD4A 3WJJA 4KVNH 2HFGH 1IKNA 2VERN 1LEKA 2BFVH 3I84A 1GZPB 5HPMB 3NIGE 1X5LA 1JYXA 3VH8B 1JFQL 4A6YB 1I8IA 1CGXA 4Z7OE 3MLPA 3OKLB 4LSTH 4QRUB 1PZ5B 1UB5A 3E6HA 3SJVE 5DURD 2IBGA 3QCVH 4JFOA 3UJJH 3ABZA 2P45B 5LAXA 1ZGLB 4JY4B 3ZTJG 3SKOB 1DE4A 3L6FA 4UOW0 1S7RA 2QSVA 2ESVA 3N1GC 4JFDE 5J4MA 1KB5H 1ZGLM 2VXTH 4L4TB 4Y19B 1WCBB 4XWOC 4U0RB 2KQMA 3BP7A 2AJSL 4X4ME 3MV7D 1FZKA 5ETUB 3MV9B 2CLVB 3A6BL 4JO3L 1KG0A 2VISA 2ZCKH 4J1UA 5ACZB 3BKMH 4OFYD 1IGCH 5C07A 4L8SC 4YHKH 4PJ8C 1YPZE 1A6PA 2SEBB 4XPBL 3K80A 1WIOA 2PCPA 4PJFF 4E42A 4OV5B 1VGKA 2ZSVB 1JRHH 3TBSB 3TNNB 3BN9C 4WFHE 5F96L 2WUCL 4PJFE 4C83A 4GG6A 2GAZA 4KY1H 3EJJX 5DHVB 4OCSL 3S7GA 5EA0L 4JJ5A 1T5XB 4M7ZB 1FL3B 4U1KB 1FORL 1FZJB 3OAYH 1BMGA 3NBNA 4KTYA 1K8IB 1FFPB 3WLBA 3SJVA 3GMOA 4GAYA 2FEEL 3UYPA 4GAYB 1NBQA 4AT6B 3TV3L 3S35L 5CBAB 4OZHB 4HXAH 1NLDH 3OKDA 4K7FB 4NGHL 3MLZL 2Z0BA 4OCXH 3HI5L 3W5MA 1AKJD 3EJYC 1MCNA 3PABA 5DMIH 1II4E 4PGZA 4LSRL 3KYNA 4PRHA 1YECL 4GAGH 3ZT6A 2R0KL 1RHHB 3OJ2C 1EXUB 1QD0A 3FQWA 5D1QD 3HI1B 5JIIA 2ZOKB 1RI8A 3MFGB 4X5LA 1FL6B 5BMFH 4YGVA 3AB0B 5DZLA 2AJ3A 2PUQT 1QBAA 1C7TA 5GISH 4MJIE 2A77H 1X5AA 2Z8RA 4GG6E 4AENB 1CZ8L 3VA6A 1NCAL 4D9QE 4AM0B 2EIEA 1XR9A 4JZNA 1INQA 9CGTA 2H8PB 4IHOB 2UZIH 4GRWB 1P84J 1JRHI 5KVMC 1MLCB 3EOYG 5CINH 4A6YA 1P2CB 3ARFB 3R06B 5L88L 3NZHL 3KPSB 3TNMA 1UM5L 2BDNL 3B9KC 4TUOB 4G8IB 3SPVB 1EEZB 3U7WL 2DIAA 3GJFK 5DGRA 3QO0B 2RGSA 1IVLA 4JKLA 4XNMB 3RVTD 1L4IA 1DQML 4LK4A 2E7LC 4EVNA 4IOSD 3OKEA 1WBXA 3SKMA 4ELMF 2R56L 3CMGA 5ITBL 3RVUD 4POUB 1RJCA 2V2XB 1ZHBA 1TJIH 2X42A 4RZCB 4ELME 4OGAD 4Y4HB 1JRHL 2R9HD 3S3PA 1CICB 3OAUL 1TNMA 4OGXL 5KSAB 4HBCH 4UNTA 4HKJA 5IBLD 4JM2A 4BSJA 4TUKL 5JXEC 3U46B 1U3HD 1DJSA 5CKGA 4E0RA 3MROA 1QPPA 2EH8L 5HPOA 4LGSB 5GS0D 15C8L 3TBTB 3FOMB 1FIGH 3L3KA 3QEHA 5E2WH 4XMPL 4HBCL 3WNNA 5CEYB 1E27B 1MWAL 5IW1B 1X5FA 3NCJH 3UTTD 1P1ZB 3PDOB 4PB0H 1FYTA 3MV8B 4KPHH 3ZTNH 1H8SA 5DJ6B 1QBMH 1XCQB 4JFQB 5L6YL 1JMZA 3HZVA 3RWCB 1QTYT 3W0WA 4S1SH 3ZDZE 3JV5A 4ODTH 3HE7B 4X5XB 2EKJA 2PO6A 4HK0B 3FB7A 5I1CL 1Q8MA 3O2WL 1JPTH 1CU4L 1J9CT 2A74B 4WHYG 3VI3F 1QOKA 3ULVE 3WUWB 3L5WB 2DLEA 5CIPH 1DCLA 1H3WM 2CD0A 4JFYA 2IC2A 5GIRA 2DB8A 4L29B 2JCCF 3QA3A 3OGOE 5C08E 4NWUL 5HYIA 5E8NB 2P43B 1I7ZA 3JV4A 3TO4D 2YK1H 1NCWL 1WBZB 5E9DB 2HLAA 3JWDC 2W60A 3D25A 5C6WH 4E41D 5C71A 4MCZA 5SX5H 4G9DB 5F7NC 3LS4L 1GZQA 1NGQH 3BPLB 3VMOA 2DTSA 5FA4B 1DBMH 5FYJL 3EOBB 3VGGA 3OQ3B 3DXAE 2AK1L 2OL3H 4LSVL 5DMIL 25C8H 1M6OB 1DZBA 4D2NA 1F4XL 2DIJA 5FYKH 5AD0A 2AEIT 4X4XA 1QA9B 1ZK9A 3MUGB 4LLQA 4CDHA 5BVJA 4NQCE 5GS0C 3ULVC 2DBJA 4KI5F 3W9DA 1WBXB 5I76B 1LQSR 1QSZA 3MRDB 4JPWH 4IS6A 1OGAD 1QBML 4ZUUB 3BRFA 2AXJA 1AGCA 3WEXA 3QUZB 3FQRA 4JFED 4WFEE 3BDBA 3VG9B 3WDJA 3GJFA 4TNVF 3FB5B 4RA3A 1Y0LB 2ZPKL 5DS8A 3OPZH 1IILE 1RJLB 1JE6A 1HIML 4XMPH 4FFYH 3G6AB 1G7PB 4U1LB 1LDPL 5DMJB 5HVHB 5SWQA 3QJHB 2K9UA 1UFUA 4P2OB 4AMKH 4X5WB 2EEBA 4NQDD 1HINL 3HG1D 1C08A 3AREA 2P8LA 2XWBA 3VRIB 5CEXA 1OAYL 4WCYH 2H3NA 3VFOA 3PNWB 2EE3A 3DECA 4W4OC 1MRFH 2AABL 3F7VB 3CLFL 3QEUB 5TFSH 1KIRA 1JHLL 5ANME 1YY8A 4PY8I 5J13B 4F15B 5ITBH 1WZ1L 3HAEB 2VXTL 2HFEA 4OGYL 5T5NF 3PWJA 2DQEH 3HAEA 4TSCH 4Y5YA 4YE4H 3VFWA 2AW2A 1MRFL 2BNUA 1TCRB 2VE6A 1DQDL 2P5WD 3MZGB 3O6KL 4NQTA 3CX2A 2R1YA 1J8HA 5FV1L 5ACLA 2EXYD 1X5GA 1LDPH 2PYEA 5HHOA 2UUDK 4PB9H 4Q0XH 4BKLB 2R2EA 2DKMA 1T3FB 3CGTA 2GK2A 5DO2C 4OQTA 3PGDB 3KR3L 3QUYC 1U2CA 2Z35B 2X40A 2ZG2A 4XAKD 1GOFA 4XNZB 4NO5A 4MDIB 1CBVH 1EEYA 4XP1L 4MA7H 4X8JB 4P23B 4P5MB 4YGAB 4U1GB 4HIEB 2B1AL 3DRQA 4MAYC 1JF1B 1YNLH 2WWMD 1UADC 5T1KD 3BXNA 4KV5E 4KK9C 3AS1A 4Y8DC 4RISH 4OZFH 4ZYKB 4AIZB 3MUZ1 3FO2B 3QDGD 4G8GD 4LP5A 3MMEB 4PJXA 4PJ9B 2J5LB 2WZPD 2XRAL 4NM4L 1FZMB 4CW1A 2CGRH 3RVVC 3C08L 3QDMD 4Y19A 4GQPH 2K3TA 2C5DC 4M3KB 4KKAD 3GNMH 2NTFA 4YHNA 1JL8A 1KCSL 4K9EH 4DK3A 3D39D 3IU4L 5KZCB 4RFNB 4HAGA 1KYOJ 5FM8A 2YPLB 2WMPA 1G7LB 3BVNA 3C2AL 3G5YA 4NCC1 5BZWB 4I18A 2R29L 2ZP0T 4KQ4L 3QCTL 4HUXA 3L3JB 3AREB 5CWSA 5CWSB 1MOEA 4UT6L 3DJ9A 3UO1H 4CVZB 1BD2B 4JZJA 3O6MH 1XMWA 4NP4L 5KVDL 1U58B 1S7XB 4PRID 3WO3B 4EN3C 3OWEA 4PY7B 3VD4A 3QRGH 4G6FB 4ZD3H 1JPTL 2YRLA 5TQ0L 4OCRL 2IANE 1SEQL 4P2QE 5DO2D 3S5LA 3SGJC 2A6IB 5I1CH 3MA9L 4Y2DB 1AGEA 3S36H 3OB0K 4WUUA 1A6ZB 2P44B 5F7YC 4NQCD 1DUYB 3D87B 3GNML 1T2QH 3U4EA 3VXPA 4LVOB 2PYFB 3PABB 4PV9A 4DWHA 3H2WA 2HMIC 4LIQL 4YC2C 3NFPA 3RHWK 3Q6FA 2P5EB 1N5AA 3B8SA 5KZCD 2J12B 2LU7A 3VMNA 1AC0A 5TF0A 1XF4B 1RJYA 4ZS7H 5HHXH 5EIIA 1M7DB 5EU3B 3RGHA 3SY0B 3IFPB 5F7FA 4GG6F 1I9JH 3GSUA 4WDIA 2ICWA 5E95B 4C4KO 2R8SL 2ICWB 1JZ2A 5GRVL 5T1LD 3RL1A 2EDDA 3M1BA 2CJUL 4PGBA 4JVWA 5FGBA 4AK1A 4O02H 1VDGA 1JZ5A 1CXIA 1CGTA 3BE1H 4KZDL 5SX4I 4JHWH 3ECBB 3ARDC 4U1JA 3MJ8A 1MFBL 3ET9F 1U8PA 1FH5L 2X44D 3OKEB 2NW3A 3AROA 1M7IB 3F7QA 3H0TB 3VDCA 2VRAA 1YN7B 5JDSA 3KPLB 1DQMH 2E7BA 2PN5A 3DV6A 1MIEL 4ODSH 3TJEH 4LLVA 3WHE1 3VFRA 3CK0H 3SDDA 4RMQA 3ROOB 3QDME 3L7FA 1PLGL 5J1TC 4UQ3B 1I8MB 5FO9B 1LNUA 1GSMA 3A6OA 4G9FE 3CC5B 5K9JL 4NUJB 1EO7A 1JV5B 1W72B 2GTZA 3OR6A 5E1HB 3SDXF 3Q6GH 2R29H 4KQ4H 2VQ1B 4U3CA 5C3TA 1A7QH 1OAZH 3PXHA 3UDWC 5IFHL 5I30L 2Q86A 5L0QB 2EO9A 2QBWA 5E6IA 1AH1A 4MA1B 3BD4A 2HJFA 1HNGA 5E5RB 5IMOB 4FQJL 2IAMA 3HR5B 4UZGA 3GI8L 4K8RH 4KJYB 1YECH 1JPFB 2Q8BL 3MLWL 4K71B 2H2PC 3VFUA 1WAAA 4K3GA 4XH2B 3GGWB 4JG1H 3CFBA 3D18B 3KPOA 4PJ8B 4JPKL 3NCYS 5DD1L 4HHAB 4XPTL 1NDMB 1JMXA 1NLDL 4O2FB 3UDWA 4OBRA 3VGDA 3HI1A 4XCNA 4OZGB 3BIKB 4LLUA 1IAKB 3WDIA 1C1EH 1Q0YH 2YBRB 4C83B 3ULUD 2BC4A 5T3ZD 5MHSE 3NZ8A 4PV9B 1JWMB 2ITCB 5EZIL 4ZUVB 3NMEA 1QFPA 5FKAB 4ZO8A 1T1XB 4JLRB 4LVNC 4JRYD 3GB7B 4X98A 1RJYB 1R3IL 3ARQA 4HG4K 1W0WB 4IM8A 5MI0C 3LPFA 5KTEL 4KK6C 4M6ML 3CCHA 1MLCA 4JHWL 2D9CA 4JFHD 4WVRA 4P49A 4LCWB 2D31B 1DDHB 1G1YA 4JG1L 3HE6C 5GRVK 3HG1A 4XAKE 1WAAE 4BZ1L 1ZLVH 3ARVA 2VN4A 4JO1L 3AU1A 3CLEL 4OZHF 5CJXA 4TUJA 2XA8H 2FSEB 2H41A 3ZKND 2CSPA 4MQ7A 4MVBD 1EDQA 4XCFL 2R69L 4QRSB 2A9ML 5DMKB 1CDBA 5DQJA 1YA5A 2OJZH 4KU1A 5SWSE 4MZ2A 2DTMH 4JB9L 4OFDA 5BS0E 3OF6A 3U0WH 2RFXA 1SYSB 4CDGC 1RIHH 4LDEB 2E8YA 4XHJC 1F8TL 1LHZA 3FO9A 4X6EA 4LEOB 2HG5A 1U93B 4RNRB 3S96B 4PR5A 2Q8AL 4YDIH 4JFXA 1YN6B 2K1MA 2R0LH 2VZ3A 1O7VA 3BZ4A 3RKPA 2VDLL 1UQSA 2FX8L 5JTWA 5JOEA 4JAMA 1KFAH 1T22B 1A14H 1TZGL 2AJVH 3MRIB 2F54A 4PGDB 2ZKHH 1TFHA 3MUGA 1FH5H 1QVOA 2IH1A 4QEGA 2JB5H 4PJGE 1C08B 2PXYB 4NN7C 3EO1B 4NOBA 2BRRH 4MA1C 1ZWIA 3N85L 5C09A 4XVSL 5FAAA 5H2BA 5TDNB 2VLJD 4W70A 3T0EA 4R4NC 4CRPA 1QLFB 25C8L 1Y0LA 3LSOA 4PP1C 3DBXA 5BV7B 3WE6B 4M6NL 2IAMC 4L3CB 5E2JA 3N06B 1PSKL 2XIDA 5LCVL 1FNEA 1FG2A 4M7LT 3VXMA 4HGWA 3VXRB 5GRZA 1DUYA 1VFBA 1WUNT 4I4WA 4CN4A 3CSGA 3P11H 1K9TA 2RJMA 4YHPB 2NY6B 3C8DA 4JGJA 4OAWA 4J3OC 2Z92B 1MQ8A 1XAUA 3I50H 4P57A 2HFFA 3KS0J 1P2CA 3VFVA 4QTIH 2YSSB 4QY8A 4W68A 1J8KA 2E9WA 4WO4D 4C56E 1XZ0B 5HHMB 3MCLL 2EO1A 5JXED 5HVGB 5GJTH 4P4KA 5C09E 3WUWA 5DRWB 2E3VA 4CBPA 3LN5A 1W72H 2XPGB 4PRIA 1EUTA 1YYLL 3AAZA 1RUPL 3MRKA 4D9LL 3ZKMD 1J0JA 2FECL 5GISL 2QQQA 1NGWA 3AY4C 4Z0XA 1CLYL 4D0BA 4J3TA 1V7NH 4QCIB 4HV8B 1DQDH 1ZTXL 2B2XL 4X99A 4G80A 2QQNH 2I9TA 4U6YA 1OP3H 1S7QA 1OAZL 3S97C 5CD5C 5HGDA 1BF8A 1KN2L 4P46C 3BVNB 4R3SA 2O93L 3Q6GL 4HS6A 5LBSL 2ATPA 1XGTB 1RU9L 4R26L 1I7UB 4ZUTB 1OVZA 3MRPA 3LV3B 5LCVH 5TPWL 4EN3B 4HWEL 4NNYA 1NFIB 5EZLB 3LKOB 1EZVY 1Q9KB 2X1XR 1J1PL 4GW4B 5SV4A 4NBZB 3TPUA 4XZUA 4XZUB 3BZFB 3P2TA 1MHHB 1DEEB 3MRJA 1WWAX 5E0QA 4G42B 2PXYA 4HW6A 1PGRB 2A1WH 4NC2B 3SOBL 2Z93B 2ZUWA 2B1AH 1IGJB 1JYVA 1IQDB 3SQBA 1FO0A 1L7TH 3B3IB 3HKFA 2W0FB 1LO3H 1ZHKA 1JN6A 2GJ6D 5H2BB 2HRPH 1VKXB 3QXAB 2WV3A 4Y89A 4OCMC 4PGJA 3IDGA 4J1UB 5EO0A 3AM8A 5GS2H 3WSQL 3ESUF 3O81A 5B22A 1HH9A 3W11C 5F88B 1AR1C 4FQXA 1EVTC 1KC5L 4BZYA 3JVGA 5E99L 1CN4A 1FO0L 1QKZL 3TNNA 1F13A 4WFHD 1I7ZB 3JV4B 3PGDA 4U3XA 4X9HA 3OB8A 4I0KA 3NTCH 4PP2A 4EXKA 2QSQA 2BMKA 2OX5A 4MXQC 4CVZA 2R1XA 2VL5B 5D2LB 3EJZD 2ZOLA 4QOKA 2GY7B 3KDMB 1HQ4A 4QOKB 4PREB 2NNAB 3TYFB 4GS7C 1INQB 2VH5H 1GGYA 3SKJL 1G7QA 2YUVA 1I1AB 4CGTA 2A83B 3PQYE 1FNFA 5DRZA 3S36L 5J56B 2F74B 5HPMA 1FL5A 2HH0L 3O41B 1A5FH 1S9WA 5H94A 3UJIL 3BW9B 3UYRH 4LQFL 3V4UL 4Z0BH 3EYUH 3OB0H 3QHZH 4E41B 4NQDE 2R23B 4FS0A 1BGXH 5D8JH 3SGEI 2AV7B 5IV2B 4XNYH 1IFHH 2HWZH 2DOCA 1BFTA 3SE8L 1A4JB 3HUJA 2F53A 1JK8B 2H26B 2J8UB 2EXWC 1GAFH 1IBGH 1ITBB 3FB6A 1Z9SA 1ZHLA 5GGRY 1G6RB 1YEHL 2F58L 1LO5A 3ARDD 3PWUB 4QRRB 1DQQB 1FG9C 2DWDA 2X9YA 2Z4QB 1NBVH 3L3GA 4JDZA 2YZ8A 4ZSOE 5I1JH 1EMTL 3BDXA 1OF2B 3BPCB 43C9B 2QSTA 5FYJD 1LE9B 1P4LB 3TN0B 5TQ2L 3QWRA 4D9RD 1ZKAA 4LEXH 5F6IC 4DGVH 3PIQA 2XWTB 1HCFX 1D6VH 4U1LA 5I6XB 4RX4A 4MXWL 3U46A 5EA0H 5J1AB 5DJYB 1FE8H 1AE6H 2CUMA 2EE2A 1UJ3A 2ITDA 1MPAL 1NANI 4WUKH 4PJBA 3TBYB 5CZKA 5KN5A 4PRPD 5B3JE 5C9JB 4TUOA 2DQUL 1NEZG 3X3FL 5EOCJ 4NOFA 4OZHE 4DEPB 3STBA 5E4EC 5BO1L 5IVZB 3DO7A 3PHQA 1OAXL 2J8HA 2BNQB 1AQKH 2XQYK 4NQDA 1KPRA 3OXRB 4PFEA 3SO5A 2DM7A 4JO4H 1IC5L 4G8EA 4UOW1 2B4CC 4WW2F 3N85H 3O9WC 4H5SA 1QEWA 4LU5H 3IXAB 4GFTB 5BS0B 1R5WB 1SBSL 4ONOA 3WSQH 2DJUA 1YUHB 2GI7A 4K3DH 2WANA 3B9KA 3U30C 1B0GA 1JGVL 4F7CA 3VG9C 4N0CD 4Z95H 1CD1B 1KENH 4G9FB 2IAND 3UAJC 4FQCH 1H3GA 3VFGH 4P2OA 1HNFA 3Q0HA 1ORQB 5IVXA 2ZCHH 3EYOB 4JKKA 4LSQH 4ZAKA 2I9LA 3FN0L 5DLML 3LZFH 4NZJA 2XY1A 3MCKB 4YDIL 4DKFH 2HVJB 5DEFA 5D93B 5GQBA 4NZDA 4LLMA 1JTTA 1KJ3L 4ZQKA 1X5KA 1EUUA 2NNAA 1QR1A 1NSNH 4L4VE 3UZEA 1RSFA 4LSQL 4W6YB 3G5VB 1QSVA 3ARSA 5JW4R 2HN7B 5MENB 1HZHH 2I26N 2NY7H 3RWIA 4YDLB 2OQJB 4WEBH 3CZJA 3KVQA 4M7LH 3MOQA 4WGVB 4RGMC 3GHBL 3VFPB 3RAJH 1IAKA 1WAAF 1N59A 3DV6B 2P5WE 3DNKA 3S3SA 1HYSC 2F19H 4PTTB 1JBJA 1A6WH 4IOFD 2YUXA 1I75A 1MCWW 1JI1A 3QDJA 5FKAA 1I7TB 1TVHB 3DRTB 4X80L 1GGIL 3O11B 3LN4B 3CSYB 4A6YH 3T0ED 3VWKB 5AAMA 3K4DA 4R2GC 1WF5A 3RPIB 5DHYA 3RTQB 3ZDXF 2J8UF 4MLSA 3LEXA 1NJ9A 4MVBC 3B9DA 3IDJA 3BUYB 4HEME 4UQ2A 1T1WB 1XH3B 4PGBB 5EIVA 4D0CA 1VHPA 5GGRB 1MCPL 4EJ1C 1AI1L 3A0OA 1PBYA 3RDTD 2YRPA 4NO0B 5D1ZC 4MHHG 4Y4KC 5ID0B 2H2SC 4HC1A 1RZFL 1TQCC 4NSKA 4P9HL 1PDKA 1GZQB 4QTIL 1UB5B 3E6HB 3LKNA 1SEQH 3WFCL 4LQ1A 3DXAD 5F1IA 2DQGL 1F4XH 4HGKC 4MXVF 5AZ2H 4XNMA 5DK3A 1AGEB 4CU6A 1IBGL 1D5BA 1M1SA 5F44A 4YHZH 4IMKC 3O45B 4MAYD 4AH2B 5I1HH 1LE5A 3OKYA 1MCHA 5CKAA 4N0UA 5ERWA 3HNTH 4NHCH 2ZUVA 1A6TA 3I85A 2F5AL 5HYSB 1J05B 3T1WA 2W0FA 2XQBH 3T0AA 5HHQA 3SDXE 2YPVL 3IFLH 2UWEB 4PJCE 4AY0A 5HYFA 8CGTA 5DR5H 3O9WD 3QQ3B 1R3JA 2BY2A 1LEGB 2Z8WC 2UZYB 4LSSH 4FFWC 4KTDL 5SWQB 3VXRA 5BCAA 3ZYIA 1AJ7L 2EDWA 3DI3B 4OQ1A 3PWVA 1E27A 2F54E 4XNQA 5ECJE 4XXDB 4R0LC 4I3SL 1FVEA 5CIPA 3D2UA 3CLFH 3JTSB 1NCDH 3MRRB 3UEZA 4G6AC 4HH8A 4PRHB 4QRTB 4MB3A 1TZHB 1UM4L 1QACA 3ARBC 4QXWA 4UNVA 1ZVYA 3IJYB 5IHUH 1E6OH 1L9MA 1OTTC 2RCSH 4YDJB 3RL2B 4Q6IC 2JKXA 2D4FA 5ALBH 2W9DH 3CXHJ 2C4FT 4LARL 12E8H 2A38A 5FM5O 5L2KE 1AO7D 3G6JA 4JKMA 2W9EL 4XNXL 3DYMA 3HAEH 4KDVA 3LN4A 3PP4H 2DAVA 2E8ZA 3WLBB 4OI8A 1NFKA 3MSPA 1ES0A 3QH3B 3A6CL 3U1SH 3ULSA 3QG7H 2QHLA 4JREC 5JO5B 2H2PD 4F2MA 2GTWB 3FQXB 4NN6B 2YKLH 1DQJA 5TH2A 4ODWB 5F7DA 3TNMB 4BYHA 3L3OB 1AKJA 3MRIA 2EDYA 3SDAB 4DCQB 4UDTB 2F9BT 4CVUA 4BQBA 5FGCE 3FB8B 4Y1AB 5EBMB 1GPOL 5HVWA 4PJCF 5FK9B 1ETZB 3CFJA 5C07D 4BH7B 1ETZA 3CFJB 4G9FD 4KKNA 5CSGA 2E9IA 3MGOA 3GSWB 4HT1H 2KPNA 4V1DB 5GRXG 1JTPA 3S4SG 3ZE1E 1PKQA 3BYTA 3RIFF 3MNWA 5D72L 1DUZB 5DWUH 5E2TL 3GMRA 2DWEA 2BNRA 3QXWA 3GSXB 2I60H 1Q1JL 2J6EA 5D7JB 5EC1A 1FN4A 2I5YH 3DBXB 2XQBL 3BIAX 2FRGP 1SY6A 3G6JE 1QFUL 1C5CL 3HAEG 5C7XH 4YFDB 4HC1H 3G9AB 4O5LL 1G7PA 4LLYA 3STZB 5JW5A 4U6HB 3DGGA 4EI5C 1VKXA 3MXVH 1FC1A 1NBZB 2MTPA 1LK2A 4OM1L 4Z5RA 1A3RH 4Z7NF 3O3DA 3QPQD 2J6EL 5TDOA 1OSZB 1OWRM 5LGHL 1IRAY 4YPGB 2A6DB 4O5LH 1RQ5A 3FONA 1KN4H 3BZFA 5ID1A 3ARBD 1P4BL 5T5NG 1RVFH 2Y6SD 4P9HH 5IESL 1CFQA 1RIVL 4F3FB 1GGCH 1FV1A 1K8IA 2BVQB 4WTZA 3S37H 3LRSA 4PJGF 3D0LA 5CIPB 2RHEA 1EEYB 4FXGA 1LP9A 1A6VH 4M61A 3MRQA 3WFHA 5DVOA 2R1YB 2IH3B 4EI5D 1FAIL 2VDRL 1EHLH 2BNRE 4JPVL 3NIDE 3BT2L 2VDMH 2BC4B 1A1MA 4FQHB 4M7JH 5DGQA 3IRPX 4BKLA 1NGWB 2EZ0C 4ZODA 4YNYB 2AJZB 4X80H 4FQ1L 1MF2H 4PJDF 2XKSA 2FIKA 3HUJB 3UTSB 1OGAA 3DXAB 3FQNB 5F7KC 3VFTB 1JPST 2FEDC 2DJSA 5ESVB 3SDCC 4M02A 3CSBA 2XY2A 5DT1L 5CCKL 1NBYA 4QOKE 4BFBD 4WFGE 4DCQA 3L3IA 2WBJA 5J3HC 4FFZL 1P7KB 3FMGL 1NSNL 4P48A 3U7WH 2O5YH 3SE4A 2CK2A 5F1SA 1FFQA 2EYTB 1Z6JT 2OR9L 2BVPA 5LGKA 1Q38A 3GSVA 1XGRB 5HJ3A 1G7IA 1P7QA 2C3VB 4ZUUA 4R96A 4O51B 5E2VL 2NY4D 3LQAC 43CAB 2Z8VC 5CZVL 4XP5L 3RZWA 4KXZH 3RWHB 3ALXA 1E4WH 4RDQG 4IDJL 1K8DB 5DD6A 1MCBA 4KZEL 3L3DB 5IB1B 4NQEB 3CU1A 1NAMA 1JGLH 3FT2B 5FXCH 2BSED 1T0NA 2NY5C 3FQRB 2AEPL 1IL1A 3VD5A 2CKBL 5DUBB 1CG9B 1EVUA 5IFJB 1CL7L 3I2CL 3NZ8B 2V2TB 1BZ9B 4OLYH 1VEOA 4OTXL 1UWXK 4PRBB 1W0YT 5HYJD 1DBBL 1V8HA 2ZWLT 4M6MH 4RGND 1YQ2A 1G7JA 3VGBA 5D2NA 1JWUA 2QQLL 3FAXA 2F74A 4PJHE 1CF8H 2E7LA 1Q9WB 3BH8B 1KPVA 3VXTA 1I3GH 3LQZA 4JRXD 4YXLL 4DN3H 1CICA 3NCBB 3U9UB 1KIPA 3O3BA 4AG4L 4XNQB 5GZNC 4YHMH 2DD8L 3LHPH 4JY6B 1KYOK 2DQHL 1X4XA 3EO0A 5B38B 2XPGA 2XZQL 4ORGB 1YJDL 1VFMA 3A67L 1BD2E 3QUXD 5FDWA 2PO6B 3KWWA 3BEVA 4LCYA 2D7NA 3CDFA 4GBXB 4NDMB 3D69B 4NQXA 1UXWB 4QRQB 2WUBL 2O5ZL 3KPLA 1DVFA 1I9RH 2ICCA 1MI5A 5EULV 2CGRL 3LKRA 3P9WB 4B7LA 4PP2B 5I75C 1R5IB 4UQ3A 5ALCL 1CD9B 2M2DA 3TA3A 1F3RB 1A5FL 1ZV5A 1IM9A 1MFEL 1QSED 3H7BA 1WT5A 2NY4C 2FX9H 4X83A 3MV9D 2AEPH 4PJDA 1GYAA 1OTSD 1AXIB 4XBEH 1CXHA 5KVGH 1JGUH 4L4VA 4G8GE 3QCUH 2EIBA 2JB5L 2FR4B 1O5DT 4I0PD 1OP3K 5ISZE 2RAMA 3GI9H 5EU5A 5GGQH 2DF3A 2B4CL 5E9DE 1OARH 5C0JA 4E41E 1QLEL 2WP3O 2HLFC 3QZWA 2RBLA 3O2WH 3MXWH 3GM0A 1R3KB 3PP3H 1KF9B 3IFOA 4XCYB 1RK0B 1QRNE 1RK0A 1VACB 2OTWA 1MCIA 3QIBD 3AREC 4XX1G 2HVKB 5IB1A 4HUWB 3HLAB 1NANH 3EHBC 4OV6F 3WHE0 4PJGB 5BJTB 2VDQL 4MA8L 1PEWA 1JGUL 3ISWA 2GT9B 3ARFA 5DC9B 1NCBL 4W4NA 2ZUQC 3MJ9H 3VGHA 1XF3A 15C8H 2DQFA 1GH7A 1KELH 3MLRH 4MNGE 1I1RA 1GGBH 3QQ3A 4TVPD 4G8GA 3EYQD 1BEYH 4WO4B 4GRMB 4QRPA 1I1CA 1FL5B 4JZOA 4PD4K 1MREH 3CAFA 1YYMH 2Z31C 5IBTL 3H8NA 1WICA 4O2EB 5DURB 4NN7B 2PXYC 5C0AB 4H8WL 4UAOB 1U8IA 2VOTA 3QIBB 4CL7A 3WKML 2Q20A 5I74B 5F1NA 5FDWB 2LFGA 1MCRA 1FG2B 1QFOA 2W92A 1EGJA 3IAGC 1T66C 1BZ7B 2Q1EA 4YX2H 1Z9LA 4PG9B 1U8NB 5D70H 1A9EB 1RZ8A 4CN6A 1TJGL 5L88H 1BBDH 3QEGH 2IBBA 4PJCA 5GJSL 3QUYB 1C1EL 1Q0YL 5I1DA 5KSUB 2BY1A 3JV6B 3CVHL 3BKCH 1TDQA 1FVCB 3KYMB 1NCAH 4JPKH 1VFAB 1SJXA 1BX2A 1QG3A 4MHHI 3V4VL 1I9IH 3VFPA 3IJYA 4LCWA 2GY5A 2VLRE 3ZKQD 5J11C 1Q9KA 2HFTA 3UJIH 3GSOB 1SEBA 2ICES 1LO4L 3NFNB 3OJDB 2VITB 4PJEE 3RWJA 1A7RH 4PRPA 1QLRA 3V4VH 5I73C 5FUZH 5CZVH 4TOYL 4NZUL 5HGBB 3P4MA 3MRMA 3FO9B 4X6EB 3ORJA 4XBPA 4PUBL 1IKFL 5L2KB 4M7KH 4CMMA 3U0TA 4IBLT 3Q3GB 1NFDA 3IDNB 2ED7A 3D25B 2VDNH 3C5ZC 1FN4B 4YDVB 1A6AB 2YA2A 5MI0B 4WHDA 5E99H 2P1YA 2W65B 1WBZA 5E2UL 5A43C 3OL2A 2ZUYA 5DVLA 1YEIL 5F93C 3MLXL 4LLWB 4WI2A 4LVNB 5L6YH 1RZGA 3LRHA 1RZGB 4XP1H 3CDGB 3IDMA 4LPYA 1MEXL 1S5IH 4JG0L 4BFIB 4IRSD 1BVLB 4YBQC 4Z7WA 3GDBA 3QUZC 2RIKA 1EJOL 1P4IL 3SKOA 2VSCA 4KMTL 5FCUH 5C3LD 1KEML 3EGSB 5A2KH 1RUAH 4R8WL 5T1DH 2IALA 3FRUB 3QUKA 1RUMH 3UMTA 3BZEB 1C16A 3V79C 2AEWA 4P46D 2XNAA 5GGTL 5L7XL 5LWYL 1F6AA 4O2EA 1GGIH 1UACH 2C1OB 1S7SA 2NTFB 4RGNB 4YNYA 1OGTB 3QUZA 1DSFH 3T08A 3N9GL 4PJAB 2BP3A 2A9NH 2NQCA 2UY7A 3MLTA 2NR6D 4HUVA 4RQQA 2DDQL 2NXZC 5DUML 4Q9RH 2BVOB 2D2OA 4J4PD 2JJTC 4FP8L 1CDYA 3KYAA 4FTVB 1GGCL 5IOPB 3DROA 3WHXA 3N50A 1ZMYA 2HT4D 1T1XA 3R0MA 3B2UC 4R6UA 4JJHA 4JO1H 2AXGA 5L2JB 4MA3A 5HD8D 3IKCA 3K4ZA 2AXGB 1KB9J 2YUZA 4ZAKC 4D94A 4NPYB 1JF1A 3SJVB 5EU3A 3C8HA 2VZ1A 1U9KA 4OZIF 3GMQA 5FFLA 2LE9A 1FJ1A 3BP5B 5M7QA 5T1DL 1TLKA 3H7BB 1G0DA 4J3XA 1K4CA 5IMLA 1YEJH 1OARL 1EA9C 3L95B 4XC3H 1A1OA 2NR6C 3C5ZD 4HC1L 1DUZA 2B4CH 3O8XA 3TPUB 4AQOA 5L9DL 1KBGH 1Q9OB 3CMOL 5K9KB 2GITB 4HV8A 1BIHA 3DGCR 5I8KH 1LDSA 3EBAA 3QDAA 5HYSA 2KBGA 5JA8B 1U92A 4Z76B 1XIWB 2MKLC 5DDHA 3BKYL 2R4SH 4OF8A 1G9NH 4X99B 2ZSWB 4U6XA 4RRPG 5ESAA 2BNQE 4NNPL 3VG0H 1YY9D 5TDPB 5DTFA 4QT5A 3GHEH 4ZPTA 4RAUB 3MLZH 3MLWH 2FSEA 2MCG1 2Q8BH 3GI8H 4Y1AE 4NRXB 3LH2H 4LVOC 3VD9A 2C3XA 4Y4HC 1YMMD 4K94C 2R0ZH 4JM4H 4P5TD 1ACYL 3IFNL 5FUCE 5CEXB 3QFDA 5BV7H 3HFML 3RVXC 3VU2A 4BSWB 5I8KL 1OLLA 1KACB 4GXVL 2QKIA 2X4UA 2YN5A 3TLRA 3GFUA 4X7SH 1C5DA 4JRYA 1JZ6A 4MDJB 5IMMA 1HSAA 3T2NL 1IQDA 2PR4H 5IIEB 5BW7A 2G60H 2VC2H 3QIWB 5IIEA 1IFHL 2HWZL 4XNYL 2J8UE 3U7AA 3VWKD 2VLJE 4K55A 4LHUG 1LO2L 3QEGL 1KJVB 5I16B 3UC0H 5AZEH 1LEGA 2VIRB 2PR4L 3WFZA 3DROB 2PW2B 3O9WA 1EJ6A 5EIIB 2X1QA 1G7MA 1OP5K 1AP2B 1Q9LB 1W2KT 2Z9TA 5FM4A 5DHVH 3K4AA 5D7IE 3RWEB 2OJEB 1IZKA 3HFMH 4NFDA 5CHNA 1ZWIB 3QCVL 3RGVB 2QV2A 5JQ6H 2WBJC 3SGDI 4P4KB 3HPLA 1DFBH 2DICA 1ODAA 2C1PA 4HIEA 4YFEA 4NO3A 4X9IA 5MEOB 3FT3A 1RUML 5DYOB 1NGXA 2JJVA 1GXEA 3OMZA 2JJTA 1U3YA 5IWLC 3OKNA 1F3DJ 1TCRA 5T3ZE 5MHSD 4ZPVB 4N8VG 2AV1A 4LAQL 3KLAA 3C60B 4HK3J 3ILPA 3K8KA 3OZ9H 1EHXA 3A67H 1T2QL 3REVB 1CR9L 4EBQH 5CJQL 2PKDA 1I8MA 3O8XD 1FLRL 1EBPA 5HDOA 2AK4E 3B4NA 4MCYB 4ODWA 3HS0A 1MCKA 1SYSA 2VDNL 2GKIA 4PYHA 1ZOXA 1BECA 1NBYB 3B2VL 3TYGL 3X11A 4C4KT 5SWSB 1CFSB 1CL7I 4EIGB 3LQAH 1NFDB 3IDNA 5JPNA 3CH8A 4K23H 3E0GA 4NSKB 1R0AL 1MCPH 2FBOJ 3EYSH 3NACH 3ESVF 5I71B 2E5EA 4I3SH 2JJSA 1SMOA 4QYOB 4NN5C 1Q9WA 4RMRA 4APQD 4XVJL 2G9HA 2H3NB 3VFOB 1FAIH 1MH5A 1OPGH 1UKQA 2OI9C 2KUTA 3GMLB 2H6PB 1MHCA 3C5JA 5KVGL 2CR6A 3VXOB 5DMYA 1VGKB 2ZSVA 4DN4L 4Q9QH 5E5MA 2XKUA 3ES6B 3G9VA 5I1IH 1OPGL 3F5WB 3NA9H 1FSKB 4XCNB 3FAWA 2P8MB 3IAPA 1FL3A 1I7UA 4ZUTA 1N59B 3HNTL 3QPXH 4NHCL 2A0LC 2HVJA 5DEFB 1JIBA 5I8OL 1BBJB 1E6JH 1KXTB 2J6EH 2ITCA 3QEQB 3U83A 3WIIL 5I16A 4K23L 3ZZ1A 5FF6B 3VRLE 2WBJD 4M8QB 1A1NB 4JDTL 1BBDL 2EYSA 2A73A 2Q8AH 3WNKA 1CLOH 5DSCA 3MFFA 4XMKL 3MLUH 3OAZH 4D0DA 5DVMA 5I73B 3GSRB 1FLRH 4DGIH 4DVBB 3UTSD 1MUJA 3J7HA 2FO1A 2MJWA 3HHRB 4JCMA 1EJOH 3ZTNL 1N64H 1N6VA 1XGUA 5FO8B 3HNSL 5I1AA 2V7HB 5FO7B 1CXLA 1NMAH 3FCTB 3JWDL 4XNUH 2IPUG 2DS4A 4RGNE 1S7UB 2DL2A 3VRJB 1WC7B 1JNLH 3PQYA 2WBWB 4LSDA 4PJHA 3QWOB 2AJ3B 1ZLUH 3EDDA 4MX7B 2VXUL 4GRLB 4Y2DD 5FYLE 3ULSB 3D5OF 4YDVA 1R3HA 4M7KL 3WEXB 4JN2B 3EOTH 4KGJA 3L5JA 1D3CA 3GBMH 2Y06L 2ZG1A 3U1SL 2EEDA 4ONFL 1P4LA 4LIQH 3IDJB 2VTFA 5KSBA 1FCGA 2IAMD 1F58H 4GS7B 2AABH 4P59L 2VDLH 4ZSOB 4XPFH 4WNQB 2HFGL 4NO0A 4HJJL 3DLQR 3EOBA 4OCRH 3WXWH 2OR9H 1HH6B 2FEDD 2J4WL 3JXAA 2ADFL 1DBJL 4G5ZL 2IJ0C 3DX6B 5I15L 1MHCB 3C5JB 4Z8FH 3I6GB 1GAFL 4NKMA 4TNWF 2V2XA 1HE7A 1HKLH 3KAAA 4WWKC 4PJAA 4QRRE 2BOCA 5GXBB 2OJZL 3CDYA 2I5YL 1IGYB 2E6JA 2Y06H 5I1EL 4U1NA 5AYUH 4OD1H 4OZIA 5ALCH 1ZEAH 4P3WA 1W72A 1H15A 1MF2L 2GTZB 3OR6B 5IEHA 3FJTA 3H3PL 5AEAA 5DD0H 1D5XB 3VMPA 1MJ7L 1A4KB 3V6FA 1PY4A 2J7LA 4NRYB 4ZUWB 4QLRA 1JTOA 1MIML 1UB6B 2HKHH 5EUKB 1I1AA 4TULL 3ZL4L 5BO1H 2R4RL 3DTXB 2V9TA 3MGTA 1NMBH 4F7MB 1OQOA 4PJXE 3O6FC 3OSKA 2GCYA 3K0WA 3S3JA 2F53D 4ODVL 3GRWL 4Q9BA 4AEIL 3NAAL 3F7VA 3QEUA 1R5WA 2XTLA 4WTWA 1KNOA 4HLZH 1JNNH 2APVA 3L3IB 3VXSB 1P69B 2EKSB 4RISL 4B50A 1YJDH 5BVPL 4DZ8B 2FL5A 1EXUA 4QF1B 5FDYA 3V6OA 1B6DA 4MNGA 3BEVB 3CZFA 3WIHL 4XI5D 5CAYB 1NAMH 1A7NH 2LU3A 1OLZA 3OZ9L 2GFBA 3S8WA 3EJYD 4OCSH 1CE6B 3WUWG 3P30H 5JW4M 4RMWA 4DGYH 1E6JL 1IAIH 3AFLA 1KFAL 1V3JA 1HKLL 1CL7H 3I2CH 2BJML 1XGTA 4F7TA 2CKBH 1FHGA 4O4YH 3TESA 1MAMH 2OXHA 2YA0A 2JJWA 5D1XD 1EBAA 4J6RL 4RWYH 4P59H 1DL7H 3TH2T 4WDIB 1NMCC 3ZT7A 3S36X 2X70A 4NKDA 3RHWF 2IFFL 4CADA 1ZVHA 2ZCLL 1MNUH 1F02I 1JNJA 1U8QA 2HT3C 1DBKL 1YMHA 4BH8A 3B9VA 3F62A 3ARFD 4PRIB 4P4KC 4WW1A 4RAUA 4M5YL 5GS0L 1TVHA 5L2KD 1EO5A 1HHKA 1LE5B 1S5HB 3ZSSA 3GSVB 5D9SB 1OP5H 4HXBH 5JHLL 2FB4L 4XRCA 3SGJA 1XEDA 2VDOL 1Z9OA 1XIWA 1U3HA 5DDHB 3I3EA 5F72S 5BZDB 1IC4L 4RQQB 1G7LA 1QSFE 1A0QH 4LSPH 4OV5A 2G60L 3IXAA 5BS0A 1WK0A 4N0UB 1U8OA 3F7YA 3HCVA 1NCBH 3TIEB 4YHNB 4NKIH 3V8CA 3VWJD 4GKZB 2XACC 1A7NL 3D69A 4NQXB 1NEZB 4XHQA 1P4IH 2JJSC 3QO1A 1FLTX 4I4WB 5JOPD 3DSFH 4LHJB 1UB6A 2V5SA 4PGEB 2AKRA 2FH8A 4OIAA 4KKLC 4JO2L 3G5YB 4O02L 1JWUB 1AR1D 2A83A 1KPUB 3QZWG 3EYOA 4FZ8L 1J12A 1OY3B 5IHUL 5IB4B 5BRZE 1HILA 1YPZA 4LDLB 2XN9E 2C1PB 2YR3A 4AEHH 4UT9H 1KEGH 1TTFA 3QT2A 5HHPA 2I07B 3H3KA 2XTJB 4EEEA 3S37X 4XCEA 4H1LG 2OL3A 2MHAB 2IPTL 3EOAA 3S9DB 1QLEH 4AL8L 3KLDA 1OAXH 4YK4C 2F54D 3QDMA 1OW0C 5FIEA 4LSVH 3S4SA 4LBEA 3BEWB 3P0GB 2EC8A 5KJRH 4JKWA 5EUOF 1UWEH 3U82B 1VADA 4YPJA 5E70A 3LSOB 1RY7B 1LGVA 3IDGB 4UB0H 1K6QL 1ES0B 3QH3A 5DJDA 2J8UA 3LMJH 3NA9L 1ZEAL 5T3ZL 3FZUD 2VLJB 4OD1L 1A47A 1GHFH 1F3DH 2VLJA 5DK2B 5F9AC 2HTLC 4PRNA 3T8XA 1ADQA 1IGTA 4QWWC 4PJAF 5KSVA 1FFRA 3L3GB 4JDZB 1HSBB 3TVMC 4KC3B 4JM2F 3ROLB 4PS4L 1TZGH 5JPMA 2E6PA 1IMHC 1QSEB 1T6WA 4P5TB 4R3SB 5EU4B 4D3CL 5DQ9B 4K2UL 3ARGB 4L4VB 5E6ZA 2EDKA 4OM1H 4S1DD 1WTGT 3LQAL 4ODXB 5BRZA 1OAQH 4OIBA 4FA8A 4X7SL 3WO4B 4YDKH 1BFOB 1LILA 3ARXA 4NNYB 2J4WH 3WFCH 4G8IA 1C12B 3WXWL 3NACL 3KJ6L 4JY4A 4FNLH 3WFEH 3OBAA 4HKZB 1AD9B 2EDLA 2VLKD 4HJJH 4MNQD 2GK0B 3RKDD 1FSKC 3V2AR 1WFOA 4QYOA 5E6YA 5IVNA 1I3GL 1NUDA 4F9PC 5TE6H 4XH2A 3EO9L 5BW7C 5FHBL 2BSTB 4R7DB 2DDQH 3IDIB 4ZXBB 2HT4C 4M93C 3GSXA 3ZSTA 4FABL 2OP4L 5EBGA 5F9OH 3L3OA 1RJLA 3GSNA 2VXUH 2E7CA 2KZ1B 5F1NB 4M6OL 1OHQA 4IJ3B 4LDOB 5DTFB 4L3AA 1IGFH 3EZ8A 5JQ6L 4L9LC 2VXQH 1RK1B 4AEEA 5HYJA 32C2B 5MP6L 4ETQB 3FOLA 3M17B 5KVEL 5A2IH 4FRWA 3PDOA 2YEZA 4IJ3C 5CHNB 1KELL 3QSKB 2RQ8A 3ARZA 3MRLA 3PJSB 3DIFA 2CUIA 3TBWA 1MPAH 4ZUSA 4LLAA 1RAMA 3HE7D 1X9QA 1T03L 4PP1D 4K7FA 4ZTPH 3MRHA 1J8HD 4ELMA 4BUHA 1PFCA 4FZEL 4KJWD 1EIBA 2D7QA 4H26B 4QWWD 5KW9H 1DBJH 4G5ZH 3D18A 1JHTB 3STZA 5JW5B 1JWMA 3VXMB 1YC8A 4ZD3L 3UX9B 4L3EB 4JGMA 1I1FB 1OL0A 1QR