2PCPA

Antibody fab complexed with phencyclidine
Total Genus 39
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
39
sequence length
216
structure length
216
Chain Sequence
DVLMTQTPLSLPVSLGDQASISCRSSQTIVHSNGNTYLEWYLQKPGQSPKLLIYKVTNRFSGVPDRFSGSGSGTDFTLKISRVEAEDLGVYYCFQGTHAPYTFGGGTKLEIKRADAAPTVSIFPPSSEQLTSGGASVVCFLNNFYPKDINVKWKIDGSERQNGVLNSWTDQDSKDSTYSMSSTLTLTKDEYERHNSYTCEATHKTSTSPIVKSFNR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of monoclonal 6B5 Fab complexed with phencyclidine.
pubmed doi rcsb
molecule tags Immunoglobulin
molecule keywords IMMUNOGLOBULIN
total genus 39
structure length 216
sequence length 216
chains with identical sequence C
ec nomenclature
pdb deposition date 1998-06-02
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2pcpA02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2pcpA01
4GKOA 4FFYH 2E8ZA 2W0KA 1I8LA 4JN2A 4MNQD 3GMRB 4YBHA 5FECB 2AV1A 1SYVB 4F7EB 3ZDZF 3ALPA 4PJHE 1LVEA 5DJZA 4B50A 3U7WL 3M1BA 1LGVA 3QA3A 5SV4A 6FABH 2R1YA 2GTZA 2J8UA 2XFXB 3GMMB 4NJ9L 3B43A 1NFIB 3TC9A 4MYWB 1CXHA 2CGRL 4ZPTB 3ARFA 1RPQA 2Z35B 4HX1B 3VU2A 1GOHA 1QRNB 4G80B 5IFHL 4KZDH 3RVVD 4QHKJ 3ZKND 4JO2H 2AJ3B 4JO2L 4K3EL 3NCBB 4GQ9H 4M7ZC 1JYVA 4WY7H 3I3BA 5IESL 3O45A 4G6ML 1ZS8A 2AJXL 1Y6KR 3LQZB 3TT3L 5T1DH 1UQSB 4TSBH 1GGUA 2EDFA 4P9HH 4OM1H 4WFFD 1FYHB 3O2VL 3JXAA 3P4MA 1K85A 2P5WA 1RZKL 3TGXA 1HXYB 4HT1H 5J12B 3BWUC 3VW3H 2HAZA 5I16A 1TETH 5JIKA 3K7UA 1DL7H 3F58L 3PDDA 3STLB 3RNQA 1S7SA 3DLQR 2QQNH 4PRPA 5AG9A 4XNXL 1KCRH 4GAYB 4WEBH 1U2HA 3EFDH 2QL1A 1K3IA 2P5WB 1T2QL 1J11A 3DX7B 1F90L 2P8PA 4BZ2H 3LKQB 3ZL4L 4GRWB 3PHOA 1BEYL 4RX4D 3BOVA 5JXAL 3QFJA 3CXHJ 3RY6A 4F7TB 1UYWH 3HAEH 2BOBA 3EOTH 5JW3H 2DLFL 3OX8A 2HLFC 4XMPL 1HNGA 3C60D 4PJEF 1AO7B 3FO9A 4KK9D 1OAYL 4J12A 5IW1A 4CBPA 1ZHBA 3RWDB 2LFGA 4PRHD 3ECBB 1VENA 4P23A 3CVIL 5DK0A 4PP1D 4JHAL 4JB9H 1N6QL 5EIIB 1ACYL 1XGQB 1PEZA 1P84K 4ELMA 1RV6X 5T3ZL 5D93C 4KROC 4Y2DD 1I7ZA 1M7IA 4D0CB 1KB5L 3AY4A 4MJIA 5D71H 4JHZA 1CXFA 4Y1AD 4PJIA 2E9BA 1YPZA 4M1GL 4MNQE 1H15A 2ZG1A 2F54A 2IQ9L 4OFDA 1F11A 4LCIL 4JG1H 3DX8B 4PJCB 5T1LD 4U2YA 1Q0XH 2LTQC 1SYVA 5BS0E 4OZIF 3LHPH 3GNML 1NKOA 1PSKH 3EJJX 5KVFH 3TVMD 1OM3H 3MXVH 5EZOL 4PLJC 4GG6B 4ZPTA 1KULA 4WO4D 5DO2D 4HW6A 1LD9B 2E6PA 4JFYB 4FFWC 1U8OB 2AJ3A 1KELL 4K8RD 5AZ2L 3O3DB 3L7EA 4UDUA 4RBPH 2YXMA 3V52L 4HIEA 3O4LD 2P45B 3D48R 5I8OL 3SDCB 1OAUL 1KJ2A 5ESQA 1ZLSL 5IW3A 1UH4A 4O58L 5BO1L 1UWEH 3IFPB 3QUMA 1MQKL 3BGMB 2XG5A 1AD9B 1UACL 2BOCB 3DIFB 3VFNB 5HXMA 2IQAA 3BEVA 4N0CC 4R4BB 3V6OA 4CN1A 5IHZB 3WN5A 3MBXH 4NQUA 4LAJH 3WFCL 3PGCB 1EV2E 3OKMA 5J13C 1CZ8H 1CYGA 2C7UB 2OR8A 4LSRH 5ALBH 2H6PB 4X4XB 4EDWH 3OAYK 3GKWH 2J4WL 3VFNA 1L0YA 4N0YL 1DDHB 4JFHD 1HINL 3D2UD 4NO2A 1IKFH 1KTKE 4ZUUB 3CFBB 5E6IA 4KHXH 4NT6A 4IOFC 4M48L 1MLBA 1KPUA 2ZJSH 5I8KH 3VXPB 3V5KB 2N7AA 1OVZA 3QUZA 5FKPA 1OTTC 1UWXH 4QWWC 2BSRA 3QDMB 1BREA 2PTUA 1BQHB 2NY5C 4GKZA 4JFZH 1KG0B 3D3VB 1RJYA 2EDNA 1IAOA 4ELKB 2IQ9H 4ZTPH 4PREB 4JPWH 5FK9B 2EDOA 3HI6H 4G9FB 3DSFH 1AR2A 1IL1B 1NBZA 3HE6A 3HZMB 2DAVA 4RMUA 1KIRB 1J8KA 3F65A 5DD0L 5F7HA 1WSST 4ZTPL 3BPOB 2NXZC 5GGVY 4ELKA 1GGIL 4OF0A 4MJ5A 4L8SB 2UWEB 3WN5C 2CIKA 4GBXC 2XWTB 3R0MA 4MVBC 4TVPD 4NQTA 4JKLA 1NMAH 3T0EB 1KIRA 1GGCH 3OV6A 3OJ2C 1QFPA 2VDRH 2H32H 1VB9A 2AK4A 2D31A 1J8HE 2AJYL 3QISA 2A6IA 2OP4L 3SJVA 5CD3A 5E8NA 4V2CB 2E7LC 3FRUA 2F53D 1U8OA 1YNKH 3KDMB 5JA8B 4Z78A 3NACH 3NFNA 4Z18A 3VMPA 2W60A 4PR5A 4X4ZA 3QFJD 4K3DL 5JDSB 3JTTA 1K2DB 3TPUB 3L9RB 5HPMB 1KT2A 1J7VR 3KLAA 2YD3A 1KJ2B 3IFNH 1RK1A 3HB3D 3QIUA 1MHCA 4OLWH 4MWFA 2FJFA 4Z8FH 4Z6AT 3AMKA 4JY5H 5FGBA 5F7NC 2QSVA 4J3XA 5FM5O 1CGSH 3HRPA 3QPQC 2VXQH 3D3VD 2QSQA 4QWWD 4GW1B 4W68A 1OTTD 4KTEH 5K9QG 4KKBC 3TFKC 4X6BB 5ALBL 4OZGF 1U3JA 2X41A 3ARSA 2AXFB 1RK1B 2XXCB 3QIUB 3FT3B 5EPMA 4HEPG 3WUWB 1V3KA 3PWJB 1ZGLB 2H6PA 3OKKB 1TXKA 3LRHA 3CZFB 4MD0B 4MAYB 4K3GA 4GSDH 3KR3H 3MNZB 4EN3C 4CMHC 3T2PA 3LH2L 4JDVA 4NYLA 4DZ8B 4X7SL 3K1DA 5IB2A 1BF2A 3WNMA 2Z8VC 4NT6B 3TCXA 1LNUB 1MLBB 1ACYH 1HOCA 2C4XA 3FN0H 4J7RA 3STZB 1WBYA 5CWSB 3MJ9L 4U7SA 1BVKA 4PV8A 3FFDB 5F96L 3PWJA 5DS8B 4J1UB 3TJEL 2BDNL 1E6OH 4P48A 4UILL 1YEGL 3CK0H 2EYTB 2ZSVB 3ZKMD 5KZCD 5ANME 3GIVA 1H5BB 3RUGA 4PJFB 1KB9K 3V6ZB 3HG1E 1RD6A 1C5DB 1IZJA 1JPSH 3SE3C 5SWSA 4XP9H 1MUJA 4KHTL 2ZUXA 4QY8A 3KG5A 4JLRB 5GS0H 2QEJA 1MWAH 3KS0J 5I17A 4OLZH 2LAAA 2ZNXA 25C8H 1I7RA 4HWBA 1IT9L 3GNMH 3VXNB 5DJ0B 5D4QA 3BQUC 4NFDA 3V6ZA 3O8XB 1OAQH 3K2UH 4Z95L 5ERWA 5SWSB 2ARJA 1TETL 4K9EC 3FT2A 1A1MB 2VLLB 1KGCE 4UBDD 4TSAL 3VD4A 1RZ8B 3PL6D 4M7JL 2I5YL 1UXWB 5F3BA 5MEOA 1I7RB 3V7MA 1YC7A 4JCLA 3OR6B 3HNTL 1Q0YH 2BVQB 2EE9A 4OD2A 1BIHA 3UJIH 4QRRE 2DBJA 1UM6H 5EU4A 1L4IA 2WIIB 4LVOC 5D96C 3RVWC 1O0VA 3BMWA 4AEHH 1ITCA 2OX5A 3X14B 3RWFA 1F97A 3DUUB 3QCTH 1BZ9A 1OLLA 2RBLA 5IVOA 3HE7C 2CKBB 1FNSH 4RX4A 1M7XA 4P2RA 3ABZA 1GGTA 4NHCH 1GAFH 4WEBL 2YUZA 2HG5A 5DC9B 4UTAL 4JHBA 3CDFA 1XGPA 3C9NA 3LIZL 1L9NA 1SJEB 4NC0B 3MMEB 5IMKA 4OZIB 5DLMH 4ZOAA 1VESA 3CLEH 5DFVD 4YFDB 3NPSB 2NX5E 2WV3A 5SWZD 1NKRA 5JQ6L 3F7VB 4NCC2 4OCWH 2EXWC 5JW3L 4GMTL 3X17A 2DQHL 4KV5F 1G7IA 1WAAA 4U7KA 4YGVB 2APXA 4PJ8C 3DX6B 2VE6A 4Y8DC 3F62A 1G7HA 2Q8AL 3CH1B 2J8UE 3I9GL 1D5BA 4ODXA 3BDXA 3AREB 2MHAA 1KCSL 3SQOL 5DDHA 4C59B 4NO5B 1KEGH 1TZIA 3OKKA 4PRNB 1CD0A 1YMME 5I76B 5JTWA 4C83B 3RIAF 1FVDA 4HIEB 5JNYA 4LLDB 5F9WB 3U30B 4HUVA 3V0WH 1VHPA 5C0EA 2PO6B 4KK6C 1PG7X 3RA7H 5GS0D 4R7DA 3FQNA 4Y1AE 3EJYC 1LNUA 2ATKB 5GRUH 3LEXB 3OGOE 3WHXB 3TF7C 1DQQB 2NZIA 5IV2B 1C08B 2HFGL 2QQKH 3FONA 4KTDH 5BQ7B 1T1ZB 4PBXA 3B5TA 4XPTH 1SY6A 3LKQA 4PJ7E 1A6VH 5KSBB 2Z9TA 4XMLH 4CKVX 1E28B 4P4KC 4LFHG 1J0YA 4LHUA 1U8QB 3L3GA 1MJ8H 3T8XA 1XGYH 3W0WD 1ZANH 3OKMB 5EUKB 2EYRA 2VIRA 4ONFH 4K7PH 4HQQH 2P43B 5GQBA 4NUJA 1EZVX 1M7DB 1YEFL 3NZHH 4P5MB 1VADB 4OQTH 3JWDC 3MV11 3I6KA 4P2QA 2P8MA 3ARED 1GGCL 5IB1A 2B2XH 1CBVL 1DLHB 4ZS6D 3P9WB 5EOTB 2XKSA 3QDGB 4D0DB 5D7IF 2DDQL 3MRDA 1LE5B 1FIEA 4TVPL 1YJDC 1II4E 4M7JH 5ICXB 5ERWB 5KS9F 2EDHA 3BN3B 5J6HA 3SE4A 1T03L 4BQCA 2Y6SC 3T2NL 2KPNA 3C5SA 2D7QA 1HYSD 1NLBL 4Z95H 2AXGB 2JE8A 1WTLA 4YBLC 3GMPA 5CZXD 2Z93A 4AY0A 5AD0A 3D3VA 3IETB 2F15A 2DIBA 5IB1B 3JSSA 1AY1L 3QCTL 3KPSA 5DD3L 4APQC 1A3RH 1FZKA 2Q8BL 3C2SA 4FABL 3C2AL 1BQLH 1A1OB 2ZOLA 3QEGH 1T1YB 3QUXA 5C0JA 2JJWA 5MENE 3VXMB 4M7LL 4DKFL 4ODWA 5DT1H 3C09C 1NCAH 2A77H 3FQXA 2JJUA 3EYSH 4UAOC 4NC1E 2NY0C 2IH3B 5EU6E 3O3UN 3BPCB 4LF3A 5HYIA 4HH8A 3GMLB 5GS1C 1S9XB 3GK8H 3GHBH 1EO7A 3IU3A 2BFVL 5D70H 3TCLA 1Q9LB 1KIQA 2XA3A 2R69L 3CSYB 4Q6YA 1K3ZA 2VE6B 4NUGL 1JPGB 2R23A 4WI7A 4X0KA 1UZ6F 3FQRB 5L9DH 2LU7A 3LH2H 5L2KD 1CDUA 4G6AC 4ODXB 1LO3H 4XCNB 5DD1H 3NCEB 4LQFL 4MLSA 3HE6D 5EC2B 1ND0B 1TZIB 2DQGH 1WFUA 3O2DA 5JHDE 2B1HL 1T22A 5DUML 5F7WC 5CMAA 3F6IA 3O9WD 2KH2B 2CRYA 3MRJA 3SCMD 2ATKA 3EYFA 5HHXL 1IAIH 3VXOA 5CJOL 5SX5H 1QFWL 1U3HB 2EIBA 4JKPL 4KAQL 4EVNA 3IAGC 1KPRB 2A6KA 2YHGA 3U9UA 1QYGL 1BVZA 4PRHA 3S4SG 3DVGB 5DHVB 4DFHA 2QQLL 4ZUUA 4U4BA 4OV5A 5D5MB 3T8XB 3EDEA 1IQDB 5HHVL 3G9AB 4MB4A 3WXWH 4KJQC 4K71C 3V4VL 3EO1B 2YR3A 2XZAH 4ZPVB 2Y36H 5I8EB 2AEPL 4LOUD 4HJGB 5A1AA 1M7DA 2EDJA 3JWDL 2AJYH 3PG2A 3MRRA 4MJID 4Y0GA 3NTCL 4UTBH 4OZ4A 3E6FA 2OLDA 3MXVL 5F8RC 5IB2B 3H3KA 4PRDA 3S97C 5D5MA 5F7EL 2B7DT 2FECI 1A6AA 3D0LB 4M1DL 1WBYB 1A3LL 1YMMD 3QP3A 5LGHH 1T7ZA 1YPZF 4U1LA 4HJGA 4Y5VC 3BI9X 4KZEH 2BJMH 4ZSOA 3QUYD 2EDWA 1MFDH 4OCXH 5F7YC 5F88A 1P7QD 2AXGA 4LLAA 3GMPB 5GGTH 2R8SL 3M8OH 4GUPA 4ZDHA 3DVFA 3UTQA 1YNKL 1FFPB 3MGOA 3O2WH 3BE1H 3HAEB 3N9GH 4MXVF 4PJBF 3D1MC 5F7UA 1QBML 4JLRA 4UTBL 5GJTL 3MLZL 5I17B 2NX5D 3AROA 4X4ME 3WHE0 4XTRD 2X4RB 1FNFA 4UT7H 1N6QH 1S7WA 1EJ6A 4PJAA 1MJUH 2V7HB 3I50L 4LRNH 4K7FB 2VRAA 3VFTA 1ZA3A 4AH2A 3BPCA 4LF3B 4Z0XB 2FATH 4YR6B 1MCSA 1V5JA 2X09A 3BP7A 2YKLL 2F5BH 1EJOL 2V2TB 4WTZG 3P4LA 4RIRA 4IRZH 4LBEB 5HD8C 2Z91B 3GSUA 1B90A 1MVFA 3TBWB 2UY6A 4LHUD 1U92B 2IBGA 3K0WA 3MLXL 3ZKQD 4YUEL 1MHCB 3EOBB 3DARA 3T09A 1MAMH 5C0BB 1TJGH 1G9EA 1T4KB 1B2WH 3ARVA 3PUCA 2QQNL 1U8MA 3CSPA 4LQFH 4N9GB 4FNLL 3REVA 5L88H 4LSTL 2EKSB 32C2A 4G8FA 2X4TA 2QADB 3SHSA 4HS3A 2YWYA 4WV1A 5JHDA 1SMAA 1QR1B 3WUWA 2FECL 5EUOB 1R6VA 4I0PD 4N68A 3S3SA 4ALAH 4EVNB 2JK5B 3R4DA 2R39A 4PY7B 1BECA 2DWDA 1SYSA 2FEDC 4WI9A 4WHCA 3PHQA 1MQ8A 4JFXA 4D94A 3RUGE 2AEPH 1MY7A 4MNHB 4BKLB 2CKBL 1VERA 2J8UF 3MRLB 3VRLF 5B38B 1BOGA 1JNHB 2BRRL 2GFBA 4G6AD 4MS8D 4UIKH 3F7PC 3FMGL 5HI4C 2X9YA 3QEUA 5AWNH 4YHKL 1EEYB 4PJHF 5T3ZD 4HCRL 2XZCL 1C5CH 1ZT1A 4LCWD 1A9EB 3V8OA 4M5ZL 2CIIA 3RUGB 3ZE1E 1P7KB 3FZUC 3IJYA 3MNWB 3ULSB 3ZTJH 2M1KA 5C6TL 1OTSD 3IU4H 3LEXA 5F89B 5C0NC 2C1PA 2DI7A 4L29B 3VGDA 3TV3H 1HWHB 3ZHKA 1BOGB 3CVIH 1WC7B 4JFEE 3AB0C 3CLEL 5IG7A 4XAKE 3UTTE 2PTTA 4XPGH 4LHUB 1IAII 1VGKB 1HIML 1BGXH 5D2LA 3VFVA 4U6XB 5DUPH 5ICZB 4HS8L 2F53B 4HWBH 3CVHB 4YHOL 3LKPB 5FYJL 3NFPB 4Y7MA 3SJVD 1VADA 1ZT7A 3CGTA 2HFFB 1OM3L 1CFQA 4FMFA 1MFCH 1FO0H 2WNGA 3UP1A 1UKTA 4M00A 3SOBH 1N5AB 1CXLA 1INQA 2DQIH 1FAKT 1FE8H 4UI2A 2BNRE 4KQ3L 2D0GA 3B5HA 3SGKC 4M03A 4U6VL 5D2LB 4F3FA 4JG1L 3WDHA 1ZKAA 4Z7VE 1UG9A 1JUFA 2H2PD 4OGXH 4K23H 2AQ1A 4G5ZL 4NZRL 2ZNWA 3I02A 1A47A 5TDOB 4C4KO 4XPHH 5JIPA 4LNVA 3OKDA 4DEPB 4NO0A 4BZ1H 3G6DH 3HPLB 3CXHK 2V7NA 1QA9A 4KQ3H 4PIRF 4X7CC 2H41A 5DF0A 5IKCA 3LCYA 4H1LH 2Q6WB 4LBEA 2BMKA 2ZCLL 1BD2D 25C8L 5IMKB 4ENEC 1B0GB 4IOIB 3N06B 5K9QI 1PEWA 3PQYD 3ME0A 5IQ9A 4A6YL 5EOQH 4WWKD 3NCJH 3OKDB 4LRIC 4KY1L 3MACH 4LDOB 4ZTOH 4M8QB 1ZVSA 1ZE3C 3PWPB 2BSSB 2IAMC 3MLTA 3MZTA 5CJXC 4YHIA 4WFEE 3AVEA 3ARFC 3ULVL 2AXHA 4D9QE 5HYJD 2GUOA 3PE9A 1S5HB 4BSWB 2FWOB 1S3KL 2MHAB 3ZE0E 4DUXA 2C9AA 2DRUA 1CBVH 2QHRH 5HVHC 1UGNA 2R1YB 2XFXA 4XC1L 4DGVL 4Q9CA 1DBKL 1UXSA 1HHKA 5C6TH 4BM7A 4PV9A 4M5ZH 2VERN 2Z8WC 3DRQA 3RTQC 4PJBA 4KUZL 3GI9H 4PTUA 1TZHA 3C8KB 2PO6A 4AENB 1YEDA 3FMGH 5E5MB 1K4CB 1BQSA 3UXFA 1I8MA 1JNHA 1VGEH 4FXKA 5EUOF 4TSCL 1G7LA 3MTRA 2X89D 4I5BB 1U6AH 5F6IB 1RULL 1BFVL 3QQ4B 4JFHE 2FO4A 5F1SA 3VXSD 2GITA 1P84J 1MEXL 5FO9A 3J8F7 4JO4L 3RA7L 5BZDA 3MRHA 3SGEI 5HYEA 4RGMB 4G6MH 5JR1L 2WBJC 2YPKA 4OD1L 5I1EL 3FB6A 3UZEA 5FCSH 4K23L 3AGVA 2UY7A 3N85L 3C5ZD 2K7QA 5T5NG 2AVGA 1F4YH 2AJSL 5IW6A 4GRLD 2XKNB 4GT7A 1CD8A 4HIXL 3IDNB 4PGCA 3RDTC 3PHOB 3C5JA 1F6AB 3ZT6A 3ULUC 1EHXA 1B4RA 4J4PD 3SBWC 3CLFL 3U46A 4OAWA 4POZD 4OJFH 2DI8A 5T3XL 4ZUVA 1XIWA 4IRZL 1OSZB 1WJ3A 4HD9A 5DGQA 1YEJH 4ONOA 3G04B 3VI4E 4BUGA 3BAEH 3HMXH 4Y4FD 3ECBA 1GZQB 4ZSOB 3F5WA 3WEXB 3JV4B 4LMQE 1XGQA 4YGAB 1GAFL 3B6SA 4KGLA 2BVPB 5E8OA 3UTQB 3NIFF 1VA9A 2I9TB 1GOGA 3AUVA 4CNIB 3WV0A 4Q74A 3ZE1F 3I6GB 4IOIA 1G7PB 4HF5H 5HHNA 2I26N 1KV3A 1C16B 4DZBB 3B9KC 3Q5OA 4ZAKD 4OZHF 2X1XR 3BRDA 5LGJA 4CVXB 1NANI 2ADIA 5GHWL 1CLZH 4N1EA 1UJ3A 1QPXA 4PP2B 1PG7H 1YPZE 2V5YA 1ZWIB 5TQ2H 3MX0A 3VFTB 1E4WL 4AH2B 4DCQB 4Z7NE 5B4MC 1MFDL 4OCXL 1G7PA 4RFEA 5HHNB 1KB5A 1LEIA 1Q8MA 1AIFB 1JNNH 2OS7A 3UPRB 5ESAA 5DURB 2JJSA 2YD4A 5FOJA 5KZCB 1QFWI 1HEZB 2HJKB 5IR1A 2EXYD 1AGCB 4NWUH 1KCVL 4PJGA 2P5WE 3L3OB 4YZFE 4P46C 5I6XB 1XZ0A 1YEKL 1A6ZB 3NPZB 4I0KA 4PRHE 5ENWB 3Q6FB 4L8BB 4YEFA 1N6UA 3O11B 4ZS6C 5IB4B 3VXOB 2R0KH 1HIMH 4GRLC 4FQPA 3TA3B 4H88H 5B3JF 1RFDL 3Q5TA 2J12B 1JN6A 1WWWX 3MV8B 5E8EA 4P2QD 3S34L 5L6YH 4M6AA 1PKOA 3W9EB 4JG0L 1D3CA 1NJ9B 3FOLA 5FO9B 1MHPH 4XVTL 3O11A 4PUBL 4XWGL 2UYLB 2PYEE 3HB3C 3H9SD 5KANG 2ZCKH 4MX7B 1IGIH 2Y72A 3OJDB 3U7YL 1J8HA 1S7UA 2FATL 1H8NA 3VFSA 4JFXB 4IMKA 1CXKA 1I1FB 5F9WC 4XPFH 5AAWA 5HYSG 5HYQA 3IDUA 2HWZL 5F1IB 3BX7C 2O61B 4E41D 2A6JA 5F8QC 2HKHH 3AM8A 4DUVA 5CKGA 5EG6C 1OF2B 1IFHL 3F7YA 3FQWB 4X6EB 1DBAH 3MLUL 1NAMA 3MLXH 4FFZL 1J0IA 3MYJB 5D1QC 3V4UL 4F9LC 1JGEB 4NBYB 5ID1A 5DHYA 4L9LA 4K8RH 1P4IH 4KTYA 3U2SB 5FCUL 1DBMH 2VSCA 1R5IB 3NCYP 3QDMA 2R8SH 2X70B 4PLKD 4FNLH 2ZUWA 3MA9H 5C3TA 2AKRB 3TVMB 4LSQH 2CJUL 4KJYB 3VWKB 1A8JH 4NZDA 4DAGH 4X7FC 1M4KA 3T2OA 2WLZA 3VFPB 1NCAL 5ITFB 4QTIL 5J56B 1Z0MA 2J8OA 3ALWA 2OP4H 5IBUB 4XPAL 2UWEE 4WWKC 1BQLL 1M6OB 3DROB 1ZT7B 4MNGA 3MOAH 4UAOB 3EYOA 3HUJF 5EA0H 1INQB 1TTUA 3V7AG 4CJ1A 2OTUA 2OTWA 3KAAA 1AI1H 3SGDI 3LKRB 5DD6B 2EE6A 5HHVH 3PXJA 3VXUB 3W39B 5BRZD 5B3NA 2VXSL 2XACC 3UYRL 5FF6B 2VH5H 1V3MA 1MVUA 2E6QA 2VC2H 3ARGC 3BISA 3ROLA 3DYMA 1HI6B 4WEMB 2HMIC 1OP3H 1TVDA 2JIXD 4I18A 3DJ9A 1X4XA 4L8DA 1Z2KA 3KYNA 2D9QB 2JELH 3D5OF 5I30H 3MV7D 1MF2L 3T3PF 2X4NB 2Q3AA 1Q9OA 3PIQA 5ISZB 1IEHA 3O6FD 1QR1A 4M4PA 1IVLA 1OARL 5L2JA 5FDWA 1CZ8L 5E6ZA 4MA3B 3VFGL 1R3HA 2D2OA 2DQGL 1ZVSB 4JDZB 5AYUL 5TDPA 5C0AE 4XPFL 4P46A 2XZQH 2YOCA 2W65A 3D0VA 5ALCL 5ACLA 3WLWD 1KJ3H 4EI5A 4JQIL 4XPTL 4NQVA 1IAMA 1X5LA 4XP5H 4ZO8A 5CJOH 3H9YA 5DJAA 5E2TH 4MDJA 1AQDB 4EN3A 3FQTA 3K8KA 1B2WL 4ZFFA 4LIQE 4XVSH 3P77B 3UTSD 4YXKL 3CX5K 3MQIA 2CLVA 4LLYA 2CIIB 2MKLC 3QRGL 4G8EB 5HI4D 3LRGA 2E7CA 3J7HA 4P3WA 1GXEA 3HA0A 1CGUA 4G9DB 1S7QA 5DYOB 5J57B 4D9RE 3T4AB 2Z92A 2X6MA 4L29A 4U6HB 5H35A 2W91A 1Z3GL 1J1XH 1PJ9A 5JOFB 4KMTH 2FEEI 3QNYB 5GRJL 2VSDA 3K80A 4RA3A 1A1NB 4DGYH 4Y1AA 1UACH 4G6FB 2B1AL 5JO5B 3O6FB 3QWRD 5C9JA 4J1UA 1D5ZB 1QRND 3T0EE 5T1MB 2NXYB 3MV9E 2J7LA 4NPYB 1VACB 3MLWH 3O0RH 3QIWD 4HKZA 4YXHH 1LO0L 4QNPE 1NGYA 3I75A 2IBZY 3JTSB 2BVOB 3INUL 4H25A 2XTJD 1RUQH 4PG2C 2X4QB 4OZGA 3BXNA 3OKLA 3JWOC 3G5YB 2DQJH 2FCBA 5E9DD 2P7TA 5CGYC 5IROA 5EWIL 2XTLA 4NUGH 4MZ2A 1HH6A 1IC4L 5GGTL 3U9PL 4BQ8A 3P4NA 2CRZA 3O8XA 1RK0A 1U8NB 4L4JA 2VH5L 1MIEL 5IM7A 3BYTA 4U2ZA 5FYJE 3VGAC 3GSWA 2IJ0C 1M7IB 2VQUA 4U0RB 3G5YA 4WFHE 5KJRH 3MCKA 3QO0A 2WWMD 1BFSA 4WFGD 4PUBH 4XWGH 4QF1B 3QXDB 3BKML 3WNNA 4O2FA 2CQVA 3OR7B 1GGBL 2VDML 3HZKA 4GBXD 3CUPA 3PV6A 5INDA 3IT8D 1WZ1H 2DQDH 1IZKA 4HUXB 1SM3H 4D9QD 2VLKD 4KFZC 3H9SB 4DKEL 1GVIA 4OLXH 2MCG1 4L4TA 4F7PA 5KW9H 4LEOA 1TPXB 3MRQB 2AJSH 1XIWD 4QF1A 1YUHA 4OCSL 2WP3O 4P46B 5I6XC 2XI9A 2FJHA 4NQSA 3GBML 1YN6A 1TZHB 1OP5K 2ADJB 2EECA 1XF1A 3SDAD 3D2UA 4Y5VA 4XPBH 12E8L 4HLZG 4ONHA 3TBVA 4EI5B 2VZ3A 3L3IB 4NQVB 1DVFB 1N59A 1I4FA 4NCC1 4X4YB 5C08D 4YHML 3CMOL 3HLAA 3O3EA 5JW4N 3K74B 4F37F 4Y4FB 1W2KT 3RFZC 5JIHA 3MRQA 5T33L 5HHOD 4F58H 2FJHB 1XF4B 3CFIC 3KXFB 2XPGB 4ONFL 5TJWK 1IEAA 1RQ5A 3EHBD 5HGBA 3CJJA 2BSED 1S5IH 4E5XB 1C5BL 2DYPA 1EA9C 1G9ML 5J13B 1ZHKA 2CK2A 3SDDD 5C70A 3V6OC 3VW3L 3T04D 2RGSA 3W9EA 4U1KB 3RU8H 4JRXA 2FJGA 4I3GA 3SJVE 2VXQL 5B39B 3U4AA 2NZ9C 5GSVB 2A1WL 1GC1H 1JHTB 1UM6L 4OLVL 5BRZB 4X6CE 2YZ8A 3LMJL 4FRWA 4R2GD 5BZWB 3A0OA 2D03L 4OF7A 4AEIH 2Z31C 5DT1L 4WIQA 1K6QH 4NO0D 1WCBB 1I1FA 1OSZA 4E0RB 1T1WA 3RZCD 3GJFA 3SQOH 1S5IL 5I71B 1RVFH 5AAMA 3IFLL 1WVZA 3MA7B 3MLRL 4NWUL 4DVRH 3UBXB 3VXQB 2L7JA 7CGTA 2HT3D 1NGQL 1QSZA 4NKDB 3DBXA 4HIXH 3V6BR 4OFPA 3U7WH 5T3ZE 5MENA 2XTJC 3QDGA 1BMGA 4PJ8B 1WIUA 5FIEA 4XC3H 3REWB 5FK9A 3VXUE 2COQA 2R1WB 3ET9F 1RHFA 5H94B 5F7KC 1Z9MA 3UCRA 3KLSA 1OGTB 5DUPL 3FT4B 4MA8H 5E2JA 5CSZA 3HZMA 4M7LT 2FX8H 5KSVA 2JB6A 1UZ8A 3GSOB 4TTDD 3UBXA 3T77A 1YEJL 4L3EA 2AKRA 5J9PB 1WWAX 1H3UA 1L6XA 1AKJB 3GMNB 5HHME 3TV3L 2NY3B 4NKMA 1PLGH 3SKJH 1HQ4B 3STBA 5C71A 4ZAKC 4JVWA 3GEWB 3IJHB 4M6NH 3RGHA 2ZSWB 3TBSB 1UZ8B 2DLIA 1S7XB 4RGOH 1INEH 2PXYC 1AIFA 3QQNA 3F8UB 1FRGL 1P2CA 4NO3A 5L8JB 1AKJA 1P6AB 3G6DL 1I8KB 3HAEG 2V2WB 1JI1A 4NOFA 3DSNA 3GO1H 4CDGC 4TSAH 2VITB 3EOYG 2BNUB 1HQ4A 3DXAB 3L3OA 4PJCA 3O3BB 3SE4C 4ZD3L 1MCKA 3TBVB 1J05A 2FR4B 2XA8H 1HCVA 5D7KD 5D2NB 2QHRL 4NKOA 5C09A 4QTHB 2R0LH 3KNBA 4JZJA 2HJFB 4ALAL 3QO1B 2DQCH 1YYLL 4ODSL 4HUWA 4P4RB 3D39D 3AU1A 1KUMA 1BQUA 2ZCHH 4HKJA 3AREC 1RI8A 4UU9B 5I1DA 1AE6H 4XX1G 3VCLA 3ARBA 1LD9A 4YXLL 4O5LL 4ELMF 4NRYA 2MNUA 1CICC 3UO1L 3NA4A 1MFAL 2BHUA 5ICYA 1FC2D 1ACZA 2OI9B 3KPPB 1LDPL 3OPZL 5L2JB 2HTLD 5IVXE 1HHJA 3I2CH 1XF5B 4ZQKA 3WJLA 4XI5C 3VRJB 2XOTA 4HIJA 2VLJB 5HBBA 3BH8B 5DD5H 4RZCB 4UUJB 5TF1L 3C5ZB 2W0LA 5CEZH 2YD1A 1A4JB 1QSFD 4JFDB 1CR9H 3HR5B 1RHHB 1U8IA 1HXYA 1GJIA 4RMTA 3IFNL 1F02I 1IQDA 1MCNA 4MAYC 2FIKB 2AJUL 1MCDA 4RGNE 3STLA 5D7IB 1DLFH 3PJSA 5I8EA 2P5ED 2EC9U 4QYOB 2CLRB 3EAKA 1ETZA 4ZO6A 4I2XB 1UEYA 4TUJA 2GCYA 1RHHA 3CFJB 4F7CB 5TQ0L 3VXMD 1ZEAH 1WUNT 2O5XH 2EDQA 1XR8A 3HC0A 5FV2A 2D7TL 4P46D 3PP4H 2EDXA 2R4SH 4BSVA 4PJ8A 4MD5A 3REWA 1GL4B 3RTQD 3NAAL 3VFPA 2A73B 4KI5E 1E4XL 5E24E 4JPWL 3TO4D 5SX4I 3ORJA 2NW3A 1F6FB 1XGRB 3I75B 5KSUA 3JTSA 5IGXH 5IT2L 4XB7A 5IW1B 3PABA 3WXVH 3HC0B 1CQKA 1FNGA 4JQXA 4L5FH 3PDGA 1B0RA 5D1QD 1MRDH 1T1XA 2AK1L 4W6WB 3RX8A 1MI5B 1IBGH 1BZ7A 1CVRA 1CT8B 4QHUB 3GM8A 1A7PH 1VEOA 4MCYA 3KYKL 1DBAL 2DYPD 3MLUH 4PJAB 2OJEB 4MDIA 4PB0L 4MJ5B 4MGXA 3H3PH 3LN4A 2Y36L 2OL3L 5KG9B 5IB5B 1IEBB 4HGWB 5DEFA 1EGJA 1KB9J 2BNUA 4M3KB 4Z0XA 5DJDB 4F80A 1BIIA 5BV7B 2HVKB 1BZ9B 2F54B 4PJEE 4GW5A 4U1GB 3QIWA 4QHUA 5IT2H 4I3SH 3X11A 5ANMA 2X9WA 5E2WH 4QTHA 5CP7B 1G0XA 4JKPH 1N2RA 1X3DA 2D31B 3LKOB 4JN2B 1A7RL 3P4OA 5CSGA 5I1DB 1V05A 3D0VB 3F7VA 1BEYH 4G3YL 4X8JA 5CJ5A 4KUCD 2FB4H 1F2XK 4G8GA 1FH5L 1P9MC 4JFYA 1FH5H 2ESVD 3QCVH 2EIDA 1BJMA 3AC0A 1RMFL 1UT9A 3G6JB 3C5ZC 3GKZA 1A6WH 3PWVB 2YA0A 4XNUL 4LL9A 3IAQA 5D2NC 3ARFB 4JM4H 2Z35A 5MEND 3QPQD 5IBUG 4EOWL 5C0RH 3DMMD 4MWFB 2NLJA 2GI7A 1QLEL 2YMXH 2D7PA 1ZA6B 1S7QB 4URTB 2Y23A 3K3QA 4AK1A 1IKFL 1HINH 1BJ1H 3BD4A 4X6BA 1B0WA 3VGHA 1ES0A 3QNYA 1RZGA 2Q7NA 3GHEH 5MI0C 1FFQA 3FL7A 1URLA 5IESH 5F9OH 5D2LF 1PY9A 2CLRA 4EIGB 1LP9F 5E8DH 2NY3C 4XVSL 2VLKA 3CFEA 3CZFA 2XV6B 3RHWK 3VI4F 1AHWB 4X9BA 4PB9H 5C0AA 3EDJA 1RSFA 1MCPH 3QEQD 2VB5A 3FTGB 3U7YH 2DKSA 1QRNE 4XP5L 4R26H 1EGJH 1HILA 4TUKH 4N5EC 4P9HC 4W6XB 1IC5L 5BO1H 5TE4H 3ZYZA 3ZYOA 5KVFL 5ALCH 4I3SL 1YQVL 3OKLB 4XAWH 2IFGA 3WXVL 4YPGA 5FFLA 5IFJB 3W0WE 2H2PC 2CMRH 1G1YA 2FEEL 5FKPB 3GIVB 3P73B 1VGKA 2RJMA 3JV5A 1FG2B 5I1GL 2EDBA 3LS5L 3UTSE 3GI8H 1DJSA 4R0LC 2FH8A 5FA4B 3UC0L 5BCAA 4G9FA 1WICA 4PGDB 3O2WL 3S4SB 4NKDA 5LCVL 2UZIH 3DBXB 3MV8D 1NBZB 2BY0A 2BNQD 2DLEA 4M8VA 1TQCB 1FG2A 3MOBL 4U3CA 4JRXD 3LRSA 4U7MA 3H7BA 4KRPC 3SQBA 1I1AD 4B5EA 5JPMB 2Z31D 4JO1L 3RVXC 4JM2D 4HZLA 4L8SA 5K9JH 5CSZB 3ARGA 4MJIB 3MJ7B 3SE8H 4Z7UA 3SKUD 2VAAB 4IRSD 3UTTA 4JY4A 4FQCL 2Q6WA 4CU7A 4LGRB 2QSCH 4DKFH 2VJXA 4EN3D 4OCNC 1XFPA 4WCYH 1LO5A 4JFPB 1RIUH 3DUUA 3BE1L 1I9IH 1UCBH 2B4CH 4MS8C 3IU3B 5C07B 2G9HA 4XT1C 3VWJA 3RWGA 4H26B 3MRFA 4PTTB 3TEUA 1ERNA 2VAJA 5CBEB 1PYWA 2HT4D 4J3UA 1AGBB 5DJYB 1IE5A 5JUEL 1ORQB 5M7QA 2ADGA 4KRNA 4CU6A 2C4FT 3GMMA 5EN2A 1H3PL 2XRAL 4P3CL 4G8GE 5I1EH 1JF1B 3QWRA 5SX4H 1WEJL 5JHLH 1QRNA 4YJZL 3VWJB 2ICWJ 4PJXB 2ZKHH 5GGVL 5D70L 3R1GH 5C0ND 4JFFB 2O5XL 3VH8B 4OGYL 3DRTA 4PTUB 5GRZA 5CIPH 3VFUB 1OB1B 1HHHA 5DJ8B 4DN3H 3CH1A 1RZGB 1OAZH 1TLKA 5TE7H 2NY2D 3IFOA 2G5BB 4J3WA 3WXWL 1KBGH 3IFPA 1NGPL 3MFFA 1JGVH 3NH7H 3SKOB 5I1LB 1EAPB 4C83A 4Q9QL 5DJ6B 3G5ZA 4GXVL 3NMEA 4ETYA 1DQJB 4HDIA 2IQAB 5C0EB 5DHVA 5EIQA 2WBJB 4NQDE 3VDBA 2GITB 5A2JH 2B20A 2WK2A 3WHXA 5IV2A 4HK0A 1AR1D 2D3VA 5ADOL 5E1AB 4KRPD 1FZJB 5MP6L 3B9DA 3RVTC 4DGVH 4C56E 5D7SL 1NEZG 1VPOH 5KSBA 5DUMH 5MERA 3HG1D 4HG4J 2DS4A 3U36A 2PETA 4XCYA 1LEKA 1BFVH 3L3GB 4FZEL 1DBBL 2OL3H 3LDBB 5GIRB 3VFWB 4WHDA 4CRPA 1VFMA 4JRYA 1B4JL 3W2DL 3C5JB 3OX8B 4YX2L 2IBBA 4ZUWA 4OCRH 4ZTOL 1O5DT 5CZKA 3IKKA 4WNQB 1FNSL 2VL5B 4MQXD 5C0BD 3H3BC 4XNYL 3UBXI 3KPQA 2PYED 1ZMYA 4RWHA 2FYYB 4WO4C 1UKQA 5DO2C 3UDWC 2APBA 3GSQB 4OZFB 2Q76B 3IF1A 2D7OA 4FZ8H 5F7DB 2Y25A 4XC1H 1NEZB 3W2DH 1KYOJ 4ZUWB 1DQDL 3DMMA 1S9VB 4OZFH 5DJCA 3SDAA 1QSFA 5K9OB 5KSAB 4M43L 3GJEB 4K07A 2A77L 4M5YL 4XHQA 3ARXA 1HSAB 5CIPA 3TJHD 3HRZB 1MFBH 1UJ3C 2VDLL 3KYOA 5I1JH 4NZTL 1I1AC 3TJEH 1ZA3B 1CLOL 3ZYIA 5HHOA 4PPTA 3MCLH 4XNYH 1A1OA 2AEQH 3BP7B 4BZYA 4YHZH 2AP2A 5FOBA 2PYFA 3VXMA 4QXWA 4YBQC 1CFSB 1ONQA 1G6RB 2ZCLH 3IDYB 4JANA 5GGTA 4RIRB 4DJMA 4YAQA 1S8DB 2R0WH 1AGBA 2DJUA 3OXRB 2Q20A 3BYYA 3I9GH 5IB5A 1MHHB 3WO4C 5D8JL 2FEDD 1JGDB 3FB7A 1NSNL 3ARBB 5E8PB 4CVZA 4NRYB 4GW5B 1VPOL 2FHFA 1MCOH 4QXUH 4WW2A 1Q9LA 2XY1A 4UINL 1MEXH 1T0MA 3OJVC 1BBJB 2DM2A 4QRPA 4MJ6A 4YHMH 3WLWC 2WP3T 4J3SA 3DX6A 4OLZL 4XP4L 4XBGB 4BELD 3FB7B 4HIJB 3GBNL 4ODVH 1K8IA 3I2CL 4X8JB 4WW1B 5JXEC 3VA2C 3MCG1 3NCFB 5CD5D 3MSPA 1QNZH 4OF8A 1V7ML 2BRRH 4FZEH 2PXYA 5C0CB 6FABL 1WZ1L 2HRPH 3FQUA 2NY2C 4NQED 1A6TB 4GH7B 1A9BA 3EYFB 4TYUA 1DFBL 5D7IA 1I1AA 2MJWA 4OCWL 4R6UA 2H3NA 1NEUA 4RISL 1FZJA 3NIDE 3U9UB 4OFKA 2AGJL 5CKAA 1QFUH 2PXYB 4OTXH 3VDAA 1BP3B 1NDGA 4P2OB 1XR8B 3DMMC 1TZGL 1YY9C 1NUDA 1F2QA 1IC7H 2Q86B 4RNRA 1T20B 4ZPVA 1OGAD 2O5ZL 4P2YA 3L95B 1GHFL 3MRKA 4G7VL 4KROD 4LVNC 2ESVA 1CTOA 5SWQB 5I1IL 1IAKA 1DQMH 3KPQB 4R4NC 3MLZH 3QH3B 4DOHB 3CPLA 3U0WH 2PNDA 4OUUB 4MZ3A 1T6WA 2EXYC 4F8TA 4HWEH 1YNLH 1MRFH 5FV1L 4TOYH 1CGWA 4QY8B 2D7NA 4CDHA 4RMSA 1AH1A 4FXLA 1CFQB 3LN5A 3KHQA 2I24N 1JNJA 3QHFH 1E6OL 1QO3A 2AS5M 1OGAE 1LHZA 5F96H 5I66A 3P73A 4DTGL 5HHMB 3GSXB 2V5MA 2DQIL 4TNVK 5D1XD 4BH7B 1BX2A 3VWJC 5D7LA 1S7TB 3GSNH 5I74B 3HE7D 3L5IA 3SDYL 4L1DA 3WJJC 2CIKB 1MCPL 2A0LC 3ZE0F 4R2GB 3P9LA 4RAHA 5C92A 2V7NB 2F58H 3K4AA 1QEWA 4K3JH 1DEDA 3H6JA 4ODWB 3ZE2E 1EHAA 3WSQH 5CGMA 5IEKB 4OGXL 4XNZB 3QBTB 4OCYH 3RAJH 5J4MA 2Y1VA 2IGFH 1XF3B 1VFAA 1JP5A 1EVTC 2CJUH 1DEEB 2FBJH 4EKXA 4Y5YB 4OLUH 2BZDA 3ZHLA 1QYGH 5ADOH 3BP4B 5HHQA 2V9TA 3L5WA 4OCMC 3U1SL 1BD2E 2KL6A 3RY4A 1AO7D 1N0LA 2DMCA 4AIXA 1WK0A 4XBGA 3PIQB 5ISZA 3DVNB 3ZSSA 4X6CA 1I9JH 4G7YL 5JW5A 1EBAA 4KRPB 4ODBD 1XR9B 2HYMA 1PYWB 2HFTA 3LDBC 3V52H 1VEMA 4XMKL 1T3FA 1JPTL 3L5WB 3WKML 2OK0L 1R24A 4AIZB 3LSOA 1BQHG 3PWPE 1N26A 5TDNA 1A7RH 5DDHB 1WBXA 2X4SA 2VLKB 3CFEB 1MQKH 2VLRA 4Z77B 2VABA 3MROB 4LK4A 4EBQL 1JZ7A 3B9KB 2AV7A 3BEWA 3FTGA 2IC2A 4GAJL 2DQEH 3FQNB 2Z4QB 3HN3A 1D5MB 2BVTA 4XI5D 1W8NA 2CXGA 4ODTH 4BKLA 4X9FA 4OFIA 2JB5H 3VWJD 1T1ZA 3MUGA 2JLLA 3EYSL 3EO1A 4M7KL 1AC6A 1J1OL 1EEZA 1W0WB 3MJ8A 1IAKB 3DSFL 1JHKH 1AGDA 2NY7H 1LO3L 4EUPH 4Z7QE 5GRVK 3CDYA 1RZIA 2Q3ZA 3ARQA 4OFYA 3DPBA 4DK3A 4PJFA 1VACA 2CLZB 1E4KA 2Y6SD 1RAMA 2FBJL 1BBDL 4EUPB 3VWKC 2G60H 4JB9L 4YPJA 3PGDA 3OKEB 3BIAX 1H8OA 4DN4L 1KNOB 1NBVH 2P8MB 3SDDB 4OZHE 1M71B 4Z7WE 5DFVC 1H9VA 3WSQL 5FCUH 1HWGB 1F3JB 2V5SA 3TP4A 2GT9B 1GPOH 4LFHD 3G04A 1W8OA 2UVFA 4BK5A 5GJTH 1G6VK 4PJ7F 5IJVA 2Z0BA 1U42A 5DFWH 2B2XL 1SEBB 4LARH 1N0XH 1DVFC 3JWDH 3U6RA 1UM5L 4PJAE 3U1SH 2A0LD 6CGTA 5HGHB 2R2BB 5E8OB 2HKHL 4YO0B 4P2OD 4PJDE 1RZ8A 3DYPA 5B39G 5IM7B 4WU7B 5BW7A 4A6YB 4XCFL 5I1KH 4NQDD 1V3LA 1Q0XL 5J7CC 5KOVC 5D1ZD 3QO0B 1XGYL 5TDOA 1QSFB 3H42L 5EU5A 5KSAA 4Y4KD 2MQ3A 3OF6A 4NRZA 4JFOA 3X14A 5KAQG 1UJ3B 3EJYD 3B3IA 1VFUA 1H3WM 3H9ZA 1FLRH 4MA7H 3V4UH 3MREA 3CDGA 3BQUD 5CBAB 4J2XA 4L8CA 2IMNA 4PRPE 5EO1A 1WT5A 4AL8H 1J1XL 4MLIA 1OAXH 3QUYB 1JZ2A 1FJ1B 1F58H 1FPTH 4NRZB 4FABH 5F9JB 4L4TB 4X6DE 4F7PB 4L5FL 2NY6D 2AV1B 3RI5F 5IR1B 3V7AE 3FRUB 4RAUA 1G0DA 3MBXL 4LSQL 3JUZA 4NQSB 4LPTA 4QRUB 3OXRA 4FG6D 4MQSB 5IIEB 5LGHL 5F3HA 1UADC 4PR5B 5LBSH 4FQJH 5ACZA 3LSOB 2ZJSL 5I8KL 1WFTA 3NA9H 1T66D 1L7IL 3CAFA 5C8JA 4JFEB 1ND0A 3QQ9C 4HWEL 1DQTA 1EAPA 4XMPH 3ULUE 2ZZUT 1I8IB 3IB4A 5DK2A 3QDMD 1FHGA 4EQ2A 4ERSH 3Q2CA 3S37L 4JM2B 2HP4A 5IMLB 4LSRL 4NP4H 4QLRA 3FFCB 4JJ5A 5E5MA 3RTQB 1U8LB 2AI0H 4IJ3B 1N64L 1CLCA 3FO0L 3H9HB 2H1PL 5FUOL 3MUGB 1ZHKB 4X80H 5IWLC 3D6GA 1C12A 4G9FD 3R8QA 4YH6A 3FONB 5CD5C 1AGFB 2DBLL 3FAWA 2PTVA 4PJ5A 1ZGLA 4FQXA 3FRPA 4UQ3A 5DZOA 2BNQA 2EDDA 4FP8H 3MNZA 4RWYH 2BNRB 4NNYA 4N8VB 2W59A 3MV8E 4JRYB 3RNQB 4OT1L 3DTXA 2DI9A 2HFGH 2QQKL 4OFVA 3RL2B 5FYKH 4N90E 1L9MA 2J88H 3EDDA 1Y18A 4WW2F 1VDGA 4X5XB 4HPOL 1YEIH 4N8CH 4LCCA 2KBGA 3BAEL 2D0FA 3T3ME 4JPIB 4NCDA 1Q94A 1JWSA 5JA9A 2J8HA 1IGTA 4KQ4H 3WO3B 4IIQA 3U2SA 2EE3A 3RWEA 4MB5A 1DBJH 1DLHA 5EOTA 4HK3J 3RL2A 4D0DA 5IFHH 1AXTL 2M8XA 3DURA 2NY6B 5GGQH 4UV4H 2CRMA 3BSZH 1CDYA 3FAXA 4G42A 4YDVA 2XICA 4C54A 1TIUA 2CDFB 1A7QH 1NCTA 4WW2C 3GSOA 4PJ7B 3V0VB 3R8BB 1TJIH 1LO4L 1H3GA 4AEIL 1U8JA 1LQSR 5I66B 4FTVD 1M05B 1NL0H 3QUXB 1T1YA 4IBLT 3FHQA 1PZUB 4PRPD 3HPLA 4YBLB 5GS2H 2DWEA 1G7JB 2NCMA 1S7XA 4UV4L 2JCCA 1VFBB 5DQDL 2GJ6B 1MFCL 4ZFZB 4MQXC 1X4ZA 1Y0LA 4NSKB 3WBDA 4S1QH 5D7JB 3F12B 4ZUTB 4RAUB 3FCTB 3D85D 2CD0A 4V2BA 5FEBA 4WUUE 1FORL 3KJ6H 5ETUB 4U1SA 4YK4C 5ACZB 4RGNB 3BZFA 3PDOA 3LPFA 4WW1A 2V5TA 4XCNA 4Z9KB 1GC1L 4BK4A 4CU8A 1WGOA 2HJKA 2WUBL 5H37G 1G7MA 2HT4C 5E95B 4LSUH 4BYHA 3CIQA 1BVLB 2F5AH 2X4TB 2Z31B 3KPRB 4P3CH 3VG0H 1C5CL 3ARTA 3WIIH 1JTOA 3QWQB 4JRYD 4LHUG 4XP9L 3SDCA 5DRNA 3H9HA 4FFWD 1EXUB 1MI5D 4JFDE 1CDGA 3VXRB 2F19H 3E6HB 5IK3B 1N64H 2QR0B 4LLVB 4NO5A 3Q3GA 4O02L 2X7LB 4K9EL 2EYSB 4HKBA 4P2OA 2F5AL 4MNQB 4HUMB 1X9QA 1ZAGA 3EYUH 2OYPA 5EO9B 1CGVA 4ZXBB 3QQ4A 4NQDB 2UYLA 3HS0A 3CFDB 4C56B 2IANB 4WI2A 2KZ1B 4OI9A 3MROA 4I9WE 2FO1A 1EEYA 1H3PH 1B6UA 2XRAH 4JREB 3ZT7A 4NZRH 1XEDA 4OQTA 2PW1B 4LQ1A 4KVNL 3SDAC 4L1HA 2MPAH 3V6FB 2KZWA 5BS0A 1E28A 4FQHA 1IGFH 4LVEA 1X5HA 4NHUB 3G5XA 1XIWC 4KRMB 1IT9H 1T83A 2F54E 1OAKL 1XCTA 1ZVYA 3KLDA 2MCPL 4PJAF 5FYJU 1JGEA 4WCYL 4GLRI 3K4DA 5IQ7H 2W07A 4UT6H 2A83A 3V2AR 2CDEB 4QRTA 3ARDA 1RZIB 4MMXC 3CC5B 2NW3B 4ODHL 3G08A 2C26A 4NJAH 3L5XH 4EDXB 1HKFA 1K4DA 1RIVH 1S9YB 4UTAH 4JO1H 1A4KB 1U8NA 4IOFD 5CUSH 4YDLB 4FS0A 3NCJL 1OWRM 1T1XB 1BLNB 3FN0L 1AO7E 1ZVHA 4HMDA 1ZT4B 3LVEA 3B6SB 4ZNEE 4Z7OE 5F9AC 3DX9A 5BOPA 4K71B 4LASH 1JCKA 4DKDC 3M07A 4J3VA 4C55A 2VL4A 4KDVA 4E42B 3MLRH 3IFLH 3BW9A 4QGTA 4MDIB 4YHYB 1H0DA 3VGBA 4PGEA 4PD4J 4O2FB 5DQJB 4X99A 4XPHL 2DQTH 5FYLH 35C8L 3V8CA 1YMHA 3BUYA 3QPXH 1QSVA 1IGCL 1MOEA 2ZOKB 3P3YA 3C08H 3IDMA 4GAJH 2R2CA 4E42A 1JF5A 4GRWF 3T3MF 1T0PB 5ECJE 4WTXA 1HHIA 1U8KA 2EICA 4RRPA 5DEGB 3OXSA 4PJBE 4YHIB 4JO3L 3CSGA 1EGJL 2QADC 3CDGB 1E6JL 4Q97A 4Z78B 4N8PA 2P46B 4KHTH 5LGKA 2GUOB 1N0XL 4ZXBD 1FGVL 3AAZB 2DL2A 3JTTB 5FHAL 1HKLH 3TPUA 5HPMA 5E03A 3DGCR 2X1QA 3C6LC 2HN7B 3EDFA 5LQBH 4JDZA 2JF1A 2NY3D 5LQBL 2QR0A 5C0IB 5KVMC 5EC2A 4YWGL 1KJMB 1PBYA 4JE4B 4MJ4A 2X4PB 3BO8A 2Y9RT 1R0AL 5B4MD 2VDRL 1YEEL 4LNRA 3QI9C 3VXTB 1I3RA 3HUJA 4LP4A 1A3QA 3OF6D 5JLZA 5EBMB 3FT3A 5J06A 4HBCH 2H26A 5C0IA 1U3HA 5IVXA 3DXAD 3LHPL 2XWJA 2CLVB 4JM4L 1G7QB 4MD0A 1NC4D 2J5LB 1ZGLM 5H2BB 5BJTB 1FIGL 2C3VB 4YFEA 4JN1L 1K5NB 1CG9A 5C0FA 3CU1A 4HUUB 2EIZB 3SKNA 4X7DC 5H37H 3MRHB 4L4VE 4QHLA 4G6JL 4EUPA 1NBYB 4JDTH 1Q1JH 4PGBA 3HMXA 4X7TB 1OAXL 1JE6A 3K8MA 4ISVB 1YZZA 3OAYH 3GGWA 5IG7B 1YNTA 2VR4A 2VQ1B 1EVUA 4XPAH 5CINH 4OLWL 4Z8FL 2PR4H 2W9LA 1KJVA 4J8RB 1CL7L 2F54D 1F13A 4R8WH 3VJ6A 4HUUA 4YPGB 4ETQA 5IFJA 2RCSH 3D9AH 3BN9D 4DAGL 2HMID 5FGCE 1X5YA 4KPHL 2RB8A 2KKQA 3CVHA 4ZUVB 3TN0A 1SJHB 1JPTH 1T04B 3JBG7 2UUDK 1ZSDB 3TO2B 5J0BA 3ARDC 4FQLH 4LPWA 4OKVB 5FA4A 1J87A 3X12B 4YHYC 4ETQB 3DX9B 3QAZC 1EPFA 3D3VE 2VUOA 3N1QC 1KB5H 4KKAC 4HHAB 4NFBA 3QNZA 3BW9B 4U1HB 4UB0L 5GGSA 4APQD 4YDLC 1BJ8A 3LS5H 2BHYA 4NO0B 4OBSA 1B3JA 3AFLA 4HZAA 3BP6B 2OTUB 1U95A 1DUZA 5IGXL 2BMKB 3MJ7A 5K59F 1OPGL 3V0VA 3U79A 3VXUA 3W39A 1WQVT 3BZEB 3CVHL 3ZKXC 1J5OH 2DJSA 4R7NB 3T0WA 4HHAA 2F53E 3W82A 4YDIH 3BIBX 2OZ4A 2HLAA 3KYAA 1FNAA 2DIJA 4TOYL 1JNLH 5TE4L 5ACMA 3MPCA 3RVUC 3LN9A 1ORSB 4P99A 4XBEH 5GSRA 3OKYA 4FQQB 2AQ3A 1EMTL 4NKIH 3RWGB 1WFOA 4HUXA 5D2NA 5LWYH 4NKOB 2GJ6A 2B1HH 4U3XA 4JDTL 1S5HA 4AM0A 5I2IA 1V3JA 5D7JA 1SVCP 3F12A 4P4RA 4TVPE 3I84A 3B8YA 4JN1H 3D2UB 1X5AA 4YGVA 4ORGA 5TDPB 1D9KB 4KVNH 4ZOEA 3ZKMC 4YXLH 1KEMH 4Y4HB 4UIMB 3O3AA 1CN4A 4KAQH 4MA1C 3RTQA 4X6DF 3U0TB 4X4YA 2VLKE 2IEPA 4U05A 1QVOB 4IRJD 4HS3B 1PSKL 5EBMA 3B8SA 4RISH 3T2QA 1DFBH 1JNNL 3D85B 3EOTL 4MA1B 3N1MC 5IVXB 1A2YB 1UYWL 2GJJA 3K8LA 3HFML 2MCPH 4UQ3B 5BMFH 1ZLWK 4YDKL 1HZHL 4EIZC 4Y4HA 1A6WL 2VDPH 1RMFH 3WFCH 3BH9A 2DTML 3DTXB 3OQ3B 4MNHA 1KPVB 1U8PB 1EXUA 2P8LA 1CF8H 4CADB 1CFVH 1RJZA 3IDJB 43CAA 3D18B 3O6ML 3BUTA 3D85A 2LAGB 1NGXB 2GFBB 2YPLB 4F7MA 3DUHA 1JYXA 1GRWA 1YNTB 1IJ9A 3G6JF 2VQ1A 4PJDA 3WFBL 5F70A 5IEHA 3DYOA 2IH1A 4JQVA 1CLOH 5TF0A 3QDAA 5EZLA 1FG9C 4JG0H 2CR6A 3IJSB 1RIHH 2PW2B 5L8LB 3D18A 3CZJA 1F6AA 4PJGE 4K9EH 1WIPA 5KOMC 4P57B 1WCBA 2XTJE 1X5FA 5HJ3A 3G6AB 1AD0B 2FSEA 1BM3L 5MEPA 3SGJA 2C5DC 1CS6A 5ILTL 4LCUB 1CICA 5EZIL 3WE6A 2NTSP 3CLFH 2Q76A 3MV9D 2WANA 1JPFB 1QQDB 1I3GH 3AM8C 3UTSB 1I3GL 1I7UA 3T0VA 1G6RL 4XVJH 3EW3B 3QT2A 3ARDB 1RK0B 2O5YL 5E08L 4P5KB 1D6VH 2DWEB 5GISL 3GJEA 2X1PA 5HY9B 2C3HA 1OTUD 1Z5LA 3QI9D 3T77B 1LP9E 1R3KA 4MCYB 1CK0H 2BCKB 3JWOL 4D9RD 1NH6A 1JPFA 1MPAH 3KYOB 4WWID 1YEIL 4MXQD 5KG9A 1IEBA 3O2VH 2E9JA 5EIIA 2F74B 1R5WA 1QD0A 1T0NA 3FN3A 4G6FD 5LGJB 1JGUL 2BXZA 3TWCH 4RMRA 2IALA 1L0XA 5F21B 3TM6A 1CFNB 2OCFD 2R0ZL 1KTLB 4POZC 4S0SD 3X13B 1ZLUH 4KXZH 1MFBL 3PHSA 1R5WB 3QQ3A 1ED3B 1LK2B 1YUHB 3R06A 3BUYB 3CFKB 4G80A 4S1SL 3FQRA 3U7AA 4L3CA 1E4KC 1KTRL 5FA3A 1N5YH 4MXQC 3WIHH 3HFMH 4MA3A 2E3VA 2D7MA 4AQOA 3QJHA 3OXSB 4HUWB 2NX5B 2NW2B 2E8YA 4BZ2L 4HJ0D 2NZ9D 1J1PL 3QULA 4HKBB 4QCIA 4GG8A 4L4VB 4KK5C 1P4LA 5DRXA 4PRBB 1BZQK 3O6KL 1JGLH 5T5NF 3CFDA 4C56A 3N85H 4LSSL 5FDYA 5DMJB 5EU6A 3HE7B 1EFXA 2ZUQB 1MCEA 4FXKB 5I16B 5F7FA 2VLJA 3GSRA 5ITBH 2NNAA 4XP4H 4APQA 2H3NB 3MNVB 4LSUL 5DYOA 4XNQA 3QZWG 4HFUH 3O4OB 4JFDA 3SPVA 1UB6A 3GK8L 3DX7A 4X8XA 3WCYA 1KCKA 3WL9B 3TESA 5FKAB 2IADB 5D8JH 3FB8B 3HI5H 5C2BH 3NA9L 4LKXA 2RFXA 4PD4K 2ZUUA 2V9QA 5DMGD 3WUWG 3ARFD 5IVZA 3KWWA 4MQ7B 1D5ZA 3UTPD 1J18A 4H1LB 2KQNA 3CXDH 2C3VA 5KW9L 5C09E 2NQCA 4DKEH 43C9A 4L9LB 2VQTA 5SWQA 1KBGL 2IG2L 4BJLA 1UB5A 5D5MF 4NP4L 1MWAL 4YHZL 3CPLB 1NCCH 2YBRA 4D0BB 1LP9B 5EC1A 4HS8H 3P30H 3SKJL 5JW4M 4LARL 1FBIL 1PDKA 3L6FB 3CMOH 3CXDL 1ZHLB 3FFCD 2NXZB 1DE4B 3TPKA 5HY9A 3DUSB 5IHBA 2GSIA 5SWZB 3GBMH 3HMXL 1H3TA 1TNMA 3IYLW 5D2NE 3H42H 1RU9H 2R2EB 2IAMA 3TN0B 2MQCA 1H0DB 1SJHA 3LRSB 1A7QL 3I6LE 4P5TC 3L6FA 3BPLC 5D7LB 4PREA 1OLZA 3F7RA 4LMQI 3X12A 3ARGB 3L3JB 1JFQH 2E27L 2DJ4A 1UKSA 3GZKA 4JR9H 1QFHA 3TZVB 5KVGH 3P9LB 3LKRA 4YHKH 4V1DB 3WIFB 4KK5D 1PAMA 3I6GA 5I15H 2R2EA 3QXWA 1N8ZA 3H7LA 3MXWH 4YFLI 2OQJB 4FQCH 4U1HA 1WCQA 2A9NL 4W81A 2H9GA 3S3PA 3UAJD 2V2WA 3UYOD 3QWOA 4JFQB 3RGVA 3TZVA 3KYNB 2WAHA 2D03H 2BERA 2YUVA 4CAGA 3MLWL 3BZEA 3IRPX 3S5LB 3B2UC 1SEQL 2X4NA 1P7QA 4XHJD 5CFHA 4JPKH 3EOBA 4X9GA 3GIZL 1KLUB 2PCPA 4X7SH 5ESAB 3QG7L 4UOW0 1D9KC 5AWNL 2NY7L 2FZ3B 3RIAK 3OKOA 1DVFA 1WZKA 2P49B 3KPNA 4HIIA 4K3DH 1T6VN 2EKSA 1CE6B 1PZ5B 1MH5B 1NCUA 1KCSH 3Q6FA 4Q9QH 3QHZH 3VFGH 2DL9A 5D1XB 2H1PH 3IXAB 3QG6B 5FUOH 5EUOA 4NIKB 3DO7A 1Y6NR 1X5KA 1NFDB 3FQTB 4ZFGH 3FO2B 3MJ9H 1IEAB 4Y4KC 3KPNB 1ZA6A 3ARDD 3TYGL 3ZLQC 3ZYJA 5FM8A 3VXME 1JBJA 4HWUA 5C07D 3ZTNH 2DYPB 1MIML 4NM4H 5DMKA 2MOVA 3X3FL 1E4XI 5E94B 2WM0A 3L3DB 4Y4KB 2FGWH 5J11B 3FB8A 3OBAA 4P2OC 4WTZA 4UZGA 4MX7A 4DQOL 5MI0B 3BKJH 5EDXA 4ACPA 5I1AA 1T5WB 1F3DH 2GJ6D 3SKMA 4O51B 1GZPA 2X4OB 4YUEH 1QSFE 1EAJA 4RAVA 3VD7A 5C0AB 3U83A 3ZSTA 3ULVE 4WI6A 1HYSC 1IARB 1FLRL 1UH3A 4MA7L 3KXFE 4FTVB 1UENA 2B0SH 1SJXA 3UJTL 4GAYA 5KVEH 4KI1A 3KJ4C 2ORBL 4TUOA 1BVKB 1L0QA 2A6DB 1QACA 4PV8B 1GIGH 4GJTB 2P8PB 1NGWA 4XXDB 5DHVH 5ICZA 1FNLA 3BD3A 3Q48A 1NMCC 4GAFB 2IAMB 5I1KL 1OAQL 3MJGX 1XGRA 1IGMH 1N7ML 5HJ3B 2W9EL 1MJ7H 1HH6B 4TRPL 3D39E 2VISB 2FSEB 2VMFA 4K8RL 4NC2B 2AERT 5L2KA 4HUNB 1F4WH 4TUOB 2OSLA 2CH8A 5EU3B 3TNNA 3TT1L 5HVWA 5DUBB 1UA6L 3T0EA 1RZFL 4NQEE 4A6YA 3DROA 3W5MA 5T5FL 4NKMB 4RFNC 5E6ID 3M45A 3S36H 3PWLA 3VH8G 2VISA 5HGAB 2VLJD 1J12A 4DTGH 3OAZH 2G60L 2EZ0C 1O7VA 1ZOXA 2QADD 1R3JB 2VXSH 5GS0C 4JFOB 5IMOA 1PGRB 2BCKA 4F33A 5F3BB 1HHGA 1W72H 1MCWW 3ESVF 1DN2A 1ZTXH 2W60B 4Z7OF 5EO1B 3NIDF 3PWLB 4PS4L 4EI5C 4TUKL 2EZ0D 5CINL 5J1TC 1J1OH 2I60L 2DLFH 2NY4D 4UV7H 1NFKA 3KLAB 3LB6C 1JHKL 1A6UL 4JKMA 3RWFB 3IDXL 3GSNL 4MJ6B 4TULL 3QNXB 2JCCF 3ZDYE 1PZ5A 4Z76A 2C4FU 3RVVC 3KNBB 1N59B 4JZJB 3MRGA 4YEEA 1KLFA 3PWNA 4YDJB 2W92A 3NZ8B 1XGPB 3C9NB 4KJQD 5F9OL 4CJ0A 1SJEA 2EXWD 1R3HB 1NUGA 1KIPB 4UV7L 1UQSA 2KDGA 3FO2A 3GBNH 3DGGB 2L4OA 3CX2A 3F58H 1FCGA 2WUCH 3BH9B 5EBGA 4HV8B 5DMKB 4WI3A 2YEZB 3SO3B 1HHHB 1OB1A 1RJZB 5DJ8A 5BV7C 3PWNB 1F4AA 1AP2A 4JVUA 4Z5RB 5L88L 1MFEH 4LIQH 5HDQH 4WI4A 1A9BB 3V9FA 2AK4D 3DNKA 3N50A 3MLYL 1TVHA 2G5BA 4I5BA 1R0AH 1BFTA 3P40A 1GSMA 3SGDH 3PQYA 5AYQA 1NGZA 1Z9SA 1JZ8A 3T65B 3G5ZB 1DANT 4YDKH 1L7TH 1U8IB 1AD9A 4ZMAT 1EZVY 5B8CC 4J3TA 5DURD 4W6YB 5IHZA 4NZJA 4F8QA 2ID5A 4CMHB 5HYJA 3RQ3A 4HPYH 3OB8A 3WS6A 4H5SA 5C0BE 4X83A 2NYYC 3KPLB 3BN9C 3NOIA 1CE1H 2BK8A 1T1WB 3GJFB 5T1MA 4OLUL 5IW6B 4PGCB 2VZVA 5D7LE 5ISZE 2WW8A 5FYLL 4MD5B 4Y19E 1QSED 3GBLA 4XBPA 5DJ2A 4LSVH 4OAWB 1G9NC 2IFFH 5MENB 2PR4L 4C57C 4H25B 4R97B 3O9WB 3NABH 4P0DA 5EO0A 1J0JA 2AK4E 5GRXG 4C56D 1RZFH 2OSLB 1JHLH 2HVJB 3EJZD 5DZLA 5C08E 1QO3B 2ARJQ 3L1OH 4U1NB 4WO4B 1ZTXL 2R69H 5DD3H 3IVKA 4BH7A 4TNWF 1I3UA 3P0VH 5DRWA 5I1JL 3C09B 3GMNA 4Q2ZB 5EU4B 5DJCB 4CN6A 1DBJL 3WFDL 1E4WH 2I25N 4U1GC 3WO4B 2HVJA 2BJML 3U4BH 3OKNB 1E4XH 3UPAA 3A6CL 4P2RB 2XQYG 3IVKB 4NN5B 1I9RH 4EEEA 1FBIH 4DEPC 4P9HL 4JCMA 1XF3A 1E27A 3C6LD 2XWBA 3H0TA 2ZG3A 5JZ7D 4Y5YA 4L3CB 4V1DA 3WIFA 1YMMB 5FA3B 3BP4A 1PLGL 3OZ9L 5TE6H 3VGEA 4WFHD 5FYKE 3V5DA 2R4RH 2AEIT 3ISWA 3MRNA 5CBEA 3QJHB 3Q1SL 3QUML 5FYJD 2ICWB 2VZTA 4HK3N 1HEZA 4CVZB 4R90L 5CGTA 1P4BL 1LO4H 4RFOL 1Q9WA 3VCLB 4NJ9H 1XZ0B 3CFCL 3D87B 5E9DE 3PL6A 5E0QA 4DN3L 4O58H 3BGFB 4CUCA 5EFIA 2IAMD 2ICCA 1EFXB 3O3EB 1AP2B 2QQQA 4Z5RA 3SBWA 3WN5B 3BSZL 2NNAB 4GG6A 4Y19A 4QEGA 4YE4H 1D5XB 1Q9WB 4Y89A 3PQYB 4HIIB 3GM0A 1NJ9A 3FOLB 5ADPL 4UOJA 5HYSA 3MV9B 1DL7L 3WL9A 5I1LA 3B9KA 5TFSL 3B2VH 3FQUB 4JRXE 3T0ED 3THML 1PX3A 5LXGL 1NAML 1EIBA 3DHJA 1IGJB 1QSEB 3U30C 4YE4L 4RMWA 1KYOK 5BXFA 3EOAB 3HZVA 2I27N 4PJ5E 4HAGA 1FFRA 3PP3K 1A7OL 5E99L 3VXPA 2ITDB 3R1GL 1AHWA 2DKUA 2R1XB 3OGCB 5JQ6H 3ULVD 3QI9A 5AEAA 5DK3A 4GRWH 3DI2B 1NC2B 1S7VA 2XG4A 5DLML 1NDMA 4L8SC 3V6FA 5CAYB 2J5LC 3BT2L 3BRFA 3U36B 2HT2C 4TSCH 3SEPA 5CGYD 2DBLH 3QUKB 2NR6C 3RUGF 1AQKL 1SMOA 5K33A 3NH7L 5D71L 1XMWA 1YJDH 4QKXB 1SM3L 1TCMA 4XP1L 1NMCB 1A64A 1WBZA 1UCBL 2XZZA 5LJYH 5I73B 1E0OB 4OZ4B 4YHLH 2A83B 2FX9H 2IG2H 2GT9A 2PN5A 3GSQA 4OZFA 3CC5A 4OB5L 5I1CL 2HJLA 3WNOA 4P2RE 1QR4A 5F7DA 3MLVH 1ZHNA 2EDRA 1I7ZB 4G5ZH 3DMMB 4D0CA 5K9OA 2YD7A 3WMSA 1FQ9C 1CT8A 4WEUD 5C0JB 3GUTA 1BLNA 5CJXA 1P1ZA 2CMRL 2BDNH 4UILH 5CIPB 4OV6F 1FE8L 3FQXB 3QDJD 1WV7T 1KOAA 3B9VA 1EH9A 2YRLA 4IHOB 2XWBB 3H0TB 3LV3B 2DQFB 5DJDA 4KRLB 4DGYL 1KSRA 1A1MA 2VLLA 1JPSL 4K7PL 3HE6B 1RUKH 4LCYB 5DQJA 5I75C 3RPIB 4PB9L 5GGQL 1G6RA 2N4IA 4OD2B 3K46A 2UZYB 3SN6N 5J6GB 3LQMA 1K2DA 4NN5C 1MHHA 2DQFA 3SCMC 3WKNA 5B22A 3PL6B 2X2YA 1J05B 3OTTA 5MP6H 3P9MB 5L2KE 1FNEA 2NMSA 2NTFA 3KR3L 5GRJH 4PJHA 1JL8A 5JPNB 1VKXA 3P2TA 5BV7L 3I6LD 2J6EL 2A6IB 5DSCB 3I3DA 3QUXD 4ZOCA 5HYSB 5FM4A 4F7EA 4J6RL 1QG3A 3BT2H 4MAYA 3P0GB 2GTZB 2R0ZH 2NTFB 5IHUL 1F42A 5E7BA 2V17L 3GI9L 4MDJB 1YEHL 3JV6B 4EN3B 2DB8A 3GSNA 3O4OC 3TIEB 1I1RA 4PG9B 1BAFL 2R2HA 1MLCA 3OGCA 1CXEA 5CEXA 1CL7I 2GHWB 4AQ1B 4PRAA 3VFRA 5GGVH 5FYLD 3S96B 2D4DA 1W0VB 5DVKA 3SE9H 3QDJE 5JUEH 4P9ML 2ITCB 5E00A 2YA2A 4FTVA 2NY1C 2NYYD 2GEEA 1DP0A 3EZJB 4JKWA 1IAIM 2Q1EA 1NGZB 4OCYL 1KPUB 4R3SB 1Y18B 3O6FA 3VG0L 5MEQA 5JOPD 2W0FA 5MERB 3Q6GH 4PGBB 3PWUB 3H9SE 2V2XB 5DVMA 4U1LB 1ETZB 1KXVC 3GHEL 3HMWH 4P2RD 5E2TL 4KDTC 1KG0A 4Y5XC 3CSBA 2BVOA 5EIVA 1JNLL 3HNTH 2ZG2A 1OSPL 1TNNA 3E8UL 4KKCC 2ZUTA 5ABDE 2OI9C 2DTSA 4ZFOA 3IKCA 1ZSDA 4MD4B 3EFFA 1P1ZB 3Q5YA 5K9KB 4OD3L 4D9LL 2R4RL 3G5VB 1TPXC 2HRLA 1TJGL 1FDLH 3O4LB 4PB0H 3VFVB 2WIIA 1BX2B 3KPSE 3VXSB 4HFWB 3BRGC 3DV6A 3T1FA 2C1OA 4FQ2H 1SBSH 3IKCB 5C6PB 1HSBA 5D96B 3KPMA 1EX0A 2WBKA 5IJKA 2VXVL 4TPRH 4P2CG 1ZLWH 1Z6JT 5J6GA 3O4LA 4F3FB 3NGBB 4KH2A 4ELMB 1AGEB 1O7SA 1S9WB 3BHBB 1MJ7L 2OMNA 1N7MH 3MV01 3I02B 3LZFH 5FECA 3CUPB 1Y0LB 4NSKA 3RVUD 1TZGH 3RX5A 5FGRA 5C07A 4X5LA 3MUZ1 1JTTA 5GSRB 3SY0A 1G7IB 2RCSL 4EQ3A 3HE6C 4JY6B 1R3IH 2R4SL 4KU1A 5TF1H 1Q1JL 3KHOA 3E1F1 2HKFH 4G8FB 4KUCF 3SO3C 3T0BA 1T7YA 3N9GL 5EN2B 1CFVL 1UWXK 2IFFL 1IILE 5I76A 5E8DL 5KS9E 3CSYA 4HJJH 4YC2B 3ARBC 1SQ2N 4KC3B 4ODTL 2APVA 3NFSL 2YUXA 1EMTH 1TVHB 4LCCC 3QUZC 4NKIL 5D1QB 2BY1A 4HXAH 3GSNB 1J0HA 1NFDE 1XF4A 4GW4A 1KF9B 1DQQA 3GDBA 5D1ZC 3RVXD 3T65A 4X6DA 2WQRA 3P4MB 2R9HC 3EBAA 1YNLL 2BSTA 5FXCH 3QUZD 5HHMD 2D7TH 5EOCL 4XNUH 4KJPC 1OPGH 2YRZA 3NFSH 4GBXA 1NBQA 2L0DA 5T1KB 2ZP0T 3A6BH 1L7TL 3QXTA 4NDMB 3AS3A 1YEDB 5I0DA 5AYUH 5INCB 1YDPB 2VZOA 1HH9B 4V1DD 1NANH 3O6LH 3MC0A 1QP1A 2V2XA 3QUMB 2QQLH 1KXTB 3EO0B 2R15A 1AXIB 1DN0A 2Q86A 4R4BA 3AXLB 4UBDC 2DD8L 1AGDB 4PJXE 1CD1B 5J11C 2R0LL 1C5DA 3ALXA 1C08A 3FO9B 1T80A 5KVDL 5ID0A 2IPUG 3T2NH 3UPCA 1DN0B 1DDHA 1AD0A 1U3YA 1QFWM 2EIEA 2W0PA 3QYCA 5DJ0A 2F58L 4Y19D 2DDQH 1LDPH 5D7JC 3MRPB 1U93A 4Q6IA 4WU5B 4AYFA 1JK8B 1SY6L 3FT2B 3TT1H 4P4KD 4YDVB 1WT5C 4RBPK 1JFQL 3KLHD 3IXTA 1F90H 5HI3C 1JIBA 2GSGB 4NQCB 3PGFH 5AG8A 1W72L 3OR6A 2R2BA 2BVQA 1JZ6A 3V79C 1OP5H 4TRPH 1H15B 3MRPA 3HAEA 1JZ4A 2CO7B 3VRLE 5CZXC 4EI5D 4ZD3H 1T03H 2Y06H 2A74B 2M2DA 3D9AL 3T3PE 2ATPA 3MGTA 2GSGA 4M7LH 3T0DA 3MRNB 1BAFH 5I1CH 3QEQB 1S7WB 4JO4H 3RZCA 4Q9BA 4JY6A 2P44B 4M6MH 1NC4A 4IHOA 1FN4B 4YIQA 1D5IH 4GAGH 1DEEA 3O3BA 3ZKSD 1REIA 1FJ1A 2W9EH 2G9HB 4N1HB 3MGTB 1ED3A 3QQ3B 4OQ1A 1IGIL 3DV4B 4P49A 4PP2A 4WDIB 2ICWI 4LGPB 5DJYA 1ORQA 3HC4H 1GGYA 5JQHC 5JR1H 3PDOB 4U1JB 5F3HB 4G6KH 5DWUL 4F2MB 5E70A 1NCDL 3WNPA 5IB3A 4OIIL 2YZ1A 3E2HC 4B0MM 2H8PA 4ZO7A 5IFAH 4JZOA 3RDTB 2BSTB 4MXVE 4XZUA 4Y5XB 5I18H 3KPPA 1KPRA 4FMKA 1I8IA 3ULVF 5FUCC 3LD8B 4PYHA 1BD2A 1KN2L 5EORH 3TZVC 1QSEA 1BWWA 1I3RB 3FJTA 4GS7C 4TN9A 1TJHH 4QO1A 3WDIA 5KSBE 1XCQB 5IK3A 1CTNA 5TPWH 3UTZA 2ADFL 1S7VB 2NY4B 3HR5A 1CCZA 1J1PH 1EUUA 1E4JA 2YPKB 4KKLC 1F4XH 1QBBA 3BWAA 4LLQB 4G43A 5T1LB 4Y4FC 1SBBA 2IANA 1RUPL 3VFMB 1TQCC 5DMYA 4KMQA 3RZWA 4IEFB 5GGSY 3W81A 1EEZB 1F8TH 3MJ8B 5E1AA 4Q0XH 4ISVA 5F88B 1J10A 2BSRB 3L5XL 3ULVH 3KWWB 4MQ7A 4MXWH 4RGMC 2R9HD 3VFOA 1KJVB 4GG6E 4JPIA 1Q94B 1RZ7L 3MRMA 4PYGA 4IRJB 1FYTE 1VCAA 5GHWH 1B6DA 1MIEH 3RWEB 4HH9B 5ICXA 5I15L 4MSWA 5DS8A 1FAIH 4MB3A 1JWUA 3KYMB 5AUMA 4KUZH 4MAYD 1MNUL 5HGGS 1U8HB 3C5SB 1NCBL 2WBJD 1U0QA 3IXTB 1A3RL 3RVWD 2Z93B 4I18C 3KXFD 3L3HA 4WUUB 3MRMB 5LKNA 4JHAH 3DUSA 4CNIA 4K7FA 4JM2F 1K4DB 4MSWB 1R5IA 2K3TA 3U4BL 1OAYH 5DFTA 4XGZB 4YR6A 5C2BL 3NFPA 2DQTL 2JCCE 3ZDYF 1MREH 2DMBA 3PNWB 4KJYA 3VWKA 1EUTA 1EHLH 1I3VA 2KQMA 5FGCB 3B2UD 3BP6A 1M05A 1RZJL 3RZCB 2P5EA 1YQVH 4HC1A 3GB7B 1WWCA 3RY5A 4GKSA 5JOEA 4LAQH 1G7JA 4YIQB 3L1OL 4LAQL 4LP5A 1F4YL 4PY8I 4IS6B 1M6OA 2CSPA 2VXTH 1S9XA 4LLUA 3CH8A 4LKCB 1YJDL 1OCWL 4BSJA 1MCQA 3QXVA 3BKMH 2BP3A 4LSSH 3HR6A 4NKQB 3UJJL 1OY3B 3D69B 3JZ7A 1S8DA 2F9BT 1TJHL 3GB7A 3C6SB 4N8CL 1TCRB 3REVB 3QRGH 3BHBA 2CPCA 2D0HA 5ETUA 4NBXB 5D6DC 3MLVL 5F9JA 4L8BA 2OXGA 3QZWB 2CKBA 4JZOB 1I85A 4M6OL 4NM8H 2YPVL 2J2ZA 3EYUL 2BSSA 1RUPH 2JTDA 3MLTB 4YFLF 4FA8A 2OL3B 5GS0L 1NAMH 5IF0B 1P4BH 3JV6A 4LSTH 4JFEA 4Z7WF 1A5FL 5HDBF 3W0WA 4WGWB 1G1CA 1Z3GH 5FHBH 2VDOL 3E2HB 4H0HB 5E5RB 2A6KB 5HVGB 3RKPA 1X5GA 3E6HA 3LOWA 3OJDA 3DVGA 4N9GA 5E00B 5SV3A 1ES0B 4I4WB 4U0QB 4L4TE 2YK1H 1A6TA 1NFDF 2E9IA 5F1IA 2NY1D 1A7NH 1NL0L 2H26B 2DQHH 3FKUS 1N5YL 1BFOB 1S3KH 2IPTL 4L3ED 2XWJB 5C0DA 3ZDXE 1W0WA 4LLDA 5F6IC 4KY1H 4QHMB 4Y2DC 1DSFL 4AMKL 5C0FB 3SKMB 3QDJA 4HG4K 1GZPB 2CKBH 4RNRB 3SGKA 5FYLE 1AI1L 1F58L 1FPTL 4KJWD 3MRLA 4O4YL 5B38A 1LE9B 5GGRY 1MUJB 3DETD 5E56A 4RQQB 1BFOA 2X70A 3SDCC 5C3LD 4Y2DB 4H8WL 2MSPA 1S78C 3FFCE 1KNOA 2WBWB 1GGBH 3VJ6B 3EO9H 1F3JA 4WWKB 4Q6IC 4CVWA 4WRLA 3KPRD 4OUUA 2CDEA 4QRTB 4WUKL 5JHDD 2Y5TB 2YKLH 3AB0B 5DA0B 1Q72L 5ID0B 2ZUSA 2C3WA 3AMLA 4U49A 5C09D 3LKNB 4HCRA 1CGTA 2EDLA 2J88L 4LRNL 2GAZB 3LS4L 3TYFA 3R0NA 2W9DL 5EZJB 4JRYE 3SOBL 1A0QL 4M93B 4P5KA 4UB0H 1Z9LA 3D39A 4WU7A 2E7LA 5EU3A 3TNNB 1HQRA 4JVPA 3BDYL 3EHBC 5IBTL 4U31A 1F3RB 1B9ZA 2WWKO 1CGXA 4NZTH 2ERJB 5B8CA 2FHBA 3BD5A 4PJEA 1G84A 4M61B 4N0CD 4WFFE 2BC4B 2GAZA 5EU6D 3SY0B 1EFXD 2BVPA 3GRWL 4LCWA 2IPKA 4Z7WB 5C7XL 4H1LG 5DRZB 1MCBA 5I1GH 2NY1B 3GSUB 3TBWA 1YMHB 2IAND 5J3HC 5L8KB 5F7MC 4ZG1A 4F33B 3IDIB 1HHGB 2FWOA 3SDXB 2CUHA 3LPGA 3W11D 3RI5K 3FCTA 2P5WD 1HHKB 4NGHH 4FQQA 5DEGA 4KI5C 3F6LA 4PV9B 3HG1B 5DRZA 3HZKB 4OIAA 4HWNA 1FN4A 2F8OA 4DCQA 32C2B 1UWGL 5I8CA 3BJ91 4HC1H 5I19H 5BVJB 5I2IB 4GW4B 5HD8D 3UPRA 2DTMH 3WLBA 4RDQG 5B3JE 1CDIA 1G7LB 3UROR 3WFHB 2EH7L 3DV4A 3PWPA 3GMQA 4RGNC 1JPGA 2Z31A 3LQAH 4E9LA 4ZFFB 4JM2A 3O3AB 1FL6A 2FO4B 5E1HB 4AIZA 4R7DB 1MRCH 3EIFA 3FFCA 4JJ5B 5A2KH 2YEZA 1QOKA 5IB3B 1YDPA 5GZOD 4M1DH 4XVUD 3WFBH 2PKDA 4OGAD 5HHPA 1PKQA 5IBLC 4WI8A 1ITBB 2X4SB 3Q3GB 4Y4FA 2X7LA 4B41A 4BFBD 1IQWL 2YMXL 2X42A 3O6MH 2VO5A 2YD9A 4KVCH 4Y1AB 5CMAB 4GG6F 3AS2A 5DMIL 3FB6B 3C8KA 4EDWL 3MV7A 4U0RC 3QDJB 2OTPA 3WIHA 4IJ3C 3NACL 3S36L 2M26A 5FKAA 1K4CA 1MF2H 1PKQB 2F8XC 1P69B 2K9UA 4HKZB 3VI3F 2WINB 4Y2DA 1KXQE 2ZPKL 3T0EC 4OI7A 4LPUA 4JKKA 3U46B 1S7SB 4X5XA 3I6KB 4P2QB 1C8PA 1XGUA 1IM9B 2PTTB 3LEYH 4G43B 1EJOH 4PLKC 3WHE1 1M1SA 5JHLL 5B39A 8FABB 4U6XA 1F3DJ 2A6JB 4J8RA 4JO3H 2XN9A 3AS0A 3TZVD 1FFNA 4YNYA 4XCCL 4G9FE 1FFOA 3QPXL 2EDTA 3F7YB 3FQWA 4DN4H 2HFFA 2BOBB 5D2LE 2P24B 3TYFB 4IRJC 3VFOB 5J1AA 3BQUB 2VLME 2FX8L 4PJ9B 5HI3D 2XYCA 1FSKB 2DKMA 3GSWB 1KLGA 1RUKL 4F9PA 4WO4A 4H0IA 5DVOA 4K94H 5L9DL 5I73C 3VXSE 3MLPA 5AUMB 4XBEL 4QTIH 3KS0H 2LVCA 3NN8B 1FP5A 4ODSH 2W38A 3FN9A 3OB0K 4OCLC 1N3NA 1FL5B 4EUPG 3L3JA 1QA9B 1MRDL 4WUUA 1WAAF 4IIQC 1EO8H 3RIFF 3QXAA 1I1CA 1JYNA 1DUZB 4KPHH 2JB6B