2Q6WB

The structure of hla-dra, drb3*0101 (dr52a) with bound platelet integrin peptide associated with fetal and neonatal alloimmune thrombocytopenia
Total Genus 43
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
43
sequence length
188
structure length
188
Chain Sequence
TRPRFLELRKSECHFFNGTERVRYLDRYFHNQEEFLRFDSDVGEYRAVTELGRPVAESWNSQKDLLEQKRGRVDNYCRHNYGVGESFTVQRRVHPQVTVYPAKTQPLQHHNLLVCSVSGFYPGSIEVRWFRNGQEEKAGVVSTGLIQNGDWTFQTLVMLETVPRSGEVYTCQVEHPSVTSALTVEWRA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Immune system
molecule keywords HLA class II histocompatibility antigen, DR alpha chain
publication title Crystallographic Structure of the Human Leukocyte Antigen DRA, DRB3*0101: Models of a Directional Alloimmune Response and Autoimmunity
pubmed doi rcsb
source organism Homo sapiens
total genus 43
structure length 188
sequence length 188
chains with identical sequence E
ec nomenclature
pdb deposition date 2007-06-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00969 MHC_II_beta Class II histocompatibility antigen, beta domain
B PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2q6wB02
3.10.320.10 Alpha Beta Roll Class II Histocompatibility Antigen, M Beta Chain; Chain B, domain 1 Class II Histocompatibility Antigen, M Beta Chain; Chain B, domain 1 2q6wB01
4Y2DA 5H35A 3BEVA 3V5DB 3ILQC 4XXCC 3GMOB 4NN6B 3HE7C 4FXKA 5FUCC 2OR9L 1AO7D 4NHCL 5JZ7D 3O6FD 3D0LA 1D5ZA 3T1FB 1BQHA 5C0CB 4Q0XL 4G6ML 1E4JA 1KCVH 3O9WD 1QSZA 3NMEA 3W0WB 1G7PB 4O51A 3FAWA 4PJXA 1A02N 1QPPA 5I1KL 3EHBD 2P5WA 1KC5L 3NCEB 2YKLL 4C55A 4ZUVA 4G8EB 4ODTH 3IJYB 5T1LA 4WVRA 2ZWLT 2CJUH 1IAIL 5DJYA 3RWEB 4EJ1C 4LU5L 2AV7B 3BZEA 3KYAA 4UU9B 3CVHA 3F7VA 3QZWG 5ITBH 3TF7C 1VKXB 3GI9H 2GJ6B 4XTRD 3S34L 2CDFA 1K85A 5AG9A 3O6ML 4JN2B 3V5KB 4BQ9A 3D25A 4LAJH 4Z7UB 5I75C 5KSAB 3RVVC 5IW6B 1KJ2B 1DN2A 1A6VH 2FO4A 2H9GA 2C26A 3ZE2F 2W65A 1T2XA 5TDPA 2J88L 5J57B 5F8RC 3ARSA 2D03L 3MMEB 5GGVY 2BHYA 2M26A 1MH5B 4HIEA 1QRND 4NRYB 4RZCA 4EI5C 3S4SA 4Z7VF 1BOYA 5K9JH 2DBJA 2A6JB 4M1CD 2DLIA 4J3UA 1LEGA 3MRPA 4KUZL 1WTGT 4R3SB 5KVFL 4I4WB 2XQYK 1EHLL 4LQFL 2V17L 5JO5B 1II4E 2J1KA 4OBRA 5EO1A 3OAYK 5I1CL 1S9WA 3LHPH 2NY6D 5K9OA 3UTZB 4GOSA 1PZ5B 2BDNH 4TVPE 3DMMD 1KN4L 2XA8H 3ZT6A 4FFVC 1ZGLM 1I4FA 1FYTE 4R0LA 3HG1A 4MA1B 5HYSG 3B2VH 4GG8A 5I6XC 2HT3C 1ZHLA 4S1QL 2Q86B 3NN8B 1YY9C 3R0MA 1RULL 2APBA 2NR6C 2NX5B 4LRIA 5GIRA 4HPOH 3F12B 5TFSL 1K4CB 4JFFD 4N0FB 4S2SA 4FQ1L 4E41D 5CD5C 5F7DA 3IDXH 3O6KL 3MV9B 4FFZL 1QLRA 2C4FT 4I0PD 1A7PH 5K93A 5JIKA 1JF1B 2ICWA 3BP7B 3RIAF 5F7UA 4HDIB 1ZOXA 2XQBL 4NQDE 4XC3L 5D1QC 4EXKA 3CGTA 5EOQH 1TXKA 1AJ7L 1K6QH 1W72H 4YHPA 4ALAH 1QQDA 5CEYB 4XNYH 4MXVF 4RBPH 2NW3A 3ZDXF 5KS9A 1HXYA 3LVEA 5I1AA 5IHBA 3WL9A 5MENA 1F6AB 4GBXA 2C1PA 1JNNL 4HV8B 5C07B 4CW1B 1CG9A 1C08B 1S5HA 5CEZH 3TZVD 2OXHA 1ZLWK 3N1PC 2I27N 5T33H 5HVHC 1F3DH 4X8JB 2QQLL 1LO0H 4JFPB 2HFFB 5LXGH 5FHAL 4UAOC 43CAB 5I16B 3SPVB 4D0BA 3BH8A 1J8HE 2J5LB 5KSVA 4O2EA 2V2TB 1Q72H 5J3HD 3FRUA 3VXSB 1TQBB 3HB3C 5HDBE 1QSEA 5DJ8B 1KJVA 1RIVL 2X7LA 4MJ6B 1S7RA 4NFDA 4QXWA 4L9LB 5L2KB 4NNYB 4FQLL 1YPZB 4LLDA 4K71B 3R0NA 1EERB 4XMPL 5DDHA 3KLSA 2OYPA 5E99L 4QEGA 1MCDA 1ITBB 1JNLH 4PLOB 1TPXC 4JO1L 2PW2A 4YBQC 5EC1B 3QUXA 5F6HI 3P73B 5L6YH 1NFDB 4LSPL 3AB0B 4H0IA 2NXZD 3MLUH 1EEZB 4OFIA 4JFZH 2NY3D 5HD8C 3L3HB 1H3GA 4G80A 3X13A 3QDJD 2UWEA 5FO9A 5AYQA 5TH2A 2P48B 4HEME 2FBOJ 3ZYIA 1A5FH 1XGYL 1GAFL 1OTTD 4ZFOL 2HMID 1MCPH 2I9LB 3D87B 2D7TL 4HAGA 4JY5L 4NQSA 5DK3A 3PWPD 5C6WH 4FQXA 5J1TC 3S88H 1X5KA 4NWUL 3CCHA 3EO1B 3PDGA 1XF4B 1OM3L 2NY7L 1A1MA 1AHWA 2XZCL 5BQ7B 5CSGA 2CK2A 4HIIB 4M6NH 2AGJL 2H3NA 4NWTL 3TBVB 3HZYA 2GIYA 3JWNC 5K9QI 1I8IB 3K8MA 3P9MA 4KK9D 2ARJQ 3VDCA 1TETH 3KWWA 1KLFA 3KLDA 1JMZA 2H2SD 4LLWA 2FX9L 4UBDD 4LASL 2GAZB 2HKFH 4HLZG 3K80A 1ETZB 2GW5A 4M02A 5GGRA 5GJSL 4LHUD 4PGBB 4Z0BL 1YYML 3MO1A 2FX8L 4X6BB 2X40A 2BSRA 3OJVC 5GGQH 3OGCB 1QRKA 1JF5A 5CMAB 3VI4E 4PGEA 5MEOB 4FFYL 1W0YT 4UOW0 4OI8A 4FOMA 4GMTL 1HDMB 1NKRA 4XP6H 1JCKA 2ADGB 3VWKB 3WJLA 4M7LH 5EOTA 1V3LA 2WINB 3SDDD 3G6JB 2Z31B 4DZBA 1QLEL 4H20H 2ED9A 4OFVA 3WD5L 1F90L 1T03L 3T4AA 5EFIA 5L9DH 1O7SA 1EEYB 2ZCKL 5GGTA 2DLFL 1MY7A 1FAIH 1AP2A 4AY0A 2DM3A 3UC0L 4TTGA 2HH0H 4S0SD 4F7PB 5HHOD 1NCBH 4APQA 3VXME 3LKRA 3IJHA 3U1SH 2FECL 2J6EA 4JANB 2QR0B 5T3ZL 1I1YB 3PJSB 1G7QB 1K3IA 1K8DA 2ZP0T 4LMQI 3S37L 1RD6A 4CVXA 2BMKA 1C7TA 3MLYH 5HY9A 5DHVB 3QHZH 1A7BA 5EUKB 2M2DA 4PTUA 3S3JA 3CSGA 2DQEL 1EO8H 5CUSL 1N7MH 1DBBH 4P5TC 5IW3A 4BQ6A 2DBLH 2EIEA 5CSZA 4CVWA 2O5ZH 1G7JB 4JJ5B 3JWOL 1A9BA 2AJZB 3KLAA 4L8SB 2R8SL 3MJ8A 2Q7YB 4GRWE 5A43C 2EDXA 5TDOA 1VERA 2MMXA 2W0PA 4OCXH 1FZOB 3RI5F 5DD5H 5EULV 3LPGA 2Y5TB 5ICXA 1T1YB 5JHLH 3EYUH 3QWRD 1SM3L 3FRPA 2LU4A 4WHYG 1P7QD 4FQIL 4S1DD 3ULSA 2PXYB 2P8MB 5C08B 4KDVA 5IVZA 4NSKA 3RKPA 4X7SH 5D1ZD 4YHLL 3V6ZA 4AZ8A 4M7KL 4UT7H 3RTQA 2Y6SC 3ARGD 1LEKA 3LQAC 3HAEA 4OGXL 5MERB 4JREC 2IANE 4I2XB 4EN3A 1R3IH 1IT9L 4JPVH 3C6SA 4CVUA 4QRPE 1KB9J 5D93C 1XEDA 4Z8FL 4JRXE 1KTDB 3CX5K 1ZVSB 4EOWL 4HIXL 1IEBA 5IT2H 4LFHG 4C54A 2O61B 4Z7NF 3WSQH 4DUXA 1HKLH 4ZO9A 1MHPL 1X4ZA 2IWGA 3TV3L 3BMWA 1T4KB 4QHUA 2KZ1B 3IDYB 2VNCA 3WV0A 1N0XL 4P2QA 2H45A 2PYEB 3MV8B 3DO3A 2CSPA 2VXUH 5IB1A 5I1DA 1J87A 1KV3A 1XFPA 2Q76B 1NLDL 3GJEB 4NO5B 1HQ4B 2DOCA 2HT4D 5KAQF 4LVOB 3WNNA 3U7WL 4XGZB 3GO1H 1FPTL 4J3TA 4KROC 3KPSB 3LZFH 3VFGH 3ZKXB 2Z0BA 3QHTC 3HS0A 4ZG1A 1J8HA 2PKDA 4Q7DA 4LDLB 1Q9LA 3ARUA 3EJJX 4YC2C 5TGBA 2FD6L 2Q3AA 1FAKT 5ITFB 3NAAL 4F33A 3L3OB 1Y6KR 2G75B 5BRZD 4M7ZC 2IADB 1JFQH 4AH2B 3PGDB 4FXLA 4D8PA 1U41A 1A9EB 2EH8H 2A6KA 5C0IA 1S7VB 3WKMH 4UV7L 1E27A 5CCKL 2DKMA 4QRQB 4YO0A 3ULVL 3DV6B 2EDLA 4X4XB 1IGTB 5JIPA 4HH8A 2ZOKB 5ESQB 4G6FB 2XNAB 4JRYD 4MJ2A 4DGIL 5HVFB 4C59B 4QRUA 2BNRB 5E70A 2GK2A 2LQRA 1QEWA 3FMGL 4WV1B 1DQLH 2RBLA 1T3FB 2A9NL 3U0TB 3KYKH 2DD8L 3ETBF 3WYRA 3PGFH 3S98A 2E6QA 3OWEA 4PRPD 5D70H 2PO6C 2OZ4H 3QULB 4P2YA 1A1NA 1RHFA 2P8LA 1VEPA 2HG5B 1AGCB 1FNFA 5J6HA 4WI8A 4D9LL 1KJMA 4P5KA 2PYFA 1UACH 1RJZB 2WWMD 4PJ7B 3BIKA 1NMCB 3QUML 4W4OA 4RNRA 4C56B 1D9KD 4WRLA 5DD6B 4DK3A 2F8OA 3QSKB 1E4WL 2VAAA 1OHQA 1CFNA 1KCUL 2H8PB 3P0VH 5F7KC 3FQNB 1N64H 3CMGA 3V2AR 4X4YB 3QP3A 3PP3K 1ONQB 5DJXA 2I25N 2VLJB 3DYMA 3QH3B 5EZJA 3RWIB 1O0VA 2JIXD 4G8GA 4LSSH 3V52L 2YN3A 3LH2L 5DJ2A 4BK5A 4Y16D 4XWOC 4WUKH 3V7AG 1PLGL 4L8BB 4JKMA 5CZXD 3GBMH 1I7UB 2BSSB 2BY0A 4G7VH 5GS2H 4ZOBA 5GSRA 1IL1B 1ZA3A 5HYJE 1FVCB 3BGFB 5ENWB 4LF3B 4YHML 5D7JB 4FTVA 5FKPB 1HINH 1YEGL 5L8LB 1JZ5A 4TSCL 2MNUA 5CINH 2PTVA 1TNMA 1RZJH 5T1DH 1SJXA 4P59H 1AGEB 4XPHH 5CP7A 2DL2A 3IKKA 3QEUA 5KSUA 2YWZA 3F6IA 2ZOLA 4XPTL 2HTKD 5DQDL 4Y2DB 3K2UL 1I1AB 3SDCD 5AYUH 1T04A 2OI9B 3ULUL 5BW7C 2FYYA 5HDQL 4OB5H 2P5EB 3D0LB 3WFDH 5DRXA 3ARPA 3V95A 4JDTL 5DMKB 4MB4A 3M17A 1NCWL 3DXAE 4X4ME 4F9PC 4X6EB 3N1GC 4UB0L 4S1SH 1UZ8B 1EJOH 4PJXB 4XAWH 4XNXH 1KYOK 1V7ML 4ZUUB 1SBSL 4XVJH 1TNNA 2P5WB 1MCOH 1GIGL 4Z5RB 3HC3H 4GJTB 5BOZG 5BS0E 2C5DC 4N0CC 3WFBH 3O3DA 4ZUVB 2G2RA 1E0OB 1GHFH 1N6QH 4ZXBC 1DQDL 2BOBA 3TH2T 5T1LB 5D7IF 3FB8A 3QWQB 1FGVL 3BPNC 5ABDE 1WCBB 1B90A 3H8NA 3F7VB 1Q94B 1G9MH 1XIWC 4H5SA 3VFRB 2P46B 3VH8G 3SCMD 2CDFB 3LN5A 1B0RA 3HFML 2DTMH 1S8DB 1LMKA 3GBNH 1F58L 3NZHH 5GGVL 2AJUL 4M5ZL 1VESA 2ARJA 2MKLC 4L1DA 4HGMA 3RFZC 1YDPA 4U1GB 5I1IL 4CVZA 2FO4B 1WITA 2W65B 3S6CA 3KPRA 3C60C 4PRNA 2WK2A 1TLKA 4PPTA 1MY5A 2ESVE 4N8CH 4OLXH 3DTXA 3L3GB 2B2XL 4JRXA 1OP5H 3TT3H 3VGAB 4XNUL 1DQTA 4UNUA 4RA0C 3QPXH 4P2RE 3ZDYF 5E8PA 4MAUH 1MQKL 3FFDB 1MFEL 1YQVL 4PIRF 3C2AL 2YWYA 4UT6H 1BFVL 1BJ8A 3A6BL 1EMTH 1WLHA 5EO1B 3LEVL 1CICB 5CLTA 4XXCA 1L7TH 1S9WB 4OSUL 1MF2L 3U0WL 4C83A 2VDMH 2VWEE 3HE7A 3QISA 1IBGL 3VXRB 4YDJA 4D9RE 4PY7B 1QHPA 2XKNA 3MTRA 3VFPA 1CFVH 1P84K 1I4FB 3MRGA 3HG1B 4ZPVA 3WS3B 2E9WA 4GG8B 4WFGE 4HUNB 5I71B 1ZHLB 4KJWD 4KU1A 2QKIA 3HI5L 5KANI 5E2VL 2OSLB 2EH7H 5GIRB 1XT5A 4TRPH 2XA3A 4LLQA 4JZJA 4DCQB 3BKYL 1GGUA 4U1LA 4PLJD 5F7DB 3WHE1 5DUPL 4ZD3L 1NGQH 1VB9A 4H0HB 1WUNT 5EWIL 4OTXL 4UV4L 5ISZB 2PF6A 1IFHL 2ICWB 3PHOB 1NDMB 2V7HA 2WSKA 4YHPB 5E24E 2IQ9H 1T6VN 3EAKA 5HI5D 1T7XA 5LQBL 1QYGH 3QB7C 2B4CC 5SWSA 4RRPG 1ZEAL 2D7MA 5EC2A 2EE2A 4HEPG 4IRSB 2BOCA 4MJIE 2B1HL 4RMUA 4GBXB 3DHMA 5HHMD 1BMGA 5J4MA 1KG0A 2Z8SA 2NXYD 5LGJA 3PABA 4EI5A 5E4IA 3QDGD 1ZGLP 3SKJL 2AEPL 4P46B 5D1XC 5GRUH 5F7EH 3QIWD 1G6RH 2AJ3B 2DWDB 4XPAH 3T2NL 1XGUA 3PL6A 2FR4A 1UEMA 3GHEL 4JDVB 3HAEG 4XWGH 1JRHH 1IZJA 2X5PA 4AMKL 1WBYA 4OLUL 1S7RB 2MKWA 3R4DA 3ZTNL 4KJPC 3EYFA 1G9NL 4YDIL 3SE8L 8CGTA 4IRJD 3RKDC 5T1KD 4P9HH 1U8LB 1S5IL 5DMYA 3QG7H 1T20A 5I8OL 1N59B 1KGCD 2D4FA 3BFOA 5K33A 5HYJA 2FJHB 5CKAA 5AUMA 5JPNA 2ZUXA 5JW4N 4IS6A 1J0IA 1TTGA 3DRTB 2Z92A 4P3WA 1IGCL 1B88A 1OD7A 1JTPA 2P8PB 4G80B 3ULVD 3IXAA 2FB4H 5TH2B 4MNQE 4DTGH 1LNUA 2MCG1 5LG1A 4M1DL 1TJIL 4IEFB 2W0FB 1J1PH 2VN4A 4ODWB 1MJUH 4NQSB 4OF7A 4J4PC 5I1GL 3NCYS 3GRWL 3I2CL 1DQQB 5JORA 1UM5L 1TVHA 2NY1C 4H1LA 1INEH 3GSRA 2RIKA 4FQXB 1I9RL 3CCHB 4DQOH 1FNLA 4TOYH 2P7TA 5ESAB 2Z8WC 1A1MB 4JKKA 3IJSA 4QHMA 1UWEH 4XNZB 3MROB 5GGRY 4BQ8A 4JZNB 4IHOA 5LGHL 3OJ2C 2F58L 4U6YB 4NZTH 3B9KB 2OM5A 4FZEL 1NCDH 1A6TB 2GUOA 2X70A 1JNHA 2IH1B 1D7FA 2AJVL 2LTQC 3P9MB 1GC1L 4MA3B 4O58H 3VXQA 2ZPKH 2CK0H 4ODHL 1ZLUH 3TPUB 1JYWA 1MUJA 3GKWH 3K74B 4RX4A 4RA3A 3HRZA 3O41B 5BS0A 3H3PH 4PJAE 3TVMC 2VLME 4PRAB 1P2CB 3UYOD 1CDHA 4P4RA 3TP4A 5FUZL 3ZDZF 3ARDA 2QSVA 3MOBH 4N0RA 5CJOL 3RP1A 4DZBB 3ZKND 2OQJA 5IQ7L 1S7QB 5FGRA 2J8UA 3CZJA 2HVJA 4MQ7A 2ITCB 5FYLL 3RWDA 3BQUD 2OR9H 4MNHA 4APQB 5KSBB 3MXVL 4NHCH 2Q8BL 4J7RA 1RQ5A 3AFLA 4JFDE 4X0KA 1YJDC 3V0WL 2ESVA 3HNVL 3FN9A 4Q0XH 4G6MH 4XHJD 1K8DB 4AIZA 4ELMF 4PBVC 4XAKE 2Q7NA 3BPOC 2BMKB 5FV1L 3G9VA 5E5MA 5ICYA 1PY9A 5I1EH 2HFGL 3UXFA 4P2RA 1YMME 2P24A 3GNML 1BF2A 1CVRA 5KBNC 2YKLH 4P57A 4R2GD 5IBLD 1JZ7A 1U58A 3SJVD 3ULUD 5GRZA 4WU5B 1KEML 1MFBH 1IAIH 5GRJL 4YHOH 4LU5H 2DMCA 3ARZA 2FIKA 3C8KA 5TDOB 3HI1B 1CD9B 5GXBB 5DS8A 3S34H 5L2JB 3O6MH 1T0MA 2BXYA 4Z7WF 5ADPL 1FYTB 5DD1L 5ICXB 3S37X 3NZ8A 2X9WA 2A2QT 1OGAD 5E6ZA 4D9QE 1G7LA 5JDSA 1ZE3C 3FKUS 5IVZB 4NSKB 1KJ3L 1LO4L 3W2DH 2J88H 5FCUL 3RTQB 1DBKL 1LEKB 4ELKB 1Z2KA 3QPQD 2F19L 2D03H 1GGTA 4OBSA 4W68A 4U3CA 3HC4H 1NJ9B 2P44B 2GTWA 4N0YH 3RVTD 4TULH 5DTFA 3GB7B 1F97A 1OGTB 4LLVA 4UQ3B 2OTUB 1V05A 1GRWA 1BP3B 4KUZH 4NQDB 5KVFH 2BVEA 2ZG3A 1EHLH 3BWAA 4LQFH 2V17H 4QHUB 3LDBB 5IK3A 3IKCA 3V8OA 1NLBL 1VPOL 5I1CH 3QDAA 1WISA 3L95A 3OL2A 5DMGD 2ERJC 1J12A 5FUOH 5C0GB 2N4IA 4MJIA 4I0KA 3HCVB 3TIDB 4OIIL 4YHNB 5IB1B 3GZKA 3VMPA 1C5DA 2DQUL 1G7HB 3PWUA 4P48A 1SJHA 1GPOL 2NY4B 1BD2A 4FA8A 1NGXA 3CD4A 4F7MA 3CAFA 2Y7QA 5D2NE 2Y1VA 4S1QH 2H32H 1RULH 3TFKC 5MHSE 4G8FA 1J8HB 1E4KC 4ZSOE 4P5TA 2F53E 5F8QC 1Q9LB 5TGBB 1BX2A 1D5MA 4HS8L 5TFSH 5LGKA 4BH8A 4FQ1H 5E9DD 4V2CB 1V3JA 3O6KH 4FMKA 4D8PB 2E7CA 4FFZH 3MGTB 1OSPL 5C6PB 1FC2D 3SBWA 5FK9A 1V7NL 4JE4B 4KKLD 4YO0B 1R5VA 1VFMA 2WUCL 2XQBH 1AJ7H 3DVFA 1BJMA 2BRQA 1R24A 5C0ND 1C5CL 4ODXA 2FEDC 2DS4A 4QRUB 3GUTB 5I0ZA 3MJ9A 1FP5A 1QEWB 4XPGL 1JZ4A 5EB9A 4UIMB 1W8OA 4LP5A 2COQA 1MNUL 1KXVC 4IBLT 2CMRL 3MCLL 1JNNH 5HYEA 4N90D 1SJEA 2D9CA 2P8LB 3PE9A 3HZKA 1ZANL 3P40A 3V4VL 4PJ8A 4XCFL 3T0XA 4P5KB 2PYFB 4CMHC 4OLVH 4X6DF 5FHAH 3F7YA 4AL8L 4YQXL 4RNRB 5IHZA 1AGFA 4OZFH 2DMKA 1QG3A 5JOEA 3DURB 4G43B 4LPCA 5EG6C 2XWTB 1WICA 3ARED 3QWOA 1CFNB 3X3FL 2XTJD 4X4ZA 1ORQB 3MRHB 1RIVH 3QG6B 5F9WC 5DVKA 4OLWL 2X4TA 4PG9A 4FQLH 4JY4B 5EZJB 4E5XA 1F02I 2NY5L 2HRPH 4XMPH 4DJMA 1ADQA 1BQLH 5E99H 1SYSA 5D7KD 5DJ2B 1NC2B 4JO1H 4PJGE 5IKCA 5LKNA 4Z77B 2UV3A 2VC2H 4UINL 5I8EA 4LSPH 4U3HA 4PJAA 2DLGA 2BY1A 5GSRB 3RBGA 1RU9H 5TF1L 1ZT4A 3D48R 1FGNL 2YSSA 1ES0A 4QRSB 1HEZA 1FO0L 2P1YA 1BZ9A 1CR9H 3NFPB 2DIBA 4WDIA 5CEXB 2I26N 4JY5H 1T2JA 3I6KA 4J2XA 1WEJL 2R2CA 3GSNA 2FEEI 4YDLB 1MFAL 3S8WA 2DDQH 1FL3B 1CI5A 1OM3H 4L9DA 4PJBA 4KI5D 1RUQH 2ZOLB 1U42A 4IIQB 1R3KA 2AGJH 2IBZX 3CVHL 1Z9LA 3SY0B 3VXMB 3AROA 5D7LE 3VGBA 2XWBA 4WFFE 5ICZA 2XZAL 5IV2A 1WGOA 2F8VA 1U3HA 5IMOA 3HMXH 1CGSL 1JVKA 2PO6A 4XH2A 3MRIA 2J7LA 1PX3A 2FX9H 1ULVA 3FOMA 1HQRA 1YMMA 1BVLB 4EI6B 4Z0BH 5JMRA 2AERT 2ICWI 3MRFA 3JZ7A 5I8CB 2VH5L 3VDAA 4DGVH 2WQ8A 4FFYH 3TJEL 4WUUD 3OV6A 3R1GH 3G04B 1A47A 4FQJL 4JFQA 3ZE1E 3LEXA 2BOBB 1I8KA 4CN4A 3KYNA 3FB8B 5JHDD 4GRWB 1A7OL 4WFEE 3TBSA 4M6ML 5DO2D 1QLEH 3OKOA 1YN7B 1JZ8A 3WD5H 4H5SB 1F90H 4HT1L 4JHWL 1VFOA 3LN5B 4MCYB 1A1OA 4ODSL 1B0RB 5FDYA 2ZCKH 4Z76A 5JLZA 1ZHNA 3TN0B 5AZEL 3MRMA 3BVNA 3IDIB 3GKZA 4YZFF 1UXSA 3UC0H 1FSKB 4YXHH 3C5JA 4QLRA 1U2HA 3L5XH 4PJFF 4V1DE 3RY6C 1JPGA 4I5BB 4PGDB 4MQTB 2R1XA 3PWVA 3REWA 3D1MC 2IANB 1X9QA 1EEQA 5DJZB 4LCCC 4K9EH 3S37H 1QOKA 3U2SB 4QRPB 3DTXB 4JR9L 3HNSL 1UQSA 4JRXB 1F4HA 1G9EA 3F5WA 5D2LF 1K5NA 5D5MF 2DQEH 3RZCB 1IEHA 4MD0B 4ACPA 3D2UD 5CUSH 5DK2A 3RDTC 3OSKA 5E8PB 5FYLD 3NABH 1AGBB 4LVHC 2QHLA 3MR9B 4XX1G 3GJFA 3O45A 5DJ0B 5E6ID 4HZAA 3U9PL 3IRZA 1DEDA 5HHPA 5AEAA 3F58H 2R8SH 4K3DL 4PRIE 3RGVC 5CP3A 1BBJB 2J3SA 1MCWM 1F45A 5HBBA 2HLFD 3BESR 5BW7A 5I8KH 1V3KA 4YDJB 2PN5A 3TBYB 1OP9A 4YBHA 4KVNH 1RZKL 4WTXA 3VFPB 5HTSA 3ZE2E 1DJSA 4F9PA 1CFTA 1SM3H 4GKZA 2PR4L 4FQIH 1UB6B 2W91A 1MCEA 1T0NA 1U3ZA 5EBWB 3DECA 4ZSOA 1JZ6A 4YHLH 3KPQB 3CFEA 4CDHA 3KXFD 1SEBA 3I3DA 2APFA 4Z7VE 1FVEB 3B2UD 3NFSH 4K8RL 1IT9H 4ZXBA 3BGMA 4JZJB 4OFYA 1AGDA 2EDBA 3QZWB 4MVBC 2Y72A 3VFVA 3QNXA 4Z8FH 3A67L 2VR5A 4S1RH 2VQ1B 4EOWH 4U1LB 4HIXH 5SWZD 2V2WA 4J1UA 3K81A 4YUEL 1XIWA 3OG6B 1MHPH 1PQZB 3TV3H 3V79C 2NY2D 3BRFA 5EZLB 2LVCA 4WO4C 1B9ZA 1N0XH 1NPUA 1FNHA 1P5VA 2A77L 1NGWB 5E2TL 1W0WA 4MWFA 1RAMA 3SO3B 1QBML 3PIQA 2VZ3A 5SV3A 3CFIC 5JW4M 2VZTA 5EC2B 4NQCE 4P3CH 3D69B 4ORGA 4K94H 4Y4HC 1NLDH 2BOCB 3C60A 3I02A 2BY2A 3OF6D 4GT7A 2AK4A 3DJ9A 3U7WH 4Y5VB 4YNYB 1EDQA 5DC0A 1FPTH 3VMOA 4NN7C 2FNBA 3U46A 1KB5B 4RMSA 4HWNA 4MAYB 3T65A 4YBLC 1H5BC 1AQDA 3PABB 4OCSL 4EI5B 1HYSD 2R2BA 1U36A 4OLEA 5FB8A 1CXLA 2FD6H 3BDXA 3TA3C 5D9SB 3CVIL 2IMMA 4PTTB 3NAAH 1K2DB 3QQ4A 3WO4B 3PL6B 2FR4B 3BD3A 4MCZB 2JJVA 5DYOA 1WBYB 4UV7H 5CCKH 3ZDXE 3ULVH 4KK5C 4LAQL 1PAMA 3BIBX 4KGLA 3SKNA 4EUPA 4NJ9L 5C8JA 1DLFL 5FECA 5H8DA 1HHIA 4LCWE 1DQJA 2BSTA 4DGIH 2VXTH 2VSCA 3TNMA 1WF5A 1T20B 3FMGH 3SGDI 4U6VH 2A9NH 1VADB 1U93B 2QV2A 5HYJB 2DD8H 5JPNB 5I6XB 3DX7B 3K3QA 2F54E 1HHHA 4Q74A 4XVUD 2Z92B 4DKDC 5BVJA 4HHAA 5BVPH 4ODVH 4RFNB 3UTSD 3MUGA 4D9LH 5C92A 4F2MA 4ONFL 5FDWB 4JFEA 3QUMH 5BV7L 4PB0L 3MGAA 1QKZL 5JORB 3I3EA 1EA9C 1TVHB 3C6LB 5FYJD 3L3DB 3GSRB 5GGUB 1E4WH 5A3IC 1XH3A 2GYSA 3RWFA 4HJJL 1ZTXH 1AY1H 3FFCD 4Z95H 1S3KL 1UWGL 3SKMA 3WJJC 5D7LA 3IJSB 2C3XA 1HZHL 4BFIA 3DYOA 3MBEB 4WHDA 4IHOB 5DEFA 3O4LD 5IMMB 3O81A 3O3BA 2IBGA 4RGNE 4RIRB 2GUOB 3ZL4L 3RI5K 3GSVB 2IALA 3DXAB 3LH2H 1YEEL 1WIUA 4CJ0A 4X5WB 5GGTL 3VWJB 1IEAB 2D31A 2DICA 1NH6A 3SDXB 3N1FC 4M8VA 7CGTA 1I3UA 1WBXA 2X10A 1MUJB 3VGFA 2CD0A 5HVHB 4KHTL 4UAOB 5D1XA 4YHMH 3L6FB 3VGGA 3LKNA 2EZ0C 4PLKC 3IETA 4B7LA 4YDKL 5KN5A 1BGXL 2C3HA 4TSCH 3GSQA 3VI3F 3ARDB 2CKBB 4PD4J 4QTIH 1Z0NA 3RWJB 1UYWL 4WWKD 2CRYA 3QQ9D 2OQJB 4TNVK 1A2YB 5I76A 3KNBB 4XPTH 3JVGA 4FZ8H 1OPGL 1JL8A 3LKQA 3K2UH 4B50A 4NZDA 3BW9A 4PS4H 4K2UL 4XZUB 1TPXB 2XTLA 4YWGH 2HVJB 4LFHD 3ZSTA 5KVDL 3ULUH 1OD9A 1F4YL 3RWDB 4MNHB 2GHWB 3N9GL 5F1IA 4DEPC 5HDQH 4HF5H 1CBVL 2XN9B 4L4VD 2DQDL 1K3ZA 5DR5L 4OLZL 4PJ5E 3UTOA 1FFNA 2NCMA 4K3EL 5E7BA 4AIZB 4RBPK 1NCWH 3KAAA 4UB0H 5DLML 3MLRL 5DURD 5ICYB 2RGSA 4XBPB 2QEJA 3Q3GA 1NMAH 3QI9B 1I9EA 4J4PA 4NP4L 1GIGH 3HNTL 1LP9B 5FIEA 3DHJA 4RAVA 4P2OD 1UJTA 3LS4L 1DQDH 2OL3L 3HUJF 4PRIA 1C16A 1DE4A 3LKSB 1FGVH 2R23A 4GAFB 1KCSL 2VLKA 3B3IB 5SX4H 3P4MB 4TUJB 3FQXA 3C5ZC 1ZT7A 3O3UN 1M7IA 1T0MB 3HFMH 1F58H 2W9EL 5GGVH 3GK8L 2AJUH 2CRMA 2W0LA 3NCYP 1NCAL 2FGWL 1MI5A 4OD1L 3QNZA 5I1IH 3VXUE 2VJXA 5JW3L 3UTQA 4JB9L 1TQCC 3E3QE 3B8SA 1EHAA 1HYRC 4HSQA 4Z7VA 5MEPA 1I7TA 5F7WC 3O0RH 3LCYA 4PJHA 1JF6A 3UBXG 1Z0MA 1KPVA 1DP0A 2B2XH 5HDOA 3SQOL 5CBEA 4G9FD 3OKKA 4TUKH 4EVNA 3U36B 4XNUH 1LK2A 3QEHA 1CGYA 4DAGL 1SMAA 4LLVB 4MS8C 2IMNA 1CF8H 4GXUM 5C2BL 1MQKH 3UJIH 1MFEH 1YQVH 3C2AH 3O8XB 4YXKL 1H0DB 3IAGC 2DKUA 1S9KC 1MAML 2IPTH 2IG2L 3BWAB 5IK3B 4BH7A 3IKCB 3LEVH 4JDZA 4ETQB 2CLZA 4WU7A 4OSUH 2ATKA 1MF2H 3GIZL 3WBDA 3U0WH 4KRPD 1MLBB 1IBGH 4NQCA 4Y4FD 5CSBA 5EOCL 3X12B 1RUML 4MJIB 1BECA 5EU7C 1RK1B 4FHBD 3UYRL 5F9DC 4KTDL 1EUTA 2V7NB 2VOTA 1U8JA 1R0AL 1NGXB 4HS3B 5DJDA 4F7MB 4JFHE 4TNWF 2KUTA 1BHGA 3BKJL 1HE7A 3HI5H 2FJFB 4Y89A 5E2VH 4G8FB 4FP8L 1NBVL 1L7IL 4Z7NE 4OV5A 1BX2B 5AD0B 3V6FA 2R15A 35C8H 3BKYH 3GSOA 3VJ6B 5JZ7C 1UCTA 3MLXL 2NYYC 2XY1A 5DUPH 4ZD3H 4LGPB 4Q2ZB 2J5LC 1CGWA 2GT9B 4HBCL 4PY8I 5EWIH 4OTXH 4CNIB 1CK0L 2YPVL 3EDFA 3O9WC 4ZUSB 3D18A 1TQBC 1D5XA 1Q8MA 5MEND 4LEOA 2X41A 4YHIA 4HFWA 1V5JA 1R24B 4ODXB 4UDUA 3KS0J 4PRHA 3OPZL 4L9LC 3G6DL 4K8RD 4PJIF 5LQBH 1YNTA 4KMTL 1AI1L 4W81A 1IM9B 4WI7A 3ULVF 5GRXG 1ZEAH 1OQOA 3T0EE 4PREA 3TO4B 1OL0A 3P4NB 1JGUL 3UTTD 1IRAY 1RURL 5IBUB 4MNQB 3KDMB 3DI2B 3AB0C 3FZUD 1SJEB 4X7TA 2ZUYA 4PJ8B 1ZWIA 1QSED 2H2PD 4I18C 2X1QA 4JPIA 3J7HA 3SKJH 2AEPH 3GMQA 4JEGB 1QLFA 5IHZB 1AGFB 5IQ9A 3L3IA 5IROC 2VDQH 2UY6A 1S7UB 2YD6A 2A6IA 1QSFD 3BP6A 1NCNA 3GHEH 4AMKH 3QUXD 4OLUH 3LRGA 4XVTL 2V9RA 4RQQA 3ZTNH 4RGOL 4LDOB 3SE8H 4A6YA 4GSDH 4E5XB 2XFXB 3MV7E 3L3JB 2AJXH 1DEEA 1SYSB 4HUXB 5FV2A 5I30H 3LSOB 5I8OH 4Y19D 3SE9L 1MHCA 2D3VA 5I8EB 5I1HL 3SGJC 1CTOA 5I19L 2HVKA 3IXTA 2Z91B 4PJAB 2D7NA 4YK4C 3WEXA 3HKFA 1IGCH 4BFGA 4MXQC 1ZAGA 6FABH 2VLRE 1ZT4B 4YC2B 5BMFL 2NY6C 1CVSC 3PF2A 4NKOA 2M1KA 4HH9B 5GZNC 4QOKE 4M1DH 1TJIH 2ZUWA 1BZ9B 2LAGB 1XCTB 2DYPB 1IZKA 2VDLL 1QFUL 1TJHL 1VSCA 1X6LA 1R3LA 1ZA6A 3DMMC 5ILTH 5I1GH 1DTUA 3VFOB 1NEZB 3I2CH 5E03A 1A6ZB 4AEHL 4DK6A 1I9RH 2BNQE 4JO2L 3WXVL 2DLHA 4Y2OA 4MDIA 4HUVB 2Z31C 1I9JH 1R3KB 2G5BA 1Y18A 4N5ED 5LGHH 1KPRA 1A64A 2XWBB 4FZEH 4OV6F 3IS0X 3W9DA 2A9ML 4JFDB 4PJ5A 1WVZA 1U3HB 4WJ5B 1Q0YL 1GC1H 3O6LL 1OARL 1HOCA 1GH7A 2ZCLH 1EAPA 3JBG7 2Z93A 4NRZB 4ODHH 3G08B 4HUWA 3ULUF 1HQRB 1JWMA 4KVCL 3BEWB 1YMMB 4MNGA 3D3VA 3S97C 4RMWA 1HSAA 1EK3A 2MWCA 4WFHE 3KS0H 4Y88A 1JHKL 1FL6A 2NW2A 4Y4KD 4I9WE 2G5RA 2ZG2A 5FUZH 3LPWA 4JFQB 4QRRD 3LEXB 3FT4A 1T1WB 1I8KB 2EYTA 3KYNB 1S7TA 2OLDA 1RIUL 4X9BA 3QXTA 4EDWH 1LEIB 5MEQB 3DO7A 5HHXL 1H3PH 4RDQF 6CGTA 5IQ7H 4P23D 1TCRA 4RMTA 3EBAA 1CLYL 4NO3A 4L8SC 1A1OB 3TYGH 3FONA 1U3YA 3S9DB 3MOQA 4Z76B 4YAQB 1N3NA 3DLQR 15C8H 5EO9A 5DEGA 1W0VB 2AXHA 3BVNB 3HE6B 3HA0A 1Q9KA 1UXSB 3DARA 4X7DC 3FO0H 3IDGA 2AXGA 4K7PY 3MXVH 1DLHA 4ENED 4F7EA 4G8IA 1BPVA 2Q8BH 4KH2A 1JPGB 1XMWA 2R1XB 1JGDA 3HNVH 1V8HA 4DW2L 2G60H 4YFLF 3VG0L 3RNKA 3PDDA 1DBAH 2A0LC 5FO8B 2I07A 5TE4L 2X4RA 1Q9WA 1HCVA 4RFEA 1M7DB 1JPTH 3F5WB 2VYRE 3GNMH 1K5NB 4PR5A 5D7IE 1YC7A 2BFVL 5I15L 3KPTA 4LKCA 1KEMH 1JHTB 1KIRA 1ED3B 4Q6IC 5IVXF 3VXTB 1RUAH 5GRJH 2GSGA 5EPMB 3VW3H 3GBLA 5HHPB 2NXZC 1MSPA 4R90L 5ITBL 2NY3C 4P49A 4DOHE 3GHBH 3OB0H 1MRCH 1CFQA 3MCKB 2OJEA 3IDYC 1T21A 1PKOA 3TNNB 4FNLH 1OTTC 4F8QA 4OGZA 5ADPH 4C58B 5B39G 2APTA 3MNWB 1TVBA 1TZGH 1HH9B 4EN3D 1RVFL 3KPNA 1YNKL 2I60L 4IRZL 5D2NB 1R3JA 4S0TD 1XGPA 3WUWA 3MRQB 1LO4H 4ZSOB 2F53B 3RWHA 4LVOC 5FCUH 3CFEB 4H26A 2CUIA 3ZDYE 2F19H 1I8MA 4KY1L 1NQBA 4GRLD 3ZKXC 3BGMB 3MYZA 3VFVB 4P2QD 3TESA 4ZQKB 1B6UA 3KHOA 5FGBA 2H6PA 2JB5L 1PKQE 3IAQA 4JGJA 5AZ2L 3X14A 3V8CA 2G9HB 4YXLL 3OR6B 1DUZA 2ZSWB 2NZ9D 1VPOH 1W0WB 4FG6C 1U0QA 4GW4A 3AUVA 3RY6A 2BDNL 1FV1B 4OIIH 3X3GH 3DGGA 4HLZH 5JOPE 2XA8L 2DQUH 4ORGB 3UPAA 1JI2A 2A38A 4M3JA 1A7NL 3C60B 4LCCA 1CCZA 1GPOH 3I02B 4Y1AE 5HI3D 4CADB 3TJHD 1OSZA 5LWYH 3ARBD 1T22A 3QIBB 2AJYL 5T3XH 2JELL 4XP5L 3MFGB 1AQDB 1A7RH 4U1SB 3RDTA 2HFEB 2DQTL 5DSCA 2FJGA 2YMXH 3RUGB 4FQPA 1N2RB 1XR9A 1DBMH 1IAMA 1PW3A 1NMCC 4MHHI 3RGVA 4JN1L 4G7YL 5DJCA 5D6DC 2DLTA 5B22A 5KVEH 2PUQT 3H9SE 3MRBA 3MV7A 3P0YL 3WHXA 2WUCH 1W72L 4ALAL 4JFYA 4EUPB 4NFBA 4XNYL 5FECB 1RMFH 2ZJSH 1HHIB 1C5CH 4PJGB 2BSTB 3EUUA 5HGBA 5GHWL 4N0UE 4XPGH 1P6FA 5FYJH 3FN0L 5C0EA 3QNYB 1UH3A 4IJ3B 1EEUA 4M48L 2VLRA 5AG8A 1MNUH 2QADD 2KH2B 3LY6A 3E1F1 3EO0A 1MWAA 1K9TA 2KBGA 3MCLH 5BVJB 4HHAB 4QOKA 5CEZL 4NO2A 1WAAE 4D0CA 1ZANH 1KXTB 3V4VH 4JKPH 3B4NA 4XCFH 3MUGB 1MHHA 2HTLD 3MA9L 3BGFC 2CDEB 4KI5F 5DD0H 4AL8H 4YQXH 3U4EA 2NX5E 4M43L 3SO5A 4HWEH 2RHEA 1XH3B 4WO4A 1RI8A 4G8GD 1OP5K 3TH3T 3RWFB 4F37F 2IEPA 3X3FH 4G42A 4RMRA 1P1ZA 4O2FA 1LO3L 4MJ5A 4BFIB 3C8DA 4Y5YC 1YA5A 4HJGB 3NH7H 4BFBD 3O3BB 1FZJA 1OAZL 4EDXA 1ZS8A 4WHYH 2NY5H 4Y4HA 4Y2DC 2ED8A 4MMZC 2IBBA 4R4BB 3RU8H 1I1AC 3BZFB 4ISVA 2JCCE 2OI9C 3EOBB 4FTVD 4UINH 2VQUA 3RPKA 2D31B 4XMLL 2QQKL 3MLUL 1WBXB 1H5BA 2EICA 4L3ED 5FYJU 3KYOA 3QO0A 1J18A 3E2HB 2X1XR 4YDVA 5D6CA 1BVZA 1HXMB 5FYKE 3TA3A 1FGNH 2I9TB 3LKNB 1A5FL 1NAML 3OJDB 1FO0H 5C0AB 2VIRA 1KTLA 2YD3A 5KN5B 2ICWJ 2OL3B 3STZA 5F71A 5DRZA 2X05A 1AO7E 3F7RA 1JE6A 1MFAH 3WCYA 3MV11 3B8YA 5IIEB 3DYPA 1NUDA 4M6NL 5C7XL 3CVHH 4V1DB 4OCLC 2XZAH 5L2KE 5E0QA 1JPSL 4MB3A 3H7BA 4ZAKD 1TETL 3PWJA 4QXUH 1CGSH 3A6OA 3JV6B 2BVTA 3IF1A 1FFNB 3M07A 4LIQE 4OZIF 2GEEA 5L0QB 3CFDA 2X4SA 3NCMA 3N85H 1R5WB 3CC5B 2C4FU 3QDMB 2HLAA 3MLVL 4HUKB 3TJEH 1QO3B 1FDLL 32C2A 3VGAC 2ZUTA 2YS4A 4PRIB 1C16B 3WJJA 4M7LL 1CD1A 1OW0C 1A7OH 2R23B 4M6MH 5E08L 5GRVK 3MFFA 4Z6AT 4JM4H 4Q58C 4HT1H 4JHWH 4YIQA 1XGQA 3FQXB 3V5DA 1CICC 5B38B 3KPRD 3GMOA 3U79A 5EU6D 1QRNE 3RVUC 5IFJB 1DVFD 2IAMD 4R6UA 1ZVHA 4X98A 3LKPB 3WNKA 4MGXA 1GL4B 1CIDA 2KPNA 3B5GA 4ONOA 3RVXC 4Z78A 3ARFB 5C0CA 2XG5A 4JG0L 5EU4B 1OOAA 4Z7VB 1I7TB 3W0WA 2VZOA 3JV0A 2FH8A 5HXMA 3QHZL 4JR9H 1I3VA 3HNSH 3DI3B 4XMKL 5CBEB 3OKKB 3L9RA 4XCEB 3QEHB 1EO8L 1X5XA 3FT2B 5SWQB 2D0GA 2DBLL 4F3FB 3HE7D 1RUPL 2AS5M 4Y16C 4N1CA 1IAKA 1FE8L 4NCC1 4KAQH 4KDTC 4L4TD 4WI3A 1ZT1B 2AV7A 3BHBB 4OZFG 2AEIT 3RWEA 4UU9A 3U9PH 4I8DA 5CZXC 1EFXD 4JDZB 1VKXA 1NC4A 2CLZB 3BJ91 4XP9L 3I6GB 4NQCB 1F13A 1RZ8A 5F7YC 1AD0A 5TE7L 2JB6B 2D0FA 3N0PB 4JN2A 1RZKH 4Y1AA 4JFFE 4LHJB 4Z7UA 3EYUL 1GXEA 1PGRB 1U8JB 1HI6A 2X4PA 3BPOB 5FGCB 5H37G 2PR4H 3R8BB 3TM6A 1KJ2A 2JTDA 2NMSA 2YN5A 4IRSC 3RBSA 2JKXA 3I50L 3MMEA 3PHSA 4X9FA 3M1BB 1F4AA 3SDCC 4K8RH 1MH5A 2F5AH 3KPMA 3HRPA 1ZLUK 4OV5B 1J8KA 3A67H 4ONGH 4CRPA 5IT2L 4OCMC 4P46C 3MUJA 1FNGA 3H9SA 2HFTA 2GK0A 4YUEH 5LAXA 4ZNEE 4R3SA 3O2DA 4I4WA 3L5HA 5SWSD 2Z35B 3B9VA 5JO5A 4LCWB 3C5ZA 3BGAA 2K3TA 4K7FA 4Q9QL 2A77H 4YHIB 3D85A 3OG4B 2XXMB 4N0UA 2WLZA 5E2TH 4UDUB 3UTZA 1QBMH 3T2QA 4QHKI 5IHLB 1PZ5A 2YA2A 3SGKC 2MHAB 1A22B 4D3CL 2F54B 4K3GA 3RWCA 2B1AL 4U1MA 3TO2A 3RL2B 3GMRA 2Y9RT 4P4KB 4RAUB 1DL7L 1WAAA 4M03A 4TYUA 4X9IA 4FXGA 3GO1L 3BT2L 4R7DA 3LZFL 1SY6A 3NN8A 4X7TB 1ZWIB 4OCSH 2NX5A 3TBTB 3F12A 2WLYA 4X6CF 5H2BA 4N0FA 3TCXA 1CDJA 2VE6B 3L3IB 4GKOA 4A2LA 3F7QA 2YD5A 3MJ7B 4HGKC 2EH8L 3BP6B 3INUH 3MV9A 2XT1B 4WW2F 1JF1A 2ERJB 3GSNL 3BP7A 3GGWA 4RGNB 2I5YL 4JCLA 2GJZB 4RQQB 2GSIB 1N5AA 3BDYH 2HT3D 5F88B 3QDJE 3QUYB 4NJ9H 4XPBH 5CEYA 4A6YB 1NCUA 4XNZC 2JCCA 2DAVA 2NR6D 2PYEE 1WC7B 5IMLB 5DI8A 2YUXA 4PV9B 4RGMC 3B9KC 3FN3A 4M6OL 3WNPA 4HG4J 1MHCB 1LO2L 5HGDA 3PWPE 2HVKB 1INDH 5D70L 4HAFA 5CIPH 2ED7A 4X6DE 1V3MA 4KK8D 5D1QD 3H9HB 1KEGL 4X8JA 4FQQA 4JFPA 3DNKA 2HFFA 43CAA 5I16A 3SPVA 3SE3C 3MGOA 5DC4B 5BV7H 4PB0H 1AD9A 3VFUA 1TIUA 2V2TA 1MCCA 3O9WA 3RJQB 1G1YA 4OIAA 1C7SA 3MLPA 5I0DA 5DJ8A 5K9QG 3JWOC 1UWGH 1N64L 5IP4A 2L4OA 4MJ6A 4L9LA 1HZHH 5L2KA 2H26B 1Y18B 1YPZA 3IFLH 1RFDL 1A21A 4RX4D 3UDWC 5BS0D 5EC1A 1YEEH 4L4TB 3IU4L 5GGTH 2WUBL 1UCBH 1CZ8L 1NFDA 2Z93B 4Z7QF 4HUWB 3GBML 1DDHB 1EEZA 1U8IA 5M7QA 4I18A 2Z4QB 2J6EH 4KHTH 1HSAB 2XWJA 3L3HA 2APWA 1OY3B 3QDHA 1JPFA 5IB5A 3LN9A 4OKVB 5C0BD 4UTAH 2Q8AL 4E9LA 2I9LA 1RZJL 4KHXL 4K7PL 2CPCA 3CXHJ 1T7YA 1UYWH 2ADJB 1CDYA 4M8QB 5F9WB 4C56E 3EO1A 5E8EA 1XF4A 1XF3B 4S11A 1UADC 5B21A 4NO3B 1OPGH 2NXYC 3U7YL 5HD8D 1UWXK 2ESVD 3UO1H 3TBVA 4K2UH 1N3NB 2I24N 5EO9B 5DEGB 3VXUB 3MZTA 4A2MA 5KVDH 1Q9KB 4PJDF 5DVLA 3B6SB 1OAQH 1P4BL 1CBVH 1K8IA 2DQDH 4BSWA 4OLZH 1JGDB 1D6VL 2GAZA 4K3EH 1WZLA 1YC8A 1YMHA 4PJCF 1ETZA 2Z8RA 3RNKB 1EJOL 5DLMH 4XAWL 4PGBA 3MLRH 3EIFA 5F96L 5ADOH 2I07B 3K1DA 4QRTB 4EIZC 1F4WH 3O4OB 2OS7A 3DMMA 3OGCA 5CMAA 4NP4H 4PR5B 5MEOA 3HNTH 1JBJA 5BXFA 3WFBL 1NGPL 3I84A 3HAEH 1HDMA 1EPFA 3LS4H 2NZIA 2ADGA 4NZJA 4OI9A 3BPLB 1A8JH 1KACB 2WINA 5CJQL 2Z31A 1AKJD 5INDA 3EZJB 1KCSH 1IC4H 4JG1H 3NPZB 2YA0A 3ULVC 4YZFE 1NGZA 3LDBC 5C0FB 4JFFA 1EEYA 4PJFE 1GOFA 2OMNA 1M05B 2W9EH 2HJLA 5CGYC 1NCAH 2FGWH 4AQ1B 5A16B 5HHQB 4JANA 2QR0A 4JB9H 1XGPB 5HHNB 1R3HA 4R4NC 3VG9C 4MD5A 2P5EE 2NY4C 5D2LE 3RWHB 4D2NA 2W38A 1AC0A 4OLXL 5ID0A 5DHVA 1I8MB 1YNLL 3GDBA 5EUKA 3V6OE 5KS9F 3SQOH 3TT3L 5I9QB 4X9HA 1CT8B 3ET9F 4ZNEA 5ID1B 4F57H 4DAGH 3OX8B 4ZS7L 5BZWA 1J9CT 1T80A 5C2BH 4O02L 1I1CA 1G7JA 1Q9OB 2VZSA 4UT6L 2AJZA 3TZVA 2IG2H 1W72B 2Q7YA 1DUZB 4GQ9H 2ORBL 4KKNA 2JLLA 4PY8J 1BD2D 5D71L 3GIZH 4GW4B 1FZOA 1AIFB 3KYMB 3O11B 1RUMH 2YPLB 3T0EB 5J11C 1T1YA 4KTDH 4P5TD 3QJFA 4LCCB 1EV2E 5BRZE 3IB4A 2BP3A 2P8MA 5EO0B 1OSZB 3ZKNC 3WFHB 1T22B 4HX1A 3WNLA 4BZ2L 1S7WB 1F5WA 2XZQL 4UOW1 4LDEB 5A2IH 2YD4A 1IKFH 5DSCB 3OKLA 3ZT5A 4JRYE 3H2WA 4XCNA 4HKZA 1OLLA 4Q6IA 1UC6A 1UKQA 3P3YA 3CFCL 4DN4L 1BF8A 1PZUB 1KTDA 1XR9B 3MLXH 1P69B 2O61A 1CIUA 4ZMAT 2FZ3A 4U2YA 4HBCH 1CK0H 3FO2B 2ADFH 1T4KA 2UWEF 4PRPE 3MRBB 3O2WL 5HGAB 3MV7B 1SJVA 2PYEA 4HLJA 2NY0B 4QHNA 5D96B 4JFYB 5A2LH 4NGHL 3G6DH 1RK0A 4R2GC 4GW5B 4KMTH 1AI1H 2B4CL 5EIVA 1X5JA 2QTEA 2Q76A 4NO5A 3RX5A 4PJ9B 3S3PA 2VLRB 1L4IA 1HILB 1JGUH 3LIZH 1RURH 3KPSA 5IM7B 4QOKB 1QACA 4L5FH 3UTPD 4B0MM 1MHHB 3ZTJH 5GRVL 5EU5A 5GRUL 5F7EL 1G6RL 4WI2A 3U4EB 1S78C 2B20A 2BNQB 4OQTA 1S7XB 1O7VA 2G75A 2UY7A 1YEDA 4U1KB 4AH2A 3PGDA 1A9EA 4RDQG 4KV5F 3RX7A 5C9JB 1S7VA 4QGYA 5IEKB 4AT6B 1XAUA 4YDLC 5C0JB 4O2FB 3MYJB 3T3PF 3DV6A 4MJ5B 2DWEA 4KROD 1XF1A 4XVTH 4X4XA 4RGOH 5ESVB 3OKEB 1FZJB 5ESQA 2XNAA 1ODAA 1ZS8B 4IIQC 1GZQB 3L5JA 1JWSA 5ALCL 5GS0C 2ICEB 4GH7B 1CGXA 1T3FA 1I75A 3U0TA 4GLRI 5I1HH 3RA7L 5I19H 5GSVB 4YBLB 1H5BB 2F9BT 1IQDA 1A6AA 1XGRB 1MFDH 4NNPH 2EEDA 2FB4L 3AY4C 2HG5A 5D6CB 1AGCA 5GZOC 3ZKQD 1O5DT 3LEYH 1RJZA 1KTLB 4YX2L 2XV6B 4MB5A 3STZB 2A1WH 4C56A 4HULB 3BP5A 5D6DA 1BFOA 4TUOA 5JW4Q 4AEHH 3NCBB 4ZO7A 4DUWA 4DQOL 4LLMB 4TOYL 4EQ3A 2BNUA 3LOWA 3BOVA 4JCMA 4JO2H 3WXVH 1UWEL 2PO6D 4XBEH 4X4YA 4GRWH 2CLRA 1ONQA 4NZTL 3CNKA 3W39A 2CH8A 1NCDL 4NQED 2A9MH 3PWNB 3PWJB 4HMDA 4O58L 1Q0YH 2X4UB 3K0WA 4LEXL 1UB5B 1OARH 3TN0C 1IAOA 1FL5B 3IF1B 3I9GL 3IU3B 2YUZA 1LK3L 1U92B 4KVCH 4TNWK 3CFDB 1IL1A 4F58H 5D7IB 1BQSA 1UM6H 5ENWA 4Z0XA 3VI3E 4MQSB 1PG7W 2V5MA 3CPLB 3JV4A 3R8QA 1JHKH 5FKPA 1E4XI 2HLAB 3QWRA 3TEUA 3PGCA 1C5BL 1H3UA 4HPYL 4ZTPH 2E8YA 5B8CC 4NQXB 1U91B 2MSPA 4BA8A 1F8TH 3RZCC 2C9AA 1AGEA 1F11A 3MODH 3VE0B 1C1EL 1RIUH 4XWOD 3SHSA 4Y5YA 4CJ1A 3MFFB 5HHXH 5DQJB 1WIOA 4PJFA 1QFWM 1CLYH 4AIXA 5B3JE 1I1AA 1CGTA 1QFWI 2PTTB 1A6WH 4LLYA 4ZODA 4KQ3H 4X98B 4NPYB 3DRQB 1LDSA 2P5EA 4XC1H 4Z78B 1CLOH 5DMKA 1YJDL 2N7AA 4DW2H 5T3ZE 4ERSL 4X6EA 4U1IB 3VG0H 2XTJC 1U8OA 1EO7A 1PD6A 1UZ8A 1H9VA 2MQ3A 4ZUUA 5TE4H 5I1EL 4RMQA 3PNWB 1JGEA 4PP1D 1PKQB 3L9RB 3CUPB 4M4RA 4I3SL 4Z5RA 2UUDK 4U31A 2BFVH 2EECA 3PP4H 5I15H 3JUYA 1MFBL 4E0RB 4JZJC 1IAKB 4LCIL 3C09B 2W59A 4YHOL 4KKAD 1CXFA 4U7MA 1WCBA 1Q94A 3BO8B 3HPLA 4R90H 1NC4B 3VFRA 2BVUA 1BBDH 5DK0B 3UJJL 1G9NC 4RCAA 4DEPB 2P45B 1S8DA 1RZ8B 1AD0B 5F7FA 3LAFA 4Y1AB 3SO3C 5DFTA 1N0LA 4YHKL 4N0CD 4GAGL 1F2QA 2X4PB 1HI6B 1RVFH 1YNKH 4ZXBD 2I60H 4IRZH 1UT9A 1ZLVH 2X42A 4UQ2B 3X11B 5KSBE 2K7PA 3QYCA 4P99A 5HGGS 3W2DL 4PG2C 3NCJL 2WM0A 3H9ZA 1UH2A 4Y5VC 1BVKB 1XIWD 3QFJB 1HK6A 3L3GA 2P4AB 3HC4L 4KY1H 1J1OL 1GGYA 4MAYC 3KPMB 2X6MA 4N0YL 4LSQH 1TJGL 4TULL 1OW0A 2DJUA 3UEZA 4LCYB 2JB5H 3FFDA 4PRPA 5AZ2H 1FNGB 3DOSA 3NPSB 3H9SB 3QJHB 2GK0B 1NUGA 5LAXB 2VKWA 4OZHF 4NUGL 4ONHA 4R4FL 3QXAA 4MD4A 3C5ZB 3WO4C 3KJ4C 3PL6C 4YXLH 5HHME 1CICA 4K7FB 4JKWA 3D85B 5I66B 4N0UB 5F9JB 2AK4D 5FUOL 3HPJB 3QDGE 3VXRA 4M7JL 1TCMA 5E2WL 4PY7A 5DMIL 4L3CA 1TQCB 3RWCB 4U1MB 1WIPA 3TO2B 5J12B 3GMRB 2BZDA 1IQWL 1A7NH 4QWWC 4X6FB 1IKNC 2NTFA 4QTHB 3RAJL 3V9FA 4XHQA 3WS3A 4FXGB 2WWKO 4R7DB 1HHGA 2AJYH 4MYWB 2BK8A 2JELH 4XP5H 2OSLA 3GMPA 2DQTH 4RFNC 1EJ6A 1FCGA 2YXMA 4Y16A 1EUUA 4DCQA 2X9YA 5H2BB 2GFBB 2EE6A 4KDTA 1D5BB 1KGCE 1QFHA 2HJKA 4N9GA 4QF1B 3SQBA 4JN1H 4G7YH 5ISZA 3C6LC 3GGWB 5TE6H 1I85C 3PHOA 4H1LH 1NDMA 3P0YH 1N5AB 2WWKT 3WIIL 3ULVE 4U2ZA 4PP2A 2MCPL 4DVBB 1EXUA 4LRNL 3V0AC 2JCCB 2VISB 1MCRA 3MBEC 5DI8B 5GHWH 1H8NA 3ARRA 3CH8A 4WWID 1RIHL 5ACMA 1I9IL 3FN0H 4IRSA 3FJTA 5HGDB 4M48H 4JFED 5E6IC 1HIML 1AR1C 2AI0L 3T08A 3VWJC 5KG9A 3L7EA 1MIEH 3OKYA 3SDCA 3WMSA 4JO3L 5IOPB 4ZFOA 3MZGB 1AO7B 3SDAD 2XKUA 3O6FB 4FQQB 3MA9H 4OLVL 5D7LD 4P46A 3MGOB 5D8JL 1CU4L 1AD9B 2AJ3A 3VFUB 3T09A 1E28B 4M43H 2DWDA 3GMNA 4AEEA 3O9WB 3T2OA 1KYOJ 3CDFA 3ARDC 4JDVA 1NAKH 5CJ8A 1MRFL 1X5IA 1SMOA 1PEZA 3ARYA 4ZPTB 1LO3H 1RJLB 3SGKA 4ZFZB 3DUSA 4OF0A 3BDBA 5E8DL 2HRPL 1OAZH 1BQLL 1U8LA 2WBJD 5D1XD 1N59A 4HK0B 2VC2L 1A7QL 4L3AA 3BI9X 2FJHA 4XMLH 1CLZL 3DVGA 2QQKH 2VDNL 2X1OA 3BKCL 4WFED 4CAGA 1U8IB 4OD3H 4QNPE 1RU9L 2NY2C 3DRTA 1A4KA 3SCMA 3DBXB 4I18B 2XWJB 2P8PA 4PD4K 4Z7OE 1JPFB 4PJEF 2VZUA 5IB5B 4KJPD 1NAMH 1CR9L 2W0FA 3RKDD 1FC1A 3MUY1 4ODWA 3QI9C 2PCPB 1DQQA 4YHZL 4KWUA 2JK5B 4G3YH 3MV01 5JDJA 2DDQL 4NUJB 4P9MH 5E8EB 5ESAA 4PGCA 2D9QB 1RUQL 3MROA 1JHLL 1QRNB 2VWEC 4JZNA 4J3WA 1MRDH 4ELMB 4U6YA 5GRYA 1HYSC 5C7XH 1LVEA 3B9KA 2C3WA 1S9XA 1A6TA 2IH1A 3CU7A 4H8WC 3HLAA 2V9QA 1JPSH 3HMXL 3SJVE 5DD3L 4KJQC 4MA3A 3ULUE 1XR8B 1K8IB 1OAYL 4QGTA 4YK4B 2C3VA 5C09D 4BSWB 1GGCL 2J12B 2VKXA 2NY1D 3IDMB 3TPUA 5FA3A 1YMHB 2NY6B 3UZVB 3VGDA 1CN4A 1XCQB 2YPKB 4ODUB 1U8PA 2Y07H 3O41A 3SE3A 2ICES 3DMMB 5GISL 4K7PX 3QFDB 4PRAA 5FM4A 2VLKD 4DGVL 1P2CA 3DUUB 5BXFB 5C1MB 1EVUA 4KMQA 3MLVH 5F7MC 3R1GL 3FB7A 1FDLH 2EDDA 3VDBA 2EDKA 2E8ZA 4GXVL 5IB4B 1UXWA 4Z7WB 1OGAE 5E4EB 4J6RL 5INDB 2EDFA 2Y25A 5E08H 1MI5D 1MCHA 1IVLA 1S7QA 3O8XC 3N1MC 4NOBA 1NGZB 1SBBA 4OI7A 3QXVA 3D39D 4JFFB 3UDWA 3DSFL 3OKNB 2YC1B 4E41B 1FQ9C 1YEFL 1YUHB 3TVMD 3VXOB 4F80A 2HJLB 2ITCA 4YXHL 5KSBA 4I0PB 4TVSa 1JV5B 3L5XL 1CL7I 1R3HB 3QXUA 1MEXH 4JG0H 4N5UA 1BZ7A 5DRWB 3WIFA 4MD5B 3WXWH 1LE9B 4K9EL 3S5LG 3VD4A 3IS1X 4LKXB 4XPFL 5LCVH 5ID0B 3BN9C 2BVPB 5DHXB 4XMKH 2KKQA 3NACH 3QUZD 4L4JA 5LJYH 1NANH 1BEYL 1NEUA 1NFIA 3NABL 4HK3N 2EYSB 4V2BA 4WU5A 2R56H 5BZWB 1RUPH 4JQXC 3DVNA 1FE8H 1IC7H 2X4QA 4H25B 4BYHA 3TZVB 3F58L 1U8MB 4F37K 3QDGA 3FB6B 4R7NB 3SOBL 3HI1A 3SBWC 1WFNA 4YR6B 4I48A 4XP9H 2HN7A 5I8KL 5L2JA 4JGUA 3OZ9L 2YD8A 4KVNL 5TE7H 1FYTA 2X9XA 3T1WA 5DFVD 3BD5A 3MJ6A 4QHKJ 1U9KA 5DJAA 3QJFB 5E9DE 5EA0L 3MCG1 5AWNH 2VSDA 1N4XL 3PV6B 2ZUVA 3MJ9H 3QQ9C 1LO5B 4HX1B 3TO4C 3HZVB 3LB6C 4N8VB 4ELKA 2EDJA 2B39A 3I50H 3IDJB 1PG7L 4Y7MA 3LQAH 5FFLA 3NFSL 1MWAL 3OKLB 4MDJA 1NJ9A 1QA9B 1G6RB 4QXTB 4PJ8C 1BQHG 4HKZB 4XCNB 4Q6IB 4S1RL 4JRWA 3GB7A 1OGTA 4KPHL 2VITB 1JWUB 4UQ3A 2LABA 5TDNA 2OTUA 2NXZB 4HJ0C 4PRHD 5CJXC 1GGBH 2NY3B 2FZ3B 4NQDA 1UJ3B 4TNVF 3EJYC 3GSUB 2VDRH 3QDJB 4UUJA 3T3MF 4B7IA 4N90E 4QHNB 4Q9QH 3BYYA 3EYVA 2EDWA 1VEMA 5C0GA 3PQYD 1RK0B 4YHNA 3TIDA 3HCVA 5IFAH 3PWPB 3KVQA 2O5XL 4D3CH 4P2OC 4P3CL 2B1AH 1G7HA 3QCTL 4K94L 1JK8B 4X6DB 5DQ9A 1DL7H 2XTJE 3BT2H 1UKTA 2YD2A 2Y36L 3SGEH 4FFWD 5EU5B 5C09B 3MJGX 1J86A 4PFEA 5D7KE 3MACL 2PETA 1YEDB 3ARTA 5I74B 4LHUB 1YQ2A 3MGTA 4HXBL 3GSNH 3FO9A 4ZTOH 2DWEB 2I5YH 3EOYG 5CD3B 3S4SG 4YE4L 3TFKD 2VXTL 3GUTA 1FNEB 1Z9MA 3A6CL 5ACLA 4UI2A 1CXHA 1JWSB 3CSYA 3SDDB 4U6VL 4UIMA 3OB0K 4M6OH 1U3HC 1LO2H 3CXDL 4U0RC 4BKLA 3HI6L 1IQDB 1A6AB 2J8UF 5BVPL 4ODVL 3PDOA 4LGSB 5CWSB 4KI5E 2E6PA 1KLGB 4G5ZL 3BQUA 5HHOB 1KEGH 1ZHKA 2FEDD 3L5WB 4QY8A 4GAJH 5DGQA 3BP5B 4NC0B 5CKGA 4NKQB 1YN6B 1EHNA 5EZOL 3DURA 1BFOB 4TUOB 4G43A 4HCRL 3WDJA 5F6IB 1BIIA 2XWTA 2BCKB 1I3GL 1ZTXL 4PJ5D 1AY1L 4Z95L 4KC3B 2BNUB 1ORQA 3MRHA 3QG6A 1FNSH 3UPCA 5IJKC 3IFPB 2CLRB 3E6HA 3W39B 3MQIA 4JY4A 1RFDH 1GOHA 3D3VD 1YEHL 5I17B 4WUUE 1EBPA 1NC2A 1JYNA 3IU4H 2OK0L 4Z77A 4NKIL 1IAOB 2WUBH 5JPMA 2FO1A 3HE6C 1CZ8H 5JHDE 2IFFH 4L29A 4XCCL 4NM4L 2D0HA 3PG2A 5EH1A 1YEKL 1F2XK 4WTZA 4J23A 3W82A 4Z0XB 2QQNL 4HC1L 3ALWA 5JQHC 5I2IB 4QRSA 3JV4B 1GSMA 3TT1H 3NFPA 1OGAA 3PGCB 3WLBB 1P7QB 3ZKSD 2Q8AH 1LHZA 2O26U 5CEXA 4KHXH 5F3BB 4YFDB 4QTIL 2GY7B 5B4MD 3RPIB 1IGYA 1F11B 5D1ZB 4K7PH 5T5NG 5C70A 3ARGB 1HH6A 4Y5YB 1FL3A 4PJFB 3GJFH 4FZ8L 4UZGA 3SN6N 3V5HB 4OM0L 4IIQA 3U7YH 1IGML 4QKXB 4PS4L 3N50A 4YWGL 3SY0A 3VXMA 1MCQA 5CP3H 3WNMA 4LLYB 5DUMH 4KDWA 2FSEA 4OGAD 4HF5L 3BP4B 5EBLA 1P4BH 5FYLE 3TBWB 5F44A 5D2LB 5FKAB 1X4YA 3IFOB 5JXED 1ZMYA 1D6VH 5DWUL 1IM3A 1BM3L 3AY4A 1BOGA 1P7HL 1U8OB 1BVLA 3K4AA 5D2NC 1KN2L 3JWDC 4EI6A 5F96H 1OB1B 1KJ2L 3SDXE 5HDLA 1JGEB 1NMAL 5I8CA 1S9YB 1CE6B 1NGPH 1CQKA 3G04A 2YD1A 2XKSA 2J4WH 4HIJB 1LD9A 5CJQH 1YN7A 3HPLB 4I1NB 4NJAH 2BC4B 1M7XA 1JUFB 1GOGA 1S7SB 3KXFE 4MCYA 3OXRB 5E9DA 3TN0A 5BRZB 4LPTA 3VGHA 3IDIA 3BKML 3PWLA 5SWZE 4I5BA 2DLEA 4PGDA 1OTSC 1FH5L 5I1LA 2IANA 3O0RL 2H32B 2XN9E 5DJZA 3U2SA 4QRPA 4HGWA 4LARL 4JRYB 1ZK9A 1DZBA 5E2UL 1BLNA 3V7MA 1YNLH 3QIBC 1EGJL 4TUKL 5B8CA 4KKCD 3RZCA 4PGJA 4MD0A 1P4LB 3EOTL 1VA9A 4OUOA 3F65A 1CF8L 1AGBA 4ZS7H 4PRPB 3MR9A 3UJIL 1JTOA 1LP9E 4O02H 1XF5B 5DJ0A 1MJJB 1IGJB 4LCUB 2YZ8A 4HMEA 4ONHB 2IPTL 2X89A 3QXAB 1H15A 4MD4B 3G5YA 4J3XA 1BBJA 2ORBH 3CDCA 2N7BA 5D71H 3RWGB 4U6XB 1QHOA 1H3TA 1OWRM 1D9KB 1J88A 3TBYA 4Y4KC 4X9GA 3QEQD 4L3CB 4NDMB 5DGRA 3RDTD 2NTFB 5D4QA 4PB9H 1UB6A 3QHFL 2OP4L 5FOBA 5EBWA 2B5IB 4NO0D 2OTPA 1TTUA 4IJ3C 4JHZA 5EN2B 1HHGB 3HZMB 3KPQA 4BZ2H 2JIXB 4FMFA 3RGVD 1HCFX 2B0SL 3WUZA 1FVEA 2XZQH 3GMLB 1J1XL 3GMPB 4OZFB 4WHTA 4Y16B 3AU1B 2A74A 3QZWA 1HHJA 35C8L 1X4XA 3NIDF 3CFCH 4JJHA 4DN4H 1LE5B 1N8ZB 2VQ1A 1QTYT 2HJKB 4N9GB 4G6JL 2VB5A 1ZLSL 1BJ1J 4CMMB 4O2CB 1PQZA 1MOEA 4WEBL 5EBMB 2QBWA 5EZLA 3O2WH 3DIFB 1NGWA 1KXQE 2F5BH 2K9UA 4PP2B 5J06A 1EXUB 3AS2A 5JTWA 4NGHH 12E8H 3EYSL 4U33A 1J0HA 5IW1B 1QR4A 2BRRH 3U30C 2B4CH 4MVBD 3K46A 3D69A 1RHHA 1Y6MR 4PG2A 1M71A 4PJBF 2R1WB 2UZXB 4GRMB 4Y5VA 4YNYA 2AVGA 5KG9B 5E00A 2HKHL 3D0VA 2AK1L 1T66D 2Y4SA 3FFCE 3IFNL 1FLRH 3L7EB 4EIGB 3SDCB 1KB5A 2C3GA 3MXWH 4MAYA 4X6CE 2ATPB 4WO4D 3MNZB 4ZFOB 7FABL 1NCCH 3E2HC 3O4LE 2MQ0A 1J0JA 1OWWA 3FRPG 2V5YA 4X7FC 3GRWA 1VCAA 2DQIH 2EKSB 5D9SA 3G5VB 4PTTA 3CDGB 4NT6A 3GMNB 2VDQL 1K2DA 2XG4A 3OAZH 3UAJC 1BZQK 3QIUD 1ND0A 4HIHB 9CGTA 4B53A 4Y4HD 1WBZA 4MCZA 2DQFA 1A3RH 2X4NA 5IJVA 1DSFL 1IMHC 5IB2B 4HFUL 4GW1B 4D0DB 4ZOAA 5JW4R 3OBAA 4PV8A 5CZVL 4GSDL 3DUSB 4GRLC 3JVGC 3IRPX 1F6LL 2AJXL 3ALPA 5JHDA 1IKNA 3GM8A 5I30L 5ALCH 3TA3D 3C08H 4NC2B 1VADA 1U93A 2AABH 3RA7H 3DX7A 3HC0A 3DVGB 2V5TA 2LU7A 4JKLA 4Y5XB 3SCMB 1A4KB 3CH1A 5JW5B 1MVUB 4JFOB 4JGMA 6FABL 5KZCD 3FHQA 3DX8B 4KK5D 5L0QC 1KENL 1RPQA 2UZIL 3AMKA 3D5OF 4JM2D 4F7TB 4R97B 4OM1H 3ZLQC 5FDWA 3CK0L 4YX2H 5F89A 2CIIA 1FFOB 3DX6A 3OTTA 5ILTL 3JTTB 3RL1B 1MCNA 3C6LA 4OZGF 3L3DA 4L4VE 2HP4A 3RX8A 1DUYA 5GGUA 1I85A 1EX0A 1JZ3A 4X5LA 4ZDHB 3ARBC 4PGCB 5CZKA 3WFCL 1J05A 1HSBA 3BUTA 1ACZA 1I9JL 2VUYA 1NDGA 3CSPA 1FORH 3BWUC 3MBEA 3O3AB 5BO1L 3EKCA 4RGMB 2FATL 5IMMA 1S9XB 3MRJB 4RIRA 5LBSH 3SE4C 2V6HA 3V4PL 3D6GA 4HZLB 3HLAB 3GSVA 4Z7QE 1OAKL 3DXAA 1INQA 4X4MA 5E6IA 3LQZB 4X5WA 2C3VB 1IEAA 2ZCLL 1T89C 3VWJA 4LEXH 1BJ1H 4WCYL 1KIPB 3G9AB 3I9GH 3SDXA 1OCWL 5FA3B 5A3ID 1JRHI 1LK3H 3HUJB 5K9KB 3H3BC 2VXQL 1U8PB 3ARFC 1JTTA 4NBZB 4Y8AA 3MLTB 3TGXA 4DN3H 5EUOF 3I6LD 3L6FA 5JNYA 3WN5A 5AAMA 5T5FH 1C5BH 3FB7B 4HPYH 2CKBA 3RWJA 1UXWB 1C1EH 3QRGL 4EDWL 1YZZA 2QADC 3DGCR 1H3PL 1A2YA 4AEFA 1JP5A 3KNBA 4BQBA 2EXWD 1YY8A 4K3JH 4PJDE 3EYOA 5C0CD 3PXHA 3TYGL 3ABZA 5E8NA 3IDNA 4XZUA 5E8OB 3UCRA 3W0WD 15C8L 4G9FE 3ZYZA 4O9HH 5SWZA 1B4JL 4Q9RH 2AQ3A 3RGHA 1FHGA 2EZ0D 5F93C 3FO0L 4PLKD 4KJYB 4HWZA 4PJCE 3T2PA 2CLVA 2XN9A 4ZS6C 1E6JH 3ROOB 1BZ7B 2ZCHL 1YJDH 3WIFB 2G60L 4ERSH 1DBAL 3QA3B 4OAWA 3TCLB 1D5IL 5E7FA 1PYWB 3DVIA 4XBPA 3MLSL 1T83C 1JPTL 2GTZB 3EYQD 3QI9A 2XOTA 4I77L 1Q0XL 4I3SH 1LP9A 4FABL 4BSVB 4O4YL 2GJ6D 5GJTH 1NFIB 1N5YL 3OF6A 3ZTJG 1MCWW 5HHMB 4WTZG 5FM5M 4RWYL 1RUAL 1TDQA 3DVNB 2FHFA 4LCIH 3RJDA 3LKSA 2X4QB 4K23H 1IC5L 1YEIL 4AIOA 3VW3L 2NXYB 3B3IA 4Z18A 3QDGB 3GHBL 3P4MA 5KSAD 1MRCL 4I48B 4TUJA 2HN7B 3U0PB 3EFFA 2DN7A 3L7FB 3LKOA 3QIWB 2DL9A 4LK4A 3UJJH 5KVGL 4FNLL 2FHBA 3EOAB 3V7AE 2R9HC 1FZKB 4YHKH 1TZGL 3ZKMD 4GAGH 1KIUA 4PRBA 5DJAB 2BHUA 4HQQL 1WZ1L 1X5GA 3QAZC 1B0GA 4P4KC 3ES6B 3NCJH 4IRJB 1OQXA 2QSCL 5MENE 5T1KB 4MDJB 2A73A 1J1OH 3U36A 1QBLL 4RAHA 1DN0B 1TJGH 4ZAKC 5TDNB 3UYPA 1MELA 3BAEL 1X3DA 3O2VH 4PJIB 2AEWA 3O8XA 1H0DA 1X6NA 3QUKB 4NUGH 1N6VA 4UUJB 3UTTE 4OQTL 4R4FH 1G0XA 4ETQA 5IUSA 3EYVB 4RGNC 1MLBA 4JHAL 4C4KO 2GCYB 5JOFB 3X12A 1FVDA 2V5SA 4M7JH 1IAIM 5BJTA 5E2WH 3X3GL 1J10A 1RK1A 3QUYC 5DMIH 1E6OL 1HN1A 2V7NA 4O5LL 5INCA 3VG9B 2NX5D 3FFCA 4YGVA 4MS8D 1IQWH 4EKXA 1WWBX 1PG7X 1RJCA 4HS3A 5DQ9B 1IAII 2O5YL 4X6CA 3RAJH 1RZ7H 5HYQB 5LWYL 1QSFE 3KR3L 5T3XL 5IGXL 2FJFA 1A7RL 3MV9D 1EBAA 2R2EB 5J0BA 2YK1L 3ZHLA 3QUMB 1OT2A 5EORL 2YMXL 4JQXA 4MA8L 4C4KT 5AD0A 1DVFC 3FOLA 4UTBL 3VJ6A 1DBML 2UWEE 1UWXH 4GMSL 4I0CC 4MX7B 3BD4A 3FO1B 1H3VA 4Y19E 4OLYL 3UZQA 4Q2ZA 5C2UB 2GT9A 5F1NB 3MREB 4GXUN 4JHBA 4CNIA 4ZUSA 5KVEL 3SKUD 3FO9B 1U95B 4UDTB 3WIIH 4HWBA 1RMFL 3VFSB 5J11B 2MCPH 2ZJSL 4KTEL 4LSRH 5FYKD 3EO9L 4LRNH 3MRNA 4YGAB 1RJYA 1JYXA 5C07D 2W92A 2AKRB 1IM9A 3CSYB 1VFAA 4WWKA 5FYJL 3MNVB 1L6ZA 1RIHH 1I9IH 2RAMA 4GG6F 3CFJA 2R0WH 5ACZB 3TO4A 5IR1A 2NYYD 2BJML 3RNQB 4BKLB 3P4NA 1GZPB 5F6HJ 3S96A 1HIMH 1OTUD 2AI0H 4ZUTB 4MNQA 3KDMA 2IH3B 3PDOB 1H3XA 4OJFL 1BQUA 1CFBA 1B4RA 3VXSD 1RZIB 5EBGA 1FO0A 4JKPL 3E8UH 1DCLA 4JO3H 3VFWB 3BQUB 1U8NB 1IILE 4L4VA 1ZHKB 1SQ2N 5CJXA 5DD0L 4LOUD 4QY8B 5L2KD 4KV5E 1LGVA 1CU4H 5D8JH 3T3PE 4WHCA 3RUGE 1S7UA 4HWEL 1BIIB 1ZV5A 1MRFH 3CFBB 1G7MA 1JZ2A 4ZUWB 1EVTC 1C12B 5H94B 1OP3H 4R2GB 3E6HB 3NH7L 3SJVB 4P2OA 2XFXA 5E8DH 3L3JA 5H37H 5JR1H 3RU8L 1F3DJ 3NVQA 4HUXA 4BQCA 3LSOA 1QNZH 4QRRE 5JPMB 1A7QH 1AXTL 1VFBA 3E3QC 1CLZH 2OXGA 2Z91A 4L29B 5I1JL 2VDNH 3BKCH 4NYLB 2VLLB 1XF2B 3FT3B 1BAFL 3CXHK 1T7ZA 1WCQA 2NLJB 3ZT7A 4HH9A 3X17A 2WBKA 1XCTA 2DYPA 1OGAB 3O4OC 1ACYL 3VFOA 1IGYB 1NEZA 4M9PA 1A6ZA 4YHZH 3DETC 4QO1A 5SX5H 4PJDA 4PJHF 4U6HB 1HH6B 1P4IL 2ZUSA 2C7UA 3MRLA 3BPLC 2VRAA 1MLCB 5F97E 4G9FA 4H0GA 1DANU 4HUVA 1JHLH 2VQTA 4MXQD 4NQTA 4PJCA 1Z9OA 2SEBB 3W11C 3EGSB 1SHMA 3FQWB 4JFDA 5GZND 1Z3GL 1MFCH 2FSEB 1NGYA 4WJ5A 4IOIB 3FTGA 4QXUL 5DD3H 5EBLB 1OAYH 1UA6H 1GGCH 2BVQB 5E94A 2F74B 4ZFGL 4NRZA 1IM3B 3LRHA 1L9MA 3G08A 5IESH 3LMJL 1BOGB 3BEWA 3CFKA 4Y4FA 3N85L 3VWKD 5IVXB 4R26L 5SV4A 2Z31D 5GISH 3MUZ1 3QXDB 4QHLA 1I3RB 3HR5A 4XNQA 1I1RA 5HHVL 1WFOA 4N8PA 2LVEA 2BX5A 3L1OL 5I9QC 1T1WA 4GXVH 4XRCB 5C0AE 4TTDC 4ZFFB 5FGBC 1LD9B 5IJKA 4J6RH 4KUCD 1LEIA 5MEQA 2XPGB 4JM4L 1A4JA 4GUPA 5JQ6H 1LDPH 1T5WA 4KK8C 2DQCL 2CO7B 4X5XA 2VL5A 3DSFH 5E9DB 4YAQA 1YEFH 4H1LG 1W0VA 1MCKA 1NBQA 3HE6A 3GEWB 2VXVL 4P2QE 5CLWA 3PWLB 5CBAA 2ZNWA 4L8DA 3T0EC 1AE6L 2IQAA 1FN4B 2FEEL 5I1LB 1TVDA 1BREA 4HGWB 4XPFH 5FO8A 1KIQB 5DJ6A 3KPOB 3K7UA 1BLNB 4DKEL 1M7DA 25C8H 1UG9A 5B8CB 1QVOA 1X5AA 3RHWF 1X7QB 1BEYH 1JHTA 3UTTA 2E9JA 4TQEL 1ED3A 3QDME 3V0VB 3VXTA 1L0YA 4KAQL 5ALBH 5EPMA 2GQHA 3O3EB 3V4UH 1H15B 3G5YB 5DRNA 3IT8D 3SOBH 2A0LD 2PXYD 3MCKA 5C08D 3NFNA 2HT2C 1CD0A 2NY0C 3OZ9H 5D96C 3TNNA 1RUKL 1T1XB 2R4SL 5ANMB 4EEEA 1QSFA 3MNWA 3AREB 2DKSA 1HH9A 2XTJB 5EA0H 3I3BA 3CU1A 2IPUG 5D2NA 1N4XH 4OGYL 5FOBB 1PJ9A 4HUUB 3MRQA 3GSWB 1KUMA 3LPFA 2F53A 4KRLB 4PJ9C 2YEZB 4UILH 1NKOA 1PG7H 4MHHG 1MWAH 2EDRA 2F5AL 4WHTB 2A74B 1HHJB 4Y19A 4OZHE 2PYED 4P5MA 3MV8D 4ZQKA 4ONGL 2WQRA 4KPHH 3VH8A 2D7PA 2FECI 1U8KB 4R8WL 2ZKHL 4UT9L 1CL7H 2G9HA 5KW9H 3OR6A 2ZSWA 3QR2A 2HWZL 3PV7A 4NNXA 3WO3B 2WV3A 2XXCB 4AEIL 1CDCA 4KQ4H 4X80H 3KPSD 4M5YH 3GMMB 1FV1A 4WI6A 2O5XH 3WLWC 4FQHA 3AC0A 4G9DB 3AMLA 3ZZ1A 1RHHB 1TZIA 3QCTH 1M71B 4IMLB 3RY5A 5CIPA 1OLZA 1M6OA 2VMFA 1Q1JH 4RWHA 4G8GE 4CADA 1WJ3A 5E00B 3MRKA 3D0VB 3CDYA 3QIBA 5FGCE 4WI4A 5CHNB 3VGEA 2Y36H 4U1SA 2HFEA 3BXNA 4LNVA 4FG6D 4QXGL 4BUGA 3RUGA 2R1YA 2DQJL 3P4LA 1YECH 3GFUA 1N2RA 4H88H 4KK6C 5IHUH 3KLHC 4NT6B 3MACH 1ND0B 4G6FD 3KJ4B 4FTVE 1WBZB 2VO5A 2DQFB 3INUL 4NQUA 2BNRD 4HXBH 4MXVE 4NZUL 2X4NB 5IJVB 3F62A 4L3EE 4POZD 5FAAA 2OJZL 3P11L 4Y4KA 3BDYL 5T3XD 2MPAH 4DKFL 1KULA 4WUUB 4XPBL 4PV8B 4YE4H 5HYSB 4PJGA 1AH1A 2VTFA 4QRRA 4HKBA 2CDGB 5JHDB 3A6CH 1KLUB 1IARB 3NOIA 3CMOH 5JA9A 3BH9B 3QNYA 3HC0B 4P23A 3CXDH 1T0PB 1INDL 2UUDH 2W60A 3HI6H 4C56D 3PHQB 3CH1B 1A6UL 4NM8L 4KKBC 2IGFL 5HVWA 3IVKA 5DXWA 4G5ZH 1ZLVK 3SKOB 4UIKL 5DFWH 2CDEA 2KQNA 3IGAB 5F89B 4ORZC 2CIIB 3DX6B 3KJ6H 4G6AD 1FFRA 4DGYH 2ZUQB 2VLJD 5EZOH 4Y0GA 1DUYB 4HCRH 1I3GH 1G7IA 5GS3A 4RRPA 1J05B 2CR3A 1M4KA 5FF6A 2O93L 1SVCP 1HSBB 1FFPB 3FB5A 2WNGA 1NDGB 2EXYC 2GY5A 3HTLX 4G6KL 3D2UB 5T1MA 4HJGA 3IFLL 4OZIB 5GS1B 3VRJA 3IDUA 2BSED 3IYLW 1YEHH 4R4BA 3MBXL 5MP6L 3JSSA 4IDJH 1INQB 5E6IB 3BZFA 5D7JD 1UCBL 2OK0H 4NKIH 1BFSA 3EOBA 2MTPA 4X99B 4PJEE 2UVEA 4XCCH 3S7GA 4NM4H 1YEKH 2J6EL 4GQPH 4U49A 1HXMA 2QQNH 4HC1H 1UFUA 4OCYH 5HGHB 4J8RB 2I9TA 1BWMA 5JNYB 3OJDA 1L6XA 3WN5B 3KPRE 5C0AA 4UTAL 1CTNA 2OL3A 1D6EB 3C87A 5EU6E 3C9NB 4EQ2A 4NRXA 4Y2DD 5IBUG 3B9EA 4XXDA 1I1AD 2NPLX 1KFAL 3KXFB 3QQ3B 5IIEA 3BSZL 2P5ED 3C09C 4GRLA 4E42B 1KELH 3OXSA 4KZDL 1YY8B 4OM0H 4MQXC 3EYOB 3UO1L 2AP2A 1IGMH 2RJMA 5E8NB 2E27L 3IDNB 4V1DA 1KT2B 5SWZB 4XNMB 2XI9A 3U9UA 1RZFL 4TVPL 2DQGH 3DX9B 4HWZB 1OAQL 2CLVB 2P5WD 4WGWB 3B9AA 3JV6A 2NY2B 5FUCE 1MCJA 5F9OH 5DWUH 1BM3H