3RPBA

The c2b-domain of rabphilin: structural variations in a janus-faced domain
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
140
structure length
140
Chain Sequence
RGKILVSLMYSTQQGGLIVGIIRCVHLAAMDANGYSDPFVKLWLKPDMGKKAKHKTQIKKKTLNPEFNEEFFYDIKHSDLAKKSLDISVWDYDIGKSNDYIGGCQLGISAKGERLKHWYECLKNKDKKIERWHQLQNENH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Endocytosis/exocytosis
molecule keywords RABPHILIN 3-A
publication title Structure of the Janus-faced C2B domain of rabphilin.
pubmed doi rcsb
source organism Rattus norvegicus
total genus 21
structure length 140
sequence length 140
ec nomenclature
pdb deposition date 1999-04-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00168 C2 C2 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.150 Mainly Beta Sandwich Immunoglobulin-like C2 domain 3rpbA00
1UOVA 3DBSA 2WXMA 2WXPA 3ML8A 4L1LA 4XX5A 4F1SA 2KI6A 2Y3AA 4WWOA 3S2AA 1DJWA 2YRBA 3HHMA 2WXNA 3PREA 4KZ0A 3FDWA 4L23A 2ENPA 3PYCA 2EP6A 3IBEA 5CCGE 4F93B 2K8MA 1WFJA 2A5UA 1UGKA 3NZSA 3OHMB 4GB9A 2WXOA 3FBKA 2ISDA 1YRKA 4NS0A 2WXGA 4WWPA 3HN8A 2QZ5A 1E8WA 4EZLA 3L08A 1QATA 2N1TE 3TWYA 4HLEA 2WXJA 3IM1A 3ZW3A 2V4LA 2WXLA 1E90A 3GPEA 2JQZA 2CHDA 3RDJA 1A25A 2B3RA 4ANXA 4FULA 1TJXA 1V27A 2FJUB 3QJZA 4L2YA 4FADA 3B7YA 3L17A 2Q0ZX 1UOWA 3P2BA 4FHJA 4ICWA 4LT7A 4PS8A 2Z0UA 2ZKMX 3APDA 2R83A 2WXFA 3F05A 3L13A 3LJ3A 3N5AA 4NP9A 4QAMB 5CCHE 4ANUA 4LCVA 5JHBA 3F04A 1BYNA 1E7VA 2A4ZA 4ANVA 2DMGA 2K45A 3ENEA 4XE0A 4PS3A 2WXHA 3ML9A 4BFRA 3W56A 4KZCA 2DMHA 1RH8A 4G11A 2WXKA 4WWNA 4L1BA 3TL5A 4TV3A 1GMIA 3TJPA 4LDCA 4FHKA 4OVVA 5KJ7E 3PRZA 3F00A 4ANWA 1WFMA 4NPKA 5JHAA 3CSFA 4WEEA 1CJYA 2CHXA 3M7FB 3SD5A 2WXIA 3RPBA 2LHAA 1DSYA 1DJZA 5H4YA 2CJTA 3APFA 4FLHA 2FK9A 3R7RA 5G55A 3ZIMA 4FJZA 5G2NA 1W16A 4TS6A 4PS7A 4EZJA 4MJJA 3DPDA 4ICXA 1HE8A 3QAQA 3PFQA 3QARA 3R7QA 4QJ5B 4KITB 3NZUA 4DNLA 3MJWA 4BGDA 3QR0A 1QASA 3ZVVA 4TUUA 4V11A 5EDSA 2CHWA 2YOAA 2CM6A 2ENJA 2UZPA 4OVUA 2CHZA 4IHBA 3KWUA 3QK0A 2CM5A 3HIZA 1E7UA 4A55A 2BWQA 3L16A 4HVBA 2CJSA 2X38A 3APCA 4URKA 3F01A 4Y1TA 4QJ4B 4EZKA 4AJWA 4F92B 2WXQA 3QR1A 2RD0A 4JPSA 4QJ3B 4GNKB 2NSQA 2NQ3A 4DK5A 1E8XA 3JZYA 3KWTA 4WAFA 1DQVA 1TJMA 1DJGA 2K3HA 4NPJA 4Y1SA 1RLWA 2QZQA 1DJXA 2Q3XA 3PS6A 3L9BA 3T8MA 4FA6A 5CCJA 3W57A 2ENQA 1K5WA 3NSJA 1BCIA 1RSYA 2NCEA 5T8IA 4FJYA 1BDYA 5H4ZA 1W15A 4IQHA 4J6IA 4F91B 1E8YA 1DJYA 1E8ZA 4AOFA 2WXRA 1DJHA 2D8KA 3L54A 4XZ4A 3CSTA 3L4CA 2K4AA 1DJIA 3OAWA
chains in the Genus database with same CATH superfamily
1HHGB 5SWQA 4OFIA 4XNYL 3KLSA 4F9PC 1G9EA 3VXOB 1OT4A 4FERA 4FXLA 2OR9L 2W0KA 3QUXC 3TA3B 3O3UN 4PV8B 3TBTB 1SJEA 4KKQA 3AWEA 4JDZA 1L0PA 4Z7AA 1QSEB 4M7KL 3FT3A 1MI5B 5DVKA 2IV9A 3IE4A 4QKTA 2W0LA 4R7LA 4J7RA 5MENE 5TPWH 5I8OL 2E7DA 4ZUWA 4RNRA 1DCLA 5DA4A 1IKFL 1XB8A 3EADA 1CTNA 2ZUSA 2GBVA 1FLRL 4KK9D 4ILDA 4YSSA 4ZW6A 3SY6A 1YNLL 2A73A 3AY4C 1EMTL 1BYPA 1X9LA 2DOCA 3TXAA 4XP5L 3OJMB 1ZJAA 1H6TA 1Z9PA 4L2LA 2Q7NA 4YDNA 4JFDB 5FCSH 3G6DL 3EZJB 4HIXL 1I4FA 5LDSA 1P6FA 3C08L 3ARFC 3F7RA 3FRUA 4HP5A 2FEJA 4JJHA 2OYMA 3ENEA 5L88L 2GYSA 3GT6A 2NYYC 3C87A 1T21B 4YHMH 5D6DC 5AB2A 5T3ZH 2HLAB 3BLKA 1BXXA 4UBDD 3HE6B 4G82A 2BY0A 1AGDB 3GSWB 5CBEA 2EDOA 4KI5C 5J06A 3QEHA 4EN2A 1AJ7H 3EOTL 2OJZH 1ND0A 2QDVA 5BZWB 2VR3A 4UM8B 3CFQA 3D1MC 1Y18A 4RMWA 1UCTA 2OMVA 43C9B 3E2HC 2BSRA 1B0RB 1YUKB 3PGCA 5C0BB 5IMOA 4N8CL 4BUHA 4LVNB 1J05A 4R6UA 2EDYA 2GJJA 1NC2D 1U8KA 3ZTCC 1Q4NX 4BE5A 1SUHA 5D1QA 2F5AH 1XZ0A 5I18H 2DIAA 5B7MA 1QI5A 3RAJH 2RQ8A 1F3RB 3E6HA 1AIFA 2PCFA 5C0AA 1QLRB 4XP6H 3L5JA 3BAKA 4NN5C 4WV1A 3BP5B 4DP6X 3DVIA 3VFGL 2ZUTA 3WU1A 3BZFB 4AJWA 1RZFL 4PJFB 1IC5L 1NICA 1R24A 4JFFE 2WIIA 3Q8BA 4F7CB 3DSFH 5HDBE 1HHGA 3MLWL 1YN7B 4ZPTB 5EO9A 3PS6A 3DSNA 3VXOA 2IBBA 4Y2NA 1RZKC 2X70B 3DYPA 5TTRA 1K3IA 2QLYA 3TA3A 4PV8A 4K23H 3F7YB 5EA0L 3H42H 4KROC 1QSEA 4KJPD 1OTSD 1MI5A 4Y4FA 3ZX1A 3QPQC 2XTJE 3OPUA 4S11A 3K3QA 3P11L 4LXFA 5DRZB 4X7FC 1FSKC 1QFWM 3GSXB 4P46A 1N6VA 1WSST 2CMRH 3FCTA 1TQBC 1E50A 4MMXC 2FD6L 1HE7A 2QSCH 3S4SB 1BFSA 5K69A 2NXZC 3WFEH 4LKCB 1KCVL 4LEXL 4M29A 2CCVA 4B9IA 4D9QD 2Q6WB 2VMFA 4RISL 3HW7A 1FGVL 1EH9A 1WJ3A 4HUCA 4M43L 4XVTL 4XXCA 4JRYB 4P2RE 4XPHH 1BZQK 3N40F 1OOWA 4LP5A 4JFDA 4DUVA 4BQ8A 2NOYA 1JV5B 5I1IL 1TQUA 3H7LA 3BDYH 5L6YL 1NUNB 2MKLC 4J23A 1RIUH 4UINH 4HCRA 1T21A 1XIWB 3IN2A 3ZE1F 4KGLA 3GBDA 1WZ1L 5FGRA 5IV2B 4OGAD 1AGDA 3GSWA 4PP1C 4DO4A 2JTDA 3QJOA 3ZO9A 3W11D 2HLEB 5F6HJ 1ZGLP 2DMKA 2FYYB 5BZWA 2BNRB 1OAZH 4UM8A 3UZEC 1AD0B 3U2JA 3ZKSD 43C9A 4ZAKC 5C0BA 1B0RA 1R4XA 2WXKA 3TX4A 2FECI 3C8DA 4P4KD 4BEIA 4OU3A 4GW5B 1PL3A 4JG0H 4LP8A 3HVNA 4AQ1C 5TQ0L 3CSFA 4YJZL 2OR7A 1JGVL 2Z7ZA 2J1YA 4HYTB 1QLRA 2X10A 1WF5A 3BP5A 3FN3A 4J3TA 4N28A 1MLBB 1OF2B 4ZMOA 3BZFA 4TXVB 3ZE1B 3MV01 4PJFA 4E9XA 1J87A 3QAQA 4QJ5B 4EEEA 5B38G 1RK7A 4F7CA 4OI8A 1YN7A 3PL6A 4BM7A 4ZPTA 3DV6B 3NIGE 1A6VL 3DTXB 4OI9A 4Z0BL 1ZEAH 4BDVB 3MV8E 2X70A 4AYID 1AQHA 1C8PA 1MNUL 1MIML 3F7YA 4OLXL 1YJDH 1RZ7H 1GIGL 1JFHA 4BH7B 2EUZA 5KBMA 1T7XA 5DRZA 1E65A 2GBAA 3GSXA 3ES6B 3K2UH 7PAZA 1NFKA 3PWPD 1UKQA 2PWHA 3S4SA 4WKZB 1MCOL 4LKCA 4MBRA 4LVHB 3SQOH 1MKFA 5B1JC 2Q6WA 1KCKA 4XNMA 1DHKA 3QEQE 5IROC 1JGEB 1CGWA 4JRYA 1UXLA 5C0EB 4BFIB 1PZ2A 3FU0A 4XOCA 1L9SA 4BWWA 3IF1B 3FXIC 1CGSH 2H0EA 3UPCA 1KCLA 2RHEA 1JV5A 1DBKH 2BJMH 4ZTOH 4TLSA 4N3TA 5A7EA 3BD5A 5EUKB 3TC9A 4EQ2A 4F5CA 2QMKA 3QUZC 5KAQF 1NMAL 1XIWA 3BWAB 4JG1H 1OY3B 1JNNH 1FYTE 2IDSA 5LXGH 3BUYB 4M61B 3UG4A 4C83B 4BCYA 1TJIH 5IV2A 4PRIB 1HAWA 5DWPA 1HH6B 4N2BA 1KJVB 1CG9B 2G60L 1HKFA 2FYYA 4FXGB 2BNRA 4QDGA 5B8CC 1AD0A 2YPVL 5CBAB 3T2NH 3ZQWA 1NEPA 3Q01A 2IBZY 3FFCB 3ZZLA 4I2XE 2W0PA 4GW5A 5AW4B 4LSPH 1ETZB 1LM8V 4LNRB 1UZ6E 4EMZA 3BW9B 1Q1JL 2WTRB 1NIEA 3GMQA 4XMPL 5EF1A 1P9MA 2K45A 3B9KC 4PS3A 3T77A 1OF2A 1RH8A 3OZ9L 4IOIB 4XX1E 4N2HA 2CO3A 1NCWL 5FFGA 4G7SB 3NFPB 1MWAB 3RX9A 3N40P 4HXBL 4MJIB 4HKZB 2XDHA 3DV6A 4WEBL 4KKCC 3OKDB 1N64H 3L48A 3DTXA 4U4IA 5CGYD 4BDVA 3FW6A 2OQJB 5J1AA 3MA9L 4RAVB 3AT0A 4BH7A 4IGBB 1TNMA 2A4CA 2VDLH 3ES6A 3MYZA 1M9SA 4MB5A 1HCFX 2DTML 3OSKA 4KBPA 4OJEH 3QDJD 3ARBB 4WKZA 4YIQB 1K8DB 1WA1X 5K9JH 4ZNEE 4F8TA 1V5JA 2D7MA 2W81C 1JGEA 5C0EA 4RA3A 4BFIA 2G2NA 3OPZL 2YUZA 3IF1A 1O5PA 3K8LA 3X1NA 3MN8A 3DXAD 3T65B 3QHZL 3BVWA 3DIFB 1FBIH 1CDHA 4C56A 2X7LB 1WBXB 1DJXA 1HNYA 2BC4A 3Q2WA 1RULH 3CLWA 5MERB 3TPKA 5KW9L 4JZJB 5EUKA 3F65A 2C9QA 3BWAA 1KTRL 4ZFZB 4F2EA 3BUYA 4M61A 4C83A 1U36A 2GPZA 4PRIA 3INUL 3BUDA 5F7HA 3F85A 1CS6A 1ZANH 1DVFC 4OF6A 4U3SA 1DLHB 1CG9A 1KJVA 3BT2H 3UTPD 2ZUQC 4DVBB 2BOBB 1JDAA 2IPTL 2VOTA 4FXGA 3KYAA 4UMSA 1SQMA 4P23B 1EVUA 3UPAA 1MRFL 4V1DB 3V7AG 2NRDA 5CBAA 3DRQB 5L8KB 3P0GB 4LLYB 4TSBL 1NLBH 1HSBB 3FFCA 2C3GA 3ASNB 4FYSA 2ZG2A 5JPMC 4PRBA 1ETZA 1OAKH 4LNRA 3P69A 3O6FA 4KXZI 4NIYE 5T3XE 1T0NB 2WTRA 4AYDC 3ULVF 2DQEL 1I1AB 5J1SC 3ZW3A 2HRPL 3B5TA 4PJAF 4HEMA 1IEAB 5GGVY 4RWYL 2JJUA 4NNXB 1LDSA 4IOIA 4HOXA 3FUFA 3TT1L 1K5NA 3E8UL 1MWAA 1EHLH 5KVDH 1SF3A 4MJIA 3CBRA 4HKZA 1SOQA 2EVJA 2TSAA 4HSQA 3OKDA 1NUGA 2ICWJ 3LJ3A 1TLMA 1JZ8A 1FC1A 1BF2A 4GRLA 3QJSB 2WVUA 2OQJA 2RCSH 4ZQTA 4P5TD 4RAVA 1B4RA 3CHRA 4UDTB 2ZWNA 1ZK9A 3H9SB 4X6DA 4IGBA 3MLRH 4NQVA 4F57H 4FHKA 3SO3C 4N2MA 4YDIH 4ZODA 1DQLH 1TOXA 4JFOB 2YJLA 3ARBA 4YIQA 1K8DA 4Y5YB 1J9TA 5FW6A 5HHNA 3UADA 1N19A 3ARTA 4PJAB 4ZFFA 4Q9BA 5J6GB 1IGYB 2Z64C 2YAHA 1PNCA 5IW1B 3TBVB 2IAND 5JR1L 1ZHKB 1DBBH 2XX0A 2TAAA 3PJLA 4XO5A 3EDFA 4JJ5B 3T65A 1UM4H 3EJQA 3DIFA 4WO0A 5F3HA 3VXUE 1J8HA 2X7LA 1FUNA 1WBXA 3L8QA 5CKAA 4OVUA 1DANU 4C54A 5MERA 5CKGA 4JZJA 3D85D 1E9PA 3QFDA 1KY7A 2TSBA 3V0FA 1U4EA 1VADB 2AXGB 1QLFB 5E2TH 4ZFZA 1DDHB 2EADA 2D3LA 2XZCL 4U6YA 5KVEH 5FDWB 2WWKT 4JO2H 3HOGA 3T1FA 1WS7A 1QEXA 1EGJH 2VW7A 3VGAC 1CZ8L 1ZT4B 3N6YA 1E8XA 5BW7C 4A39A 1DLHA 1KCRL 2RH0A 1X9RA 4NPJA 1M42A 1P84K 2ITDB 2ZJSH 1JRHH 2BOBA 5D72L 4DVBA 4GKZA 1CBVH 3RJDA 3CVBA 4LSVL 3QUMH 5L2KB 3QZOA 1G6RL 1BCIA 2ESVE 3CNKA 3CXHK 3WFDL 5BMFL 1WV7T 2XWJB 4V1DA 4BXVA 4WI5A 1OTTD 2BHUA 4LLYA 4KC3B 3WOVA 3WAJA 1HSBA 3AVEA 4OFPA 1E8ZA 3NCMA 2V3EA 1TQVA 3BUBA 1U58A 2MCPH 3ISYA 5C0DB 3BFQG 5EEUA 1GVIA 1I1AA 4Y4KC 2DQIL 4JMXA 2YN5A 4UILH 5FWRA 1NAML 2Y3AA 4ABQA 4JQXC 1KFAH 3VM7A 2YJQA 3FAXA 4FI7A 4NNXA 1O9VA 4QHNB 4QRAA 2QVIA 1VESA 3N91A 5CLZA 2UXTA 4JFED 3NZSA 3WO4B 1UHVA 3KLQA 5DQDL 2AAVA 3UDWA 1RY7B 4FAAB 1UM6H 3WNPA 4X7TA 2V4LA 2AITA 3LPGA 1TZGL 1Z5YD 4YVUA 3OAUH 1B9KA 5GGRY 4EPSA 3ARXA 3U6XA 4UDTA 4H8WL 1UA3A 1I9IH 3H9SA 1AZBA 4DAGH 1U8LB 3O8XD 1PPIA 1IBBA 3QHFL 1O6VA 3P2BA 4FHJA 4JFOA 4Y5YA 2CGRL 4ONGH 1VDGA 1MUJA 3CDZB 4K7PH 4P5KB 4M48L 3PNRB 2LLGA 5AENA 5J6GA 4NCC2 1QFWI 3TBVA 5IW1A 3SGDH 1N6UA 2R69A 1T03L 4KZDH 1ZHKA 3V0AC 3D0LB 2VDPB 5FO7B 5C92A 3GK8L 4JJ5A 4AQ8A 4XVJL 1AGFA 2CSPA 4XBPB 1P6AB 1HHHB 2VC2B 4G6AD 1CL7L 1CJYA 3M8OH 2FZ3B 3HZMB 4JKNA 3DJTA 2IH8A 2AXGA 3L3HA 1QLFA 2XZQL 1DDHA 1EVTC 4HS3B 2NZ1A 5FDWA 5KZCB 1CWVA 4P2OB 2JB5L 1ZT4A 1F3DH 3UCQA 1A7OL 1A4JB 1RUQL 1X7QB 2NY0C 2AJSH 3NPSB 3G5VA 3O3EA 5I1EH 1HHJB 1ZRUA 5L2KA 1A6AB 4LCWA 1IBFA 2XWJA 1D9KD 1RUPH 1WPCA 4Z0XB 4N2IA 2NXYC 2ITCA 5EBMB 2AEPL 3TU6A 4PGJA 3LN9A 4HGWB 2JKLA 4LNVA 1JZ6A 1ECZA 3UG3A 3AS2A 4R7DB 4RLDA 2W1NA 5I5IA 4YFLF 4Q7DA 1X5YA 1E4KC 1YJDC 2ODHA 2NT1A 3SBQA 1A66A 2NY7H 1QHOA 4QHNA 1RIHL 1EQWA 3WJMA 2ICWB 1CI5A 1PZ5A 5F9JB 4FD0A 1ILUA 4RX4D 4J4PD 2JLLA 2WNWA 4AGNA 2M8XA 3IDXH 2EDKA 4O02B 2HH0L 3TPUB 1NEZB 1T3FA 3DO4A 4O2FB 4Y1AD 2D0FA 4AV5A 1IJ9A 1JMZA 2F8VA 3FT2A 4A1RA 1U8LA 1A14H 3D39E 2JELH 4PJ5B 5DMGC 2AQ2A 4RMRA 2APWA 1NDTA 1L7IH 3B7RL 3QRBA 4GB9A 4JFZH 4PRPD 4W9IC 4WWPA 2VZ3A 5SWSE 5I9QC 3U4BH 1E6OL 4NNYB 3CDZA 2WXJA 3GMNB 3IM1A 1ET5A 1A9EB 1MY5A 3LKQB 3OTTA 3QB7C 4NHCL 4P5KA 4ZW7A 4DGWC 4YHNB 1A9VA 3IKCB 3EFOB 1GC1H 2WQSA 4AGPA 3VGHA 2WP3T 3M1BB 5FO7A 2VXUL 4Z7OE 3RTQD 1TJXA 2PKDA 4L5FL 4DPAX 9PCYA 4M1DL 5D70L 4NQED 4XBPA 2KKQA 1HHHA 3H2QA 4HC1A 3POHA 3BWUC 3IU4L 2FZ3A 3AG3B 3HZMA 2MNWA 1F86A 4DKEH 1X3DA 5DURD 1R1CA 4ZUVB 1WISA 4UTAH 1SVBA 3IJHB 1T22B 1RU9H 3QZLA 1I8UA 2EINB 2R1YB 3JXAA 4J3OD 1ZVYA 1UA6L 2VMJA 4G3YH 1CI3M 2HTLC 4P2OA 2AMUA 1UWYA 3FBQA 5D96B 3C6LC 4FZEH 1A4JA 2GSIB 4HCRH 1X7QA 3AXHA 4PGDB 1ZLDA 4HX1A 3QUXD 3IGAB 1JYNA 1HHJA 1WA0X 1XEUA 1KDIA 1LK2B 3QWOB 4MHHG 3R19A 3H3PL 2A3TA 4YXKL 5BS0B 2Z65C 5C9JB 5I73C 1TQWA 4U1JA 4XP9H 4Z0XA 1FWXA 4MA1C 3AITA 5EBMA 5AALA 2XG4B 2XKNB 4HGWA 3PCYA 3K2MC 3V4LA 3HG3A 3P4LA 4JE4B 4R7DA 5EG6C 4NJ9H 3QDMD 1WBYB 2HXAA 4S2SB 2Z7YA 4WI7A 3SOBL 5E7BA 1L0YA 4UI2A 1FLTX 5AW0B 5F96H 3N0PB 2BWQA 1D5XB 1RUKH 2E9WA 4YL4A 4URKA 5ANME 2ICWA 3DIVA 3OSVA 3LN4A 4LPXA 4UZUA 5F9JA 4OT1H 1OM3L 2XXCB 3OKLB 4RESB 3ARFD 1RLWA 4O02A 5AOJA 3HAEG 2NYYD 3TPUA 1HJBC 1NEZA 3SJVB 2OYLA 5JDSA 4PMFA 4M6NL 4O2FA 3UTSD 1S3RA 2WJ7A 4JL2A 2UV3A 4L4TE 3PQYE 4N68A 3VNZA 3S9DB 1JCVA 2D3VA 5HHXH 5IOPB 3ZRCC 3KPRE 3JZ7A 3K5RA 3K2IA 3KHOA 1TR7A 4NNYA 5EBWB 3KE0A 2I9LB 3GMNA 4IBQA 1A9EA 1MCHA 3LKQA 4YHNA 3H6JA 5HHVL 3QXAB 2IAMC 1DJWA 4QXWA 3IKCA 3HHMA 1BXAA 4GBXB 3EFOA 3ABKB 5I8CB 1SVZA 3M1BA 5E1AB 4WY7L 4MJHA 1NL0H 4HFUH 3BRDA 1PVHA 5I0WA 3ESNA 4IBYA 5HD8D 3VWJA 1LO4H 5C08B 1NCOA 4DOHB 4RSYA 3DYOA 1M6UA 2Y0SA 4ZUVA 3DVNA 1N5YL 3QQ3A 1T22A 1ERNA 3MBWB 5F89A 3WY1A 2Y24A 2I9TB 2R1YA 2K3TA 3ZYIA 2W59A 4W9LC 4HGMA 1FE8H 2AHIA 4PREB 2ZAGA 1JHKL 3BD3A 4QRRB 2AKRB 2KZ1B 3BPLB 2GSIA 3MOQA 4Z76B 4PGDA 3WKNA 3IGAA 3V6OC 3OC8A 3WDJA 2EDEA 1LK2A 4KROD 3QWOA 1XXDC 4IRZH 3KNBB 1QHPA 2X2IA 3ORJA 2OTUB 3QQ4A 4WNSA 5EBGA 5BS0A 3QPQD 2Y7OA 4Q2ZB 2EUWA 3L3OA 4WHDA 4X4XA 3CQPA 1XL4A 5GRZA 1RZIB 2XG4A 2AABL 2XKNA 4AK1A 5DGRA 3VD2A 4F37F 1AKPA 3CG8A 5GPRA 4ANKA 3IFOB 3RZCC 1WBYA 2NXZD 7FABL 3F58H 4S2SA 1QZNA 1UKTA 25C8L 3CHPA 3VYNA 3MUJA 4N1HB 2FX9L 5D7LE 1D5XA 3Q5OA 3RYMA 4B5EA 2ZUUA 4F58L 3NQIA 5F1NB 1P53A 2GHZA 4JO1H 4QXUL 2CO7B 2AVGA 4OKVB 4GP4B 2F0CA 3D6GA 4K3HA 2A38A 2CALA 3HC4H 4JHWH 1LO2L 4PB9H 3MRRB 3D34A 4S1SL 4MX7B 2QQLH 1OT2A 1NCCH 1TZAA 4AV4A 3O6KL 2APSA 4RMSA 1MW0A 1WFOA 4PP1D 2C3VB 2A9BA 2D9CA 3QIUA 2BRRH 2EDTA 1OP5K 4C59B 4YHZL 4HJTA 1UEYA 2Z31A 1XD1A 1TJHL 3BH8B 3QIBB 4CBPA 5EBWA 2I9LA 4XNAA 5D4HA 1CLYL 3ZL1A 5E23A 4ZAKD 5F21B 4EOWL 2QR0B 4GBXA 3CPUA 2O4EA 5CEXB 4YSEA 4FQHB 5I8CA 5E1AA 1QYGH 3KPSE 3P54A 3MPCA 2DI8A 2H8PB 4HUXB 3A47A 4H88L 3GHBH 3G08B 5DMYA 3OAWA 2VQ4A 3QULA 5MENB 1LO5B 2EDXA 5C08A 2YS4A 4EN3C 2DQDL 2P45B 1XF5A 4K5MA 2I9TA 2L3BA 3C5ZB 5F7EL 4HJ0C 3WG7B 4TVPD 1DO5A 1KLUA 2FX7H 3FQ2A 3O0RH 2Z93B 1YHPA 3IBEA 4PREA 3NABH 1H8NA 3RA7H 4ERSH 4QRRA 2AKRA 1HSAB 2UYLB 3STZB 4H1LB 2QPDB 2ZKHL 4OFVA 2Y6TE 5ID1B 1TENA 3BIAX 3CHQA 1WIPA 1JZ4A 3GJFA 1FZMB 3KNBA 2G3NA 4FQ2L 4Q2ZA 1RAMA 3CZLA 1VCAA 3EO1B 4ZFGH 1RQ5A 1RZIA 4HAKA 2OMUB 2VR7A 2VDMB 3QJZA 3IFOA 4LOFA 3L17A 2XXFA 3MRKB 5IB3B 3HBQA 4QAMB 3ZT7A 2J71A 2DJSA 5HDBF 2PYEA 4BZ2L 1MCIA 2BXYA 1D5BB 1LO0L 4O2EB 3SQBB 5IROD 3I50L 3WTWA 1LDPL 2X41A 4URTB 3OKMB 5JO5B 3EDEA 1QBAA 5F1NA 2AGJL 4GAYB 1CXEA 4BJLA 1JGDB 1QTYT 2CO7A 3UBXB 1JYWA 4BQBA 2IVFC 4OKVA 3UTTD 3QQDB 3QUZD 4ZX4A 3PHSA 1MWAH 3GMPB 3MRRA 4EI5A 2F7RA 3QH3B 3VFNA 4N2KA 5DHVB 3ZYOA 5A2KH 3TT3H 5AVVB 2C3VA 1JXDA 2ZOWA 1I3RB 1N68A 4QRPD 2ZCLL 4K7FB 1T66C 3KYKH 4JGJA 1I8LA 3BH8A 3BMWA 3M46A 3QIBA 3VD0A 4JFFB 3ULSB 2CHWA 3SYOA 5FO8B 5HDBB 4KQ3L 2DLTA 1RZKL 2QR0A 3OF6D 3BE1L 4ETQB 5C07D 2VLLB 2QQKH 4FQHA 5KVGH 4GY4A 5IY5B 3APCA 3OGOE 4AT6B 5IWLA 4QJ4B 2LAAA 2QVTA 2E7LC 2JNZA 4HUXA 3EOYG 5IFHL 5LGKA 1E5AA 4AVIA 4G80B 3G08A 1YEGL 3HA0A 2XTJB 1LO5A 3MOBL 5GISL 5MENA 1NLDL 4WQOA 3B9KD 1FZJB 2WQXA 2QFPA 5H35B 1M7UA 3WY3A 3GJFK 3C5ZA 3EH5B 4U6VL 1OP4A 5FK9B 3GIZL 5IESH 2CR3A 1BAFL 2Z93A 4JPKH 3THML 3WSQL 3MV11 2CBOA 1HSAA 1OGSA 2UYLA 3FQNB 4G8IB 4H1LA 4JFYB 3STZA 4P2RB 4TNGA 2GI7A 1QLEL 2R51A 4XH2B 5F7WC 3V4VB 4X9YA 4W6WB 5ID1A 3SGJA 3P2TA 1AQKL 3T3ME 3UOAB 3N42F 4I48B 1FZMA 1K9TA 2QPEB 3C8KB 4WWOA 3SY0B 2WXNA 5D1QC 3CFNA 3HMXA 3VD5A 5LCVA 5FFOA 1JAEA 3EO1A 2ZXCA 2OMUA 3KBEA 2IWGA 3ROLA 4F93B 2PWGA 2YUVA 3QCVH 2GJ6E 2AMGA 4WV1C 3TFBA 4LLQB 5IB3A 3MRKA 4BK8A 4AVHA 5ESAB 2GK2A 1W9XA 2DQCL 3UP6A 2DD8L 1D5BA 1JTPA 1TVBB 3NIGF 4TVSa 5TDPB 5I1JL 2YMXH 2NX5E 3W3BA 1KEGL 3OKMA 5JO5A 2K7QA 1RCYA 1DJSA 4R0LB 2BK8A 1QWNA 3P9WB 1MVFA 4GAYA 3TA3C 3VGFA 3ZGIA 4F37K 1JGDA 4R90H 3UBXA 4Z1PA 5ILTL 3DHMA 1ZWIB 4O9HL 3QQDA 4Y4FC 5FGCE 4E41E 4GG6E 4R8WL 3GMPA 3N42B 1ZDQA 2UWEA 5AWNH 3BAXA 4ANVA 4P46C 3LNEA 4PI0A 4F8PA 1GC1C 5F7FA 1ZLWK 1DVFD 1I3RA 3EFDL 5GSVB 1TTCA 1NKOA 1BJ1J 4TVPL 4PN6A 1F1AA 4BFKA 1EJOL 4XXCC 5HGBB 3ULSA 1YEIH 1SM3L 1E6JH 2Y36L 2X89D 5TFSH 4TLUA 2CU9A 4L3CB 5DD6A 3NIGB 1FZOB 2HUHA 3QRLA 4I0CC 2OXGA 4ODHH 3FRPB 3MV8B 2DL9A 3ULVH 3NOIA 3S3SA 4AQOA 4AT6A 1J8KA 4ZOEA 5D6CA 3U7YL 1IQWH 3K6IA 4YSAA 3PFQA 4WI0B 3HI6H 3U4EB 1PF3A 3NCYS 4DQOH 2R69H 3GSUB 1NBZB 4TRPL 4LGPB 1FZJA 1LQBC 1BD2E 3BN9D 3QHTC 5HHMD 5H35A 2GBTA 1QFUH 3MFGB 2X40A 1A6WL 4BUGA 5CCKH 3QG7H 3QEQB 4JPWH 4G8IA 4JFYA 3FQNA 4U3CA 1MCFA 4XH2A 3DDFA 3V4VA 3G04A 4YMPA 4LVNC 4XZUB 4U4BA 4I48A 4RGOH 4Q89A 1WCQA 1UZ6F 1SLXA 3BT0A 1DBMH 2F8OA 4PYGA 2WN3A 2ZKYA 5I0XA 2Y2TA 5CR1A 1NTDA 2E46A 1FYTB 1KYUA 4LLQA 2DL2A 4MRCA 5ESAA 4NWUL 1RUMH 4S1RH 2WXMA 1X5JA 1P7QD 4Y2DC 5EIIG 1ADQL 1TVBA 4KRPB 5T3ZD 3F62A 5TDPA 3PL6C 3I6LE 4XPTH 1UUSA 4YDKH 2CAKA 5D7SL 3KMDA 2MPAL 2KPWA 2GG1A 4R0LA 1J5CA 5F0JB 1ZK5A 1I75A 2BW5A 4JHVA 1EHXA 2CPUA 2WXGA 3CJJA 4I2XB 1TFHA 4NS0A 1IEHA 1SUJA 2W80C 1T1WA 2OCCB 2HJKB 4MDJB 4BKTC 3QPXH 2OCJA 3VXRE 3K4AA 1TTRA 1NCUA 1BZ7B 1Q9KB 1YQVL 5IEKB 1YN6B 3QE5A 4ETYA 5ABDE 5DF0A 4V33A 5GSVA 4DP7X 4LIQH 4XNDA 3VWKC 4HULB 3UJIH 5HGBA 2DQJH 4LCYB 4RMQA 5B4MD 3ZZQA 4XCEB 4D2NA 1FZOA 3NUKA 3S5LG 4M9PA 2JKJA 3FRPA 4LVEA 3MV8A 1VFAB 4RFNB 3EGSB 4HK3J 1M9WA 12E8H 5TJWK 5IF0B 2DZEA 5C1MB 4HD9A 4HSAC 4WI0A 1NCTA 4Y4KD 3U4EA 1T5XB 1USQA 3GSUA 1NBZA 4D7PA 4I5BB 2VDPH 3FQRA 3GNMH 4W9JC 5J1TC 4PUBH 3VU1A 5F88B 2JIXB 2C3HA 3ARED 4HC1H 3QJFB 1TYRA 1BQHG 1XGUB 2DBJA 5A7BA 3QEQA 3NAAH 3NCCB 2H1PH 1PDKB 3IN0A 4FABH 3DK2A 2DYPA 3BZEB 3DX7A 2DEWX 1ULVA 4OLZH 1I8IB 1EO7A 3WKMH 1PLAA 4ZYKB 3HC2A 3L2MA 4XZUA 5ADOL 3C5JB 2LQRA 5JW3L 5IBUG 1V55B 1AZRA 2VWEC 1WEJL 2G5BA 1GZQB 3AMLA 1FNEB 3BIBX 2UVEA 4HAFA 4KDVA 1G87A 1IAMA 5EZLB 1Z3GL 3RWIB 3GSRB 4AYEC 1BQSA 1FYTA 1RVFL 3GXPA 2OS7A 1MAMH 2X4UB 2F7QA 5C7ZA 1SZNA 5D9SB 5F2FA 3II3A 2AQ3A 3T0VA 1CL7I 3VB8A 3DHUA 4UOW1 2XWTB 1T7ZA 3WFCH 2AS5M 4NOFA 5D8JL 1BEYL 5DD3H 2LE9A 1ADWA 3S35L 4I3RL 5EOCJ 3V0JA 1S7TB 4WGWB 2HVKA 2JH2A 3IPEA 2VR5A 5DFAA 3QZWG 1T89A 4XPAL 1M3IA 4ZRGA 4I2XA 5AZ2H 2GIXA 3OJ2C 2DMCA 4MDJA 2LT9A 4PW3A 4IW4C 1Q9KA 1BZ7A 2V8LA 4P2CG 5BVPH 5IEKA 1YN6A 2PW2A 4O02H 5I6PA 4ISVB 4LVHC 4PBDA 2NY0D 2X0UA 5IHLB 5TPWL 1C16B 3BRGC 4F2ME 4LCYA 5GZOA 4UQ3B 2W94A 2XBTA 4XCEA 3Q8EA 3LKPA 4HEPA 3DOSB 1VFAA 5T1DH 1T04A 1HDMB 2XU9A 4NT6A 5AOZA 3EGSA 4LAQH 9CGTA 4OJDH 4NZDA 2X2JA 4Q6KA 3WTUA 2Y25A 1FH5H 5IF0A 4W9KC 4JEGB 4NGHH 5H94B 4LLMB 1T5XA 4IIQB 3RUGA 3O3DB 2F53E 4I0KA 2KUTA 4I5BA 1OP5H 3RL1B 3F05A 4FQ1H 1MDAA 4YOKA 4ODWB 3NJFA 2X3AA 3EBAA 1QVOB 5F88A 2AXFB 2JIXA 1ZLVK 5HYFA 4ZNEA 2FAUA 3QJFA 3B5GA 1XGUA 4YHML 5T3ZL 3SZ6A 4FXGC 1PDKA 2UZYB 3BZEA 3B2MA 1KB9J 2G9KA 1M1XB 2VLMD 1I8IA 3FYIB 4GO9A 2NDFA 2OA9A 2WQWA 4ZYKA 3N1GC 3VXUB 3FUDA 1KYOJ 2LABA 1AJ7L 2OJZL 5FUOH 1GZQA 1FNEA 3MV9D 3O6FC 5EZLA 3RWIA 4Q14A 3FTYA 3GSRA 3OAYK 4GKNB 4JM2F 5K9OB 3F5WB 3GYRA 2X4UA 4G6FB 5JHDE 5JORB 3LV3B 3MRGB 5D9SA 3T6WA 3ARWA 4K4KA 1W8OA 3RX8A 2EEFA 4JBSA 1UZGA 2AZAA 2F5AL 5I18L 1ZV5A 3FB6B 2XWTA 1NGZB 3ET9F 3TURA 3RAJL 3D25B 2R59A 1VACA 1YECH 2WCGA 1BG9A 4LSSH 4XP6L 3QEUB 1JJUA 2ESVB 1HINH 4GRLC 1S7TA 2Z3FA 4MNQE 2YD7A 4N90D 2OMYB 4YC2B 4LSRH 3JBG7 2V3DA 2Q2LA 3ROOB 3DSFL 4HUWB 1N9PA 3LNDA 4FYTA 4IGBC 2XPYA 5E08H 2Z6FA 3WENA 3AJ7A 2A77H 2Y1ZA 1ZY9A 4K23L 2HTLD 3SDXB 3ARBC 3H42L 3Q2NA 2R1XB 4N2FA 1R33A 1UURA 4JM2B 3W39A 4ONFH 2VMCA 1C16A 2GJRA 4YSQA 2KYIA 1MG3C 2XWEA 5C09E 4UQ3A 2CMRL 1XTLA 3REVB 3RWJA 2QSCL 2X87A 5AZEH 3DOSA 3WFEL 2OSYA 3F64A 1HDMA 4P99A 3F8UB 1KPUB 4OF8A 2WMPB 2ATKB 5FR3A 4AUUA 4XPHL 5H94A 4B9PA 4LLMA 2DWDB 2OMZB 1R75A 3O3DA 1GRWA 2AVFA 1D3CA 4L29A 3CDGB 4JHAH 1HS6A 1MAJA 3RL1A 5K5YA 3BDYL 3MRDB 4ODWA 4G83A 4Y19B 1QVOA 1RIUL 4UINL 2AEWA 2UXFA 1Q90A 2ATPB 3ZTJG 2WYTA 2UZYA 4UF7C 3KGRA 4IRSB 1ORQA 1SXNA 4N4YB 2FJUB 1UUNA 1M1XA 2V2XB 4AE1A 3UACA 1TZIB 1I9EA 1J86A 4D94A 1Z3RA 1FRGH 2BM3A 1QKZH 2X4NB 1I53A 4KXBA 4HG4J 1OAZL 5LO7A 5E1GA 4Q0XH 1I1AC 4QOKA 4GKNA 2F7OA 5K9OA 3F5WA 4NZFA 3GJFH 4GO8A 2X4TB 5E03A 5JORA 4GUOA 4WTQA 3LV3A 3MRGA 3P77B 2BCMA 3AS1A 4MB1A 4JG0L 4HPYH 1IGJB 3FB6A 2VDRB 2IAMD 1NGZA 3ZTDC 1FJ1B 4XN8A 5D1XA 1XT5A 1A0QH 3QQ9C 4IEFB 3QEUA 3UDWC 2B5IB 4XBEH 1MW2A 4CBZA 4MZ3A 1KLGB 3RNKB 2OMYA 4OV6F 4XAKD 5I19H 2EYRB 4CJ0A 2C9VA 3ROOA 4NN6C 3S34H 4HUWA 5H37G 3BGAA 4Y88A 2O6DA 1ZEAL 5D7KE 3X11B 1CFMA 3BESR 3DARA 3ULVC 3SDXA 3GS0A 2BOCA 1YJDL 2R1XA 4Y5YC 1RZ7L 4N8UA 2NW2B 3T08A 1Z5HA 4TPRH 2H2PC 5E9DD 4Z7VE 4M62H 2HFFB 5MHSD 4DN3H 1PTZA 5DJ6B 1RJLB 3K2UL 4Z7OF 3REVA 5KN5B 3LRGA 2HMIC 4L1DA 5DSCB 2QZQA 1HU8A 2LFEA 4AQ8C 4TQ8A 1HILB 3SQOL 3IAPA 1OE2A 1KPUA 2NSMA 2WMPA 2ATKA 4N0RA 3RZCD 1IT9L 2DWDA 2OMZA 5DTFB 3NFNB 4FQIH 4OW6A 1CGSL 4FI8A 5AW6B 5GGRB 2BJML 1DBKL 1ZLWH 3CDGA 2KH2B 3NYKA 4GXVH 3QJUB 4ZTOL 3MRDA 1MFAH 2DIBA 4Y19A 1ASPA 5SWSB 3D50A 2AXHA 3F2LA 3VFOB 1AS6A 3KL5A 1H19A 3D3VD 2ATPA 4JG1L 1JNNL 3L9RB 2VMEA 5LXGL 3UIYA 3LXCA 1TJIL 1Z6JT 2VN6A 2YD8A 3MUY1 4Z7OB 1KJMB 1TZIA 2CRMA 2FBRA 1CK0H 1T0OA 4HBQA 4NC1C 3S3DB 3NFSH 5B21A 4FLSA 4WFED 4LCUB 4GUCA 4H1LH 5EU7C 3WHE0 2A6IB 2JJWA 3HG1D 4UV4H 3NBNA 4ORZC 3T2NL 3WE1A 4J8RB 2BVOB 3WXWH 2I7SA 2X4TA 3P77A 1SDYA 5E2WH 4JUTA 1IGJA 3HMXH 1MCNA 5DJXA 4B27A 5K9QI 3NIDE 1EBAA 1FJ1A 3VFMB 4WO4B 3WO4C 1Q0YH 4XNZB 3S3CB 4POYA 4IEFA 1A6TB 1E7VA 3GXDA 5CU9A 4CNIA 4OD2B 3S35X 2VSDA 2P8PA 3RNKA 5I17B 2OK0H 4LLVB 1NIDA 2EYRA 4U6HB 1TTBA 5C8JB 2HYMA 1EXUB 5EH1A 4EN3D 2CBPA 1N64L 4OB5H 4QRBA 3W1ZA 3IJ9A 4EKXA 4HJ0D 2WLKA 3P1VA 5FM5O 2EVFA 1M1SA 3X11A 4M8QB 2VXTH 2NW2A 1G9MH 8PAZA 3MRCB 1EFXB 2YWYA 1FN4B 2HFFA 4HIHA 3TCXA 1Q0EA 5ANMB 5A43C 1G7PB 2VDLL 1R3JA 1RJLA 5C2UB 3LKSB 1QW9A 5DSCA 3CSYB 5GGSY 5K9JL 5C7XH 3MQIA 1HILA 1LLAA 3WFZA 2B39A 4XN4A 2O1AA 3MFFB 4OF5A 3SPVA 2BPBA 1E3ZA 4GSRA 4TL4A 4N2OA 4L4TB 3PQYB 5DTFA 3NFNA 4XVUC 4QJ3B 3KDPB 1UFGA 5CJ8A 1HL4A 1FBIL 3T4YB 3UTZB 1XD0A 3FT0A 3KPRB 4MZIA 4X5XB 5SWSA 1RULL 3VFOA 3NPSC 4POUB 5D1ZI 3IJEB 1EERB 2PO6B 3L9RA 4U6XB 3RG1C 5JZ7C 3FU9A 4AOFA 3HUJE 5IVZB 5DU7A 1ZANL 5CJ5A 3JWDC 4J1UB 4BKSC 1A6PA 3BT2L 3HE7B 4LCUA 4C4KO 4YBHA 1NCJA 3TYGH 3V10A 3HRPA 5TGBB 2A6IA 3S2AA 3V4VH 3RQ3A 3IDYB 1T66D 2J1KA 3K6SB 2NNAB 4J8RA 1NLBL 2BVOA 1XR9B 5DZOA 1PX3A 3EG9B 1VSCA 3KXFA 4FS0A 1U33A 1OAKL 1J48A 1NBVH 4AVJA 4WO4A 5HVHB 3H1ZA 2IPUK 4OD2A 3A21A 4TNVF 1TTGA 4XODA 5SV3A 4RRPG 5I17A 4LLVA 2O5XH 5C8JA 1EHLL 1GOHA 5KVDL 2LLNA 1EXUA 4L18A 4U49A 3OZKA 1ZHBB 3HBZA 3SDAB 4IBSA 4MQXC 1O6SB 1PZ3A 3TO4B 4PTTB 3PNWB 1JV2B 1UXMA 3N5AA 5C6PB 3X12B 1JCKA 2RCSL 4X7DC 1U3ZA 4JY4A 4M8QA 4FQPA 1ONQB 4M3JA 4OLVH 4NKOB 2DQGH 1EFXA 5D7LB 1ZS2A 1FN4A 3GXTA 5JHMA 2WUBH 1OM9A 4WNJA 5I6MA 5ANMA 3MLRL 4AYGA 1G7PA 2Q20A 3EYUH 4F57L 1JNHB 2CKBB 4XP1H 4YDIL 1DQLL 3LKSA 3KD4A 1NSNH 3CSYA 2R2HA 5D1QD 3QDGE 3DX8B 2P47B 3KWWB 3MFFA 2ZX9A 5ICYB 1R3LB 1U3HB 4Y16B 5C0AD 3ZU8A 3VWJC 1KB9K 4XPFH 4M5ZH 1FG2B 4AC4A 3PQYA 1AHWA 1WAEA 1DBBL 1WLHA 1JXGA 4BBWA 1UM4L 4N0CC 3UTZA 3LKOB 3QR0A 3T4YA 3LIZA 1FL5B 5EDSA 3KPRA 4MQTB 3BWZA 3FUIA 2F54A 4X5XA 3S7GA 3VSTA 1NFAA 2F9BT 3HIZA 2QGEA 3IJEA 4P8QA 3TA3D 5E2TL 2L7UA 4U33A 5KVEL 1QSED 1ZE3H 1MCQA 1MI5D 4JO2L 4JZOB 4Y4FD 5IVZA 2KZKA 1EGJL 3VW3H 1JL8A 3D06A 4G71B 1C8QA 3L3OC 4OM0L 3BKJH 3KPSB 4J1UA 3UTQB 3HPLB 3MCYA 2ZJSL 1NGWB 1JRHL 2J8UE 3ARPA 4P46D 3WEBA 1CBVL 3BVXA 1U2HA 1X7TA 3QORB 4X6CE 3SGEH 3VH8A 3TV3H 3QUML 1HKLH 1HQ4B 5TGBA 2IV8A 5ABZA 2EECA 2H7WA 3C2SA 3TH4T 2CK2A 3K6SA 1QMUA 2NNAA 5DLLA 1XR9A 3WY2A 1YPZE 3KJ6H 2GK0B 2IAAC 5CSBA 2ZSWB 1L6PA 1ZLVH 1IKOP 2MCPL 1UXWB 4JFDD 4XCYB 4OZFG 2K9UA 2IG2H 1NBYA 4I0PB 2WTPA 1J10A 5IUSA 1KFAL 1AD9B 5EIQA 5ERWB 2HCZX 1JFQH 2VDQB 4FJ6A 4P9MH 2EP6A 4A67A 5AAMA 5D71H 5IG7A 5JIIA 4OQ1A 4DUWA 1ZHBA 4TSCH 3SDAA 3OQRA 1O6SA 3TO4A 2NYKA 2Y07H 3OAYH 3PNWA 4PTTA 1UM6L 3QIUC 1JV2A 4AKQA 2EDRA 3X12A 2Z31C 3L4ZA 4KX7A 3OAUL 2CR6A 4OJFH 1ONQA 4PRAB 4W9FC 1XF1A 4B97A 1I9IL 4NKOA 2N01B 4UIKH 1FAKT 1QABA 1F2XK 5D7LA 1ZA3A 1G4MA 5AEAA 4FNPA 5C0BD 4DAGL 1BBDH 1BIHA 1SGKA 4YXLH 3RWGB 1JNHA 5LQBH 4N20A 1M7XA 1HHKB 4GI8A 3O4LE 1INQB 4QLWA 2ADGA 4ONGL 5ISZE 2K70A 3KWWA 4K7PL 5ICYA 3TVMA 2A4ZA 1U3HA 4X9HA 4Y16A 5F9OH 3EBGA 4HZLA 4KZDL 2GI0A 2AC0A 3Q0HA 4QXGH 1D5RA 1N8ZA 1M6OB 3DMMB 3MUGB 4JR9H 1NA8A 1IC1A 4JJOA 3LKOA 2W65A 3L5WB 5FDYA 4FN0A 1FL5A 5DO2C 3PL6D 3GRWA 4ZO8A 1NWPA 1XXFC 3M8OL 3Q2CA 5EZJB 2EDHA 5A2FA 3I3BA 3T3MF 2Q76B 2VCOA 3QO0B 4DEUA 4PGBB 5C0CA 1BF8A 5HYQB 1Q9LB 1MPAH 5DRNA 2J88H 4LOEA 3FU7B 4KXZH 2MCG1 3F83A 1HOCB 1N3NA 4I1PA 3KPSA 3UTQA 3HPLA 2AJSL 1NGWA 2E76C 4ZMXA 2D7TH 4FFWC 5I1EL 3QORA 3VFVB 1NGYB 1HQ4A 5LBSA 3CN0A 4GQZA 2CM5A 4GSUA 2FBJH 5A6IA 1M05B 2XN9E 3FTVA 3FQ4A 4FYRA 1RUPL 4JY5H 1Q94A 1ACXA 1MFNA 4JRYD 3WE6B 3DI3B 2ZSWA 1FVDB 3BLBA 1BP3B 4DK3A 3AG2B 4YZFE 1UXWA 2VXVH 4XCYA 3REWB 3GS4A 5E6IC 4I0PA 5LB1A 4GG6F 3T3MB 5KSAB 5ERWA 1ZTXH 4AUYA 5EHFA 2NY7L 1XIWD 2NUTB 4TQPA 3R4RA 1D5ZB 4GSQA 3IETB 4EI5C 5ADPH 3SPJA 2GB2A 4FTVE 3SQRA 3EHBB 2GJ6B 3IDXL 1SHXA 4PLJC 4ABVA 3T0AA 2L7EA 4OSUH 1I8LC 3QIBC 2QBWA 2O5ZH 2BNRD 5K59E 1OPOA 2LU4A 5FWQA 4FF9A 5C6TH 4ZO6A 2GFBB 1A14L 2NX5B 2JELL 4KQ4H 3V2AR 1WFNA 4JFZL 1L7IL 1BJ1H 2H47C 3PXLA 1HHKA 3RX5A 3U4BL 1INQA 2AK4A 5EPMB 3UROR 2AQPA 4H13C 5HDWA 3Q5TA 4MTMA 5FGCB 5DMKB 4E41B 4GG6B 1B2WH 4MBOA 1MELA 2YUWA 5E24E 3IMUA 5T5FA 1GC1L 4NQUA 5EOQH 1JTOA 5HYSB 4JQIA 2YD2A 2JKNA 1EAPB 1X5IA 3C5ZC 3DMMA 3MUGA 1D5IH 3L5WA 2A9NH 1E27B 3GBMH 2LU7A 4OZGE 3CHSA 4H2CA 2DICA 5EZJA 3MRMB 4ZMLA 1AC0A 4OIFA 2H6OA 3Q8CA 3ZZ1A 4ZMZA 4DKEL 3MLXH 3GBNH 3KVDD 1G6VK 5EUOA 3SOTA 3VYOA 4UTAL 1DEDA 3GZKA 4PGBA 3C2AH 1D5MA 1RU9L 1J1XH 5F7NC 3SGJC 5HYQA 1Q9LA 1BYOA 3FU7A 4G3YL 3A4DA 2H26B 1W0WB 2XV0A 3PXHA 4GUPB 3WO3B 2OAAA 4FZEL 4HCRL 2YLKA 1UKSA 3RY4A 3NACH 2BS8A 3VFVA 1QI3A 4TNWF 1NGYA 4MRBA 3AY2A 3PPEA 1BD2B 3DX9B 1HYRC 3HC3H 4XP9L 1YUHB 5K1NA 3VM5A 2VR6A 2OI9B 2BINA 3WE6A 1FVDA 1KF9B 4W4OA 4NJ9L 2MWCA 2UZXB 3REWA 3VX0A 4YLBA 4C56D 5I1LA 1C7TA 3TBSB 1TEFA 4E5XG 1KZYA 3DGCR 4X4MA 2R27A 4Z6AT 1FFTB 5KSAA 5F96L 1Q72H 4ZMVA 3RY5A 4LKXB 2EO1A 1G9MC 1RUKL 2NUTA 1GYAA 4Y89A 1D5ZA 3JWNG 4AGOA 4BXSV 3IETA 3WTVA 1A65A 1YYCA 1X4XA 4OT1L 1AO7A 2MQCA 4PRID 4BQ9A 2A99A 3LD8B 4I3GA 2GJ6A 4HCGA 3QYNA 2AXJA 1IJNA 2B0SL 3PAZA 3SYQA 5CCJA 3MGAA 4DFHA 3SIKA 5TD4A 4PJHA 2GFBA 3UMNA 3KLDA 4L05A 4OLUH 4CN4A 5HHXL 4OLWH 3PWUB 5CUSH 3HAEB 3MX0B 1GYWA 2N7BA 4OR1A 4DN4H 4GMSH 3PFUA 4MFHA 2ZWKA 3GXNA 4R9HA 3O6FD 1XBRA 4HK0A 4GG6A 3A4FA 2YLHA 4H5SB 2XTJC 3N55A 1CMOA 1FCCA 3HNTH 4PRHE 3Q9PA 4CRPA 2XXMB 4GAFB 3VXRB 5HYSA 3C09B 1WC7B 1EAPA 1KMGA 1NL0L 4HFUL 1SN5A 2MQ3A 2K8MA 1T7VA 4O2CB 4U0RB 1E27A 4MJID 2BFVH 1LO4L 3MRMA 1VZIA 4FZ8H 1FVEA 1GGIH 4GRLD 1OCRB 5DMIH 4CJ1A 2BIIA 3D69B 2P24B 2CHDA 1FE8L 1LE9A 2H26A 1W0WA 4GUPA 4ZS7H 1PJ9A 3SKOB 4IGBD 4Z18A 3E1ZA 3APDA 1U8CB 4MB4A 3ARBD 4RSVA 4X6BB 1THAA 3ZSTA 4IRZL 4ZFQA 1BD2A 2YRPA 1OEZW 1YDPB 3L81A 3RDTB 1CDJA 4IBVA 4G42B 3PWJB 1DL7H 1CD0A 1GGTA 2DIJA 4L1TA 2UZXA 4KVCH 4HLZG 3F58L 1H0DB 3LQMA 4FNRA 1J8HD 4R0LC 1X44A 4NPKA 4OZ4B 2ZXGA 3TBSA 4ENEC 3MLZH 3VQLA 2WXIA 2YPKB 5AKRA 1QA9B 2X1QA 2AJVH 4LKXA 3BSGA 1INDH 5AW2B 3FMGH 4WHYH 4XAKE 4J28A 4MZ2A 5K1VA 3F7QA 1ETA1 5IK3B 2KMWA 3MLYH 3N41F 2XQYG 3MXWH 4JO1L 2LVCA 5EC2B 5KJRH 1KIRB 3HC4L 4JHWL 4PB9L 1UYWH 2QQLL 1NCCL 1AI1H 1KG0B 1KY6A 3WUWB 4K55A 4V1DD 4XT1C 4DP2X 2BRRL 1E5BA 1NOAA 3PWUA 3HAEA 3MX0A 3UL4A 1ZJBA 1F45A 1ASQA 2BSEA 3RILA 5CP3A 2VZOA 4P5SA 3WNIA 1I1AD 4UQ2B 4H5SA 1HL9A 4QTIH 4CMMB 5DRWB 4JFXB 3FUJA 2FJHB 2PMZA 4GIOA 2NQDA 3VXRA 4MNGE 1NGQH 1WC7A 1IKFH 1ZE3C 1QYGL 2XRAH 2JQMA 1N5AB 5CIPA 1P7BA 1SHWA 3EUUA 3N41B 3QNYB 1E4JA 3GHBL 5IBLC 5BCAA 3QQ9D 2VZTA 2VXQA 3IBOA 1CQYA 2YD5A 4U1SB 4F2MB 1O7SA 4L3AA 3MA7B 5I24A 4XHJC 1IE5A 1IM9B 4NKDB 3LEVH 1WS8A 3D69A 2P24A 2FX7L 3FDWA 3O0RL 3H9SD 2ZNXA 5I71C 1J5HA 3SKOA 4HIXH 1J1PH 4KI1A 1FHNA 4B96A 1CU4H 1O7DC 2EDDA 2O61B 1UCBH 3L5HA 3ULVD 3FTUA 5DD0H 4X6BA 3U6XS 2GTWB 2JK5B 2F53B 5DJYB 2JLPA 4FFYA 2KBGA 3ZBMA 3MUHL 3ATAA 2H2PD 1YDPA 3RDTA 4JPQA 4G42A 3PWJA 4KRPC 4Y8AA 4ZFGL 3MJGX 3KBFA 3EOAB 2LGNA 2HMID 2DM2A 4MCZB 4C4BA 5J8OA 2RJMA 2XWXA 1H0DA 2OMTB 5JIMA 1GGBH 3MLPA 4OZ4A 4TNWK 2NT0A 3VFUB 4F7KA 1SFDA 2YPKA 1T89C 2X5PA 1QA9A 2LTQB 2AJYH 4NO5B 2V7HB 4XE0A 4YXHH 2YKLH 4WWNA 5IK3A 1J0JA 2VRAA 1NOLA 5I82A 3ZMEA 2BNQE 4OZHE 5JHDB 1KIRA 1GJUA 1MWAL 1CF1A 4I9XA 1AGEB 5L2KD 5SWZE 3HS9A 1KG0A 3WUWA 4LCWD 5GZOC 1OP9A 3TT3L 3CFJB 4B50A 4GAGH 5ABAA 3BDBA 3KYKL 4MNQB 4RFNC 1E2VA 3O45B 2IFGA 3U30C 3NZ8B 3P9MB 3ZVVA 3AU1B 1VF5C 3LNGA 2BP0B 3M7OA 3NIFE 4FC3E 4CMMA 5DRWA 4JFXA 2UXGA 2FJHA 2QQKL 1IARB 2XLLA 3PDOB 5KVGL 5AYQA 1WAAE 1J0IA 2YQ3A 4HJSA 4OCXH 4GUQA 1BX2B 3ZZSA 2J21A 1FFNB 3QNYA 4WI9A 4D9QE 2EC8A 3JZYA 2RIKA 4RISH 4WGVB 1TJMA 2AJUH 4TF4A 4AQEB 1QRNA 4U1SA 3I84A 5C09B 4F2MA 2FO4B 5CEZE 1IM9A 4NKDA 2XQBH 5IESL 3LIZH 2WZ5A 4NP4H 5KG9A 4JPKL 4FOMA 2A74B 1XQ4A 2PP8A 4F80A 2WHVA 2VR9A 4APQB 4LGSB 2O61A 5A6MA 4JG5A 4CSSA 2GTWA 2JK5A 2F53A 3OAZK 3OWRA 5T1JA 5DJYA 5ENWB 3CZFA 1NCAH 4YSDA 1SF5A 3UJTH 2VDNB 1JZFA 2IDFA 1A4KB 2IMNA 3H9ZA 5IB2B 1A7QH 4HUKB 3OKNB 3EOAA 5D4JA 3QCVL 5FEBA 4MCZA 4LL1A 2PXYB 5E1HB 5EU6E 1TVHB 2OMTA 4BZ1A 1AZCA 4WI2A 3VFUA 2WKLA 1YC7A 1R47A 2X1XR 3B7TA 5LG6A 2HA1A 5KANI 2V7HA 2YMXL 4XVUD 2ORBH 3ARDB 4Z78B 3CTTA 2B3RA 2BWDA 5DFTA 1SYVB 3MNWB 1S7UA 4R90L 1HNFA 1G43A 5JHDA 4PPTA 4Z7VF 3GMLB 1F6AB 4L48A 5AWNL 1AGEA 5JZ7D 2XIDA 1C1EH 4PHZA 4Z3EA 3WNOA 4DT2A 4MD5B 1J9CT 3BQUB 3CFJA 2CIIB 2PP9A 4MD4B 1MQ8A 4MNQA 2CUIA 2DYRB 3IGUA 4IKIA 3O45A 4XCNB 4K07A 3SE9H 3NZ8A 3P9MA 4LPWA 1YEIL 3CVHB 4YFDB 2CIKB 1E6JL 3AU1A 3UBFA 5TFSL 1YEWA 4GKLA 2V5SA 4ODHL 1XWVA 1WFUA 3ULVL 2FH8A 2VTFA 3PDOA 3PWLB 1BREA 3PWPE 3VUAA 1BX2A 1UEMA 2FHCA 1IQWL 2J6EA 4P5MB 3RHWF 4C58B 4FMFA 1FFNA 3MGOB 2DEXX 3UZQB 3HI6L 5E1QA 3IEAA 4GW1B 5DA0B 4Z7VB 4DQOL 2R69L 2FSEB 4GLRH 2I60H 4IKKA 1SHSA 1TQSA 1MCKA 2EKJA 4JGUA 6TAAA 1KGCD 2FO4A 2ZP8A 3QS3A 4L1SA 1QFUL 2DS4A 3D08A 3MNZB 1T1ZB 2G3ZA 3FCUB 1MFUA 4K3EH 2PF6A 5CCKL 3GRWH 4RGNE 3KPTA 3QG7L 4JPWL 4A7VA 2A74A 3VD1A 4MQXD 3OVUB 3K6DA 4APQA 5GRJH 4N87A 1EZVX 3WNNA 4LQFH 1OARH 1OPGH 3KPLB 4RGOL 3FQXB 5ENWA 3NIDF 1FL3B 4A6YH 2N0KA 2ENQA 1QR4A 2BIOA 3EBIA 1DBML 4L3EA 2NY2B 4TTGA 3HS8A 1A4KA 3MV7E 2J55A 4J3OG 2CBTA 3LS5H 3OKNA 1KELH 5D1XC 2PTTB 1W0VB 5LBSH 2A9MH 4EXKA 1CGVA 5KEZA 2PXYA 3AWGA 3JWNE 5L8LB 1CFNA 1RUML 4KTYA 4S1RL 3VWJD 1LP9E 2VABB 3K4ZA 3UAFA 4J3UA 4XPTL 3F7KA 1MCRA 4YDKL 4DK6A 3ARDA 4Z78A 2VZUA 1Y1UA 1SYVA 3WFBH 3SDDB 3MNWA 2ADJB 1HHIB 5EIIB 2QADB 2WXOA 1JRHI 2OL3B 3GMLA 3OR7B 1P1ZA 2JFCA 2Q3ZA 1G1YA 1E8WA 2VSMB 3HNVH 3QIWB 1BLNB 3NIDB 1J11A 3QPXL 2VL5A 4XPBH 2X6CA 2WLZA 5KJ4A 4E9LA 1E90A 4IBTA 5INDA 4PP2B 5BS0D 4XWGH 5IOKA 2BIQA 4AEFA 4MD5A 4UM9A 3BQUA 2CIIA 1ZXQA 3D8MA 4MD4A 2PYFB 3PXJA 4LIQL 3KVPA 2E9IA 2DQFB 5JOFB 4XCNA 3UJIL 1LVEA 2DQJL 4XNQB 3V6ZB 3CVHA 4GJTB 3TEZA 1FFQA 1U2YA 1Z5LA 3Q13A 3VJ6B 3II1A 2DRUA 4PBXA 3K0YA 4NLAA 3PWLA 4X4ZA 1XR8B 4U0QB 12E8L 2A0LC 4P5MA 3QUYB 1CCZA 3UZQA 3MGOA 1A6ZB 4TV3A 3SCMB 4CKVX 4GW1A 3T2LA 3S5LB 3KEHA 4CU8A 4Z7VA 5T5FH 3N1PC 4UTBA 2FSEA 3HUJF 1G9HA 1MRDH 4PJEE 4C57C 4JQIH 2ERJB 2VDPL 3GNML 3E3QE 4PUBL 4Z5RB 2J1ZA 3EH4B 5F71A 1T1ZA 5DJDB 4HC1L 3APFA 3KR3H 3UAEA 2DH3A 2W9DL 3NAAL 2H1PL 3MVSA 3G5ZA 4FABL 5CJXA 1AACA 3QIUD 2XVLA 3GMOA 2Z31D 4OLZL 3TF4A 2R4SL 3WKML 3IAQA 3ZPDA 1JYXA 3KPLA 3FQXA 2FATH 1BQHB 1FL3A 2DTSA 4PRNA 4YLQT 4DEWA 3FN9A 1R5IB 2H3NB 3N1QC 3GSNH 5DCCA 4XP4H 4HZ1A 3UTPE 3UZVB 6PAZA 4FNTA 1MVUB 2CO4A 4BFOA 2PTTA 1W0VA 1YAZA 4ZOCA 4P5RA 2B5IC 1MAML 1USZA 3BPCB 3O2WH 3HUJB 4X9IA 4DK5A 1JZ7A 1DQVA 4GG8B 3S36H 4M56A 2VABA 4TSBH 4JFHE 3WFCL 2VAJA 3BI9X 4LHQB 1NM9A 4S10A 2GHWB 2CA4A 5BUGA 1G84A 5DD3L 1OF0A 1SOXA 1S9VB 4HS6B 4CVUA 4AMXA 4NZJA 2XZZA 3W0WB 4ESKA 2X4RB 3SDDA 2DQEH 5DO2D 2ADJA 1HHIA 2WXRA 4QRRD 1BIIB 5EIIA 3SBPA 2OL3A 5EEYA 3CMGA 5AZ2L 5IJKC 1ZTMA 2EIEA 1BLNA 1AY1H 2PTUA 3IRZA 3QIWA 4X9GA 5DUJA 3WTYA 3WLBB 4M93B 3RKDC 4PP2A 3ZKXB 5BVPL 3QZWB 3L3IA 1A22B 2E47A 3NRFA 4O02L 4PVLA 1S3KH 2PYFA 4RBPK 2GVYA 2EJ1A 4FFWD 2DQFA 2EDLA 4RH4A 5JOFA 3LXBA 3OKKB 4G7YH 4XNQA 3V6ZA 2JKRM 5E4IA 3TP4A 2XV2A 3EDKA 1HVXA 5DR5H 5ALCH 2V17H 3VJ6A 1E0OB 3U36B 2PYED 5T1DL 2Q5BA 1XR8A 3BPNC 4LAQL 4BQ6A 1G9NH 3F3HA 1A25A 1FH5L 3G5WA 3NCJH 4GQPH 4LSUH 3RVXC 2J4WH 3AU0A 4NGHL 1A6ZA 1Q38A 4M5YH 3SCMA 4UB0H 4GMTH 3FTSA 4G6JH 1MOEA 2BFGA 4M4RB 4FQ1L 4Z5RA 3B2VH 3TFKC 3H56A 2J8UF 5DJDA 3QDGB 4X6CF 4JGMA 4EI5D 1YSOA 4OFYA 5K1JA 1SHMA 4UDUB 3QG6B 3KM2A 4R84A 3U48A 2DMHA 3RHWK 3WKQA 3Q6FB 5T1LB 5EBLB 3CH1B 1S9XB 1YPZF 2VGLM 3OMNB 3QIBD 2I26N 3DJSA 2VLRE 4HJEA 4WSGA 1C7SA 1R5IA 2H3NA 5FUOL 4FP8H 1OB1B 3NQKA 4PFEA 2W60B 1Q9OB 3UZVA 2G9HA 4WO4C 2P80D 1YG9A 1CXKA 1MVUA 4KV5E 2LW3A 3BMVA 3DPBB 4N2GA 4QWWC 4WUKH 4ZXBC 3X1GA 3EF7A 3H9YA 4WENB 3BPCA 4HUVB 3HUJA 4L5FE 5DHYB 2YEQA 2QQQA 2YMOA 4GG8A 4B95C 5MEND 2YOAA 2F74B 1Z7JA 2J8HA 4HIQA 4XVOA 2QHLA 3VRLE 1YECL 2J8UB 4LSSL 4KX9A 1HFUA 4PLNC 3C5ZD 4HS6A 3ZN6A 1R0AH 1HINL 1S78C 1UH3A 3W0WA 2X4RA 2H0PA 4Y1TA 4LSRL 4PGEB 1BIIA 4PQXA 1YPZB 2CLZA 1PEWA 1JPTH 2V8MA 3HG2A 4YE0A 1B4JH 4CSTA 1AAJA 3FAWA 2ZE0A 4GRMB 3I74A 4Z77B 5E08L 3HEIB 2A77L 3WLBA 4D0DA 5TE4H 1H3WM 3BISA 1PAMA 4Y9BA 4FG2A 3EJYC 4NM4H 3NRQA 4KRNA 4ONFL 3HI1B 2ZYRA 3OKKA 1T2QH 2QPFA 2HSIA 4X6EB 4Q52A 3IU3B 2X1PA 1VENA 1AHWC 4C47A 4QNPE 5DQ9B 5H2BB 2VW6A 3U36A 5AZEL 2FWSA 5JW4N 1Y1DA 4P9HH 1VFOA 5CINH 3GHPA 3HI5H 4QEGA 5CP3H 4HS8H 3J7HA 5GJSH 1UM5H 1SQ2N 2C4FU 5M94B 3SYCA 2Y7QA 1MCEA 5IHUH 4B5ZA 1HL8A 4NQCE 1KTLB 1KIPB 3GXFA 4JHAL 4M4RA 3ZT5A 2XNAB 3L08A 2PCYA 5CIPH 5J13B 3O4LB 3QDGA 5IHBA 5ISZB 1INEH 1QNZH 1IGIH 2O6EA 4UDUA 1QBMH 3QG6A 3QXDB 3RVUC 5IB5B 3Q1SH 2A7BA 1WGVA 3Q6FA 5T1LA 5EBLA 5EEVA 3DK0A 1IBDA 3CH1A 1S9XA 5IFAH 3NJNA 4S0SD 2NYZA 2VITB 4GIAA 3IKKA 2QPUA 1FRGL 1JD7A 2Z0UA 1QKZL 2WXFA 4YZFF 3NN8B 1ZKAA 4M7JH 2GY5A 3BFOA 3GO1H 1UZ8B 4HH8A 4J2QA 1Q9OA 1U8OA 4Q0XL 5HVHC 2D7OA 2PPCA 1URZA 2JSFA 3QWQB 4WFHD 3DPBA 4ATTA 4PHXA 2GJZB 1MCSA 4DCQB 4FFYH 2Y22A 4QHPA 5I1DB 2ENYA 4HPYL 3VA2C 5DHYA 5JLZA 1MH5B 2XTJD 2WBXA 2WZAA 4IOFC 4KH2A 2F74A 1I9JH 4PMEA 5AAMC 1FNFA 4JLRB 2J8UA 2WOBA 1A0QL 5DHDA 3SDAC 3TO4C 1EA9C 3L5XL 4XBEL 3VMNA 3OAZH 1W16A 2D73A 3ZL4H 1JZGA 1KB5B 2XN9B 2VM9A 5I19L 5K59F 4PGEA 2W9EH 3P3UA 1YPZA 3S34L 4GS7C 1CURA 2JI2A 3QJVB 4IDJH 2O26U 4NX0A 3EDDA 1GCYA 4GRMA 4D8PB 2UZPA 4Z77A 2OMNA 4YUEH 1RFDH 2Z91B 3QXWA 3UC2A 1WG3A 2QKIA 3APMA 3D07A 1BZEA 4QD2E 4ONHB 4TPRL 3FB8B 5I76B 3HI1A 1AKJA 3TVMC 1U3HC 2Z8WC 4M62L 4Y16C 3CVIH 4DN3L 4X6EA 5FA3B 1GW0A 1S9WB 3IU3A 1NJ9B 3VFPA 4FTVB 5C3IA 4OZGF 4AXWB 4F27A 1L7TH 4PRPE 2CGYA 4JHUA 3MREB 3L3DB 5LDUA 2WNGA 4K8RH 3WTXA 3IMVA 1H15B 2GSGB 4LE8A 1VZHA 2I24N 4FQIL 1VZGA 2A6DB 1MFMA 1TFPA 1SXAA 2BIHA 1KTLA 1F8TH 3QJXA 5F8QC 1ZVNA 4GXVL 2XNAA 2I85A 1MFAL 4GFXA 1EDHA 2ALWA 2YHGA 3O4LA 4U1KB 1NUDA 3CZEA 4NQEE 1QRKA 4DO6A 5JOPD 3QORC 4U1NB 5IB5A 2WK2A 2RACA 2D9QB 1XAUA 3WIFB 1J5OH 2WSPA 3UO8B 1CK0L 4S1DC 4A37A 3F6IA 3FSWA 3NFSL 1IB5A 3NN8A 2N1TE 4OZGB 4M6MH 1UZ8A 4J3SA 4UV4L 1DVQA 3CHXA 4A38A 4B7IA 3MV8D 1YEJH 3ZUNC 2FJSA 3UCRA 3ASOB 4I0PC 1NZRA 2GJZA 3WXWL 4DCQA 4BSVB 1NDGB 5I1DA 4ABWA 5E2WL 3HMXL 3H3PH 5FM4A 1MH5A 1AXSB 1OL0A 4BZYA 1OWRM 5KSUB 1A21A 1AQDB 4JLRA 3SPHA 1Q0YL 2KQNA 2DDQH 1S6NA 2EE0A 3D48R 3H0TB 4DFIA 1X6LA 4NC2B 4BZ1H 1S9YA 5FOBB 3SKUD 1KB5A 2P49B 2XN9A 5IBLD 3QEQD 5FYJE 1J0HA 2DYPD 3ZMRA 1TJGH 2WQUA 2VJXA 3E9TA 3H2WA 3GLZA 4XHJD 2O6PA 2L0DA 3LKRB 1SY6A 4OB5L 2ZUWA 4D8PA 5F0LB 5F3BB 1JZHA 2Z91A 2HUEA 4N86A 2HT2C 2VXTL 4ONHA 1G9ML 5FUZH 3FB8A 5I76A 4M4PA 3O11A 3B9AA 1DR9A 1G5AA 1I1CA 2KDGA 3AMKA 1FYTD 2ZPKH 4EUPB 1QUNB 4YBQC 1S9WA 5DGQA 3CH8A 3D18B 2R0WH 4FLRA 4FTVA 1EIBA 4AV0A 3DMMC 4AL8H 4Y9GA 5C7XL 4AXWA 4KI5E 4KRPD 3SD2A 3GDCA 1UOLA 3MREA 3L3DA 5GGQH 3TASA 5E99H 5LLIC 1H15A 5E0QA 2GSGA 4NAMA 4TYUA 2YEZB 2A6DA 4M00A 4ZOAA 2JQAA 1CXHA 2DQMA 4N8PA 4UMGA 4ORGB 1YC8A 4U1KA 2J5LB 2ZXWB 4KGJA 4D0CB 2QELA 4BYHA 1KC5H 4JFSA 5AVZB 3DI2B 4U1NA 2BIMA 4PRHB 2YA2A 4M1CC 4Q8BA 1BVOA 3NJIA 3WIFA 4R4BB 1CFSB 4QCIA 4F20A 3BZDA 1DUYB 4HDIB 4L9LB 5GZOD 1FQ9C 4PV9B 4OZGA 1GCFA 3WN6A 1D7BA 3QXUA 3TYGL 4W4OC 2OULB 1NH6A 2C9RA 4LOVA 3V4VL 1MNNA 1I7UB 1LL1A 4EIUA 5E4EB 3TO2B 4BSVA 1NDGA 4QTHB 3ESVF 3MHZA 5KSAC 4ES8A 3I9GH 1AXSA 1W72B 2LFGA 2NNXA 5KSUA 1NBVL 3HN8A 1AQDA 4Y4HB 1KTCA 1KBGH 4Z7UE 2IQAB 1AP2B 3LB6C 3EHBC 3D4ZA 2Z1PA 3W9DB 5FOBA 2JIXD 4H44C 3ECUA 1EAOA 2G5UA 2NLJB 5AW3B 2O5XL 3HFFA 2MTAA 3S37H 5B3SB 3PAUA 3LKRA 1RPUA 3ECBB 3QAZB 5DFVC 5F6HI 3RWCB 5F3BA 1DSWA 4XMTA 3B2UC 1SPDA 4PJCE 4XBMA 4OI7A 2HX9A 1G9NC 3KCWA 4OLVL 2DQGL 2C8NA 3QFGA 2WUBL 3AQDA 4G11A 2AQQA 3EYUL 4EUPA 1QUNA 3N43F 4XP1L 1NSNL 3D18A 4TVUA 1MW1A 5LAXB 4WEEA 2MH4A 5D4QA 2Y2YA 2IADB 4DW2H 4RDQF 4TLTA 4KNUA 4GRWH 3CVHH 5I1HH 3FO1B 4XPFL 3VXPB 3FOMB 4M5ZL 5GHWH 1XH1A 3MNVB 2YEZA 4EQ3A 3BJ91 4F7PB 1SDDB 3QXTA 3T5WA 3AFLA 1RK1B 2XVKA 1JNLH 2EZ0C 2WOYA 4KTEH 4RBPH 4ORGA 5JQHC 4JKWA 1F4AA 3Q7JA 4D0CA 5T3XD 5F9WC 2EICA 4FFVC 4ODXB 4HCIA 4FQXB 1BG1A 4OF0A 2CJSA 3HLAB 4R4BA 4D9RE 3VW3L 4MNGB 4YO0B 3N43B 4AJVA 3BLPX 3DO7B 3GKZA 3BKJL 1G7MB 1DUYA 4HDIA 4L9LA 3L4UA 3CU7A 3FFDB 5AG9A 4ZTPH 3TV3L 1RKRA 1HKLL 1L3WA 4LBAA 3J2PA 4P04A 1I7UA 4S1QH 3DLQR 2C9PA 3TO2A 3KJ6L 4QTHA 4B60A 3VSUA 4P57B 3D0VB 5A16B 4AEHH 5HYIA 2ZOTA 1W72A 1FIGH 3A3YB 4Y4HA 5BRZE 4HISA 2IG2L 3DBSA 2IQAA 4OZHF 1AP2A 4RAUA 1X5HA 1ACZA 1K4DB 4WHTB 1CTMA 1FV1A 2CRZA 1JFQL 2NLJA 1A9BB 4P07A 4P9ML 2Y7LA 3F6LA 4OZFB 4B9YA 2CO1A 2ZUXA 5D71L 2VR8A 2IGFH 4TSCL 4XGZB 2Y07L 4LO9A 3ECBA 4LF3B 3QZNA 1DFXA 2UXVA 2C26A 4FKEA 4RRPA 5E8EB 3L7EB 5A2BA 2BXZA 4P9HC 3ABGA 4OJFL 3O9WB 3ILDA 3NIFF 1WHPA 2EDQA 4P0DA 4NSKB 1FNHA 3FSOA 4UIKL 3S5YA 4QOKD 1BBDL 4YXLL 5LQBL 3V0HA 1WAAF 5I6KA 4DZBB 4FADA 3C09C 5AW5B 4K71B 5LAXA 1YYMH 2BNQB 2VNCA 3C5XA 4OZHB 3ZRFC 4U0RC 4QRPE 2IADA 2IEPA 1WZLA 4R7NB 2DKMA 3NSCA 5D1XD 3WEXA 3VXPA 1TPXB 5F9OL 3VG9B 3FOMA 4BK4A 5SWZB 2LR4A 3MNVA 3L4WA 1PKQE 4PG9B 3CFDB 4QXGL 1WCBB 3LVEA 1IBHA 1SDDA 4JR9L 4JG9A 3V0IA 3ZYJA 4F7PA 2P7TB 1RK1A 4LDCA 5E2VH 5C07E 2BP5M 3BUIA 4HA1A 3FO0H 4EIGB 2EYSA 3KPPB 4GH7B 1SN2A 1KGUA 3KGSA 5IFHH 4L4VE 2LHAA 1NKGA 4ODXA 3NIFB 4PLOB 4EE2A 1U0QA 4FQXA 4LZKA 1MPAL 1JZJA 2J88L 4OCRH 2CRYA 3HLAA 1LJMA 2DIEA 2W92A 4MNGA 1FDLH 1L9PA 3BVTA 3GSOB 4K5NA 2HG5B 5EF0A 1G7MA 3VGGA 1N2RB 4X98B 3AW5A 2D7TL 3FFDA 2J25A 2YIHA 5CR8A 5AYTA 1N70A 2YC1B 5I6OA 3QK0A 2FBJL 1VKXB 2DF3A 4NN7B 1T6VN 4OBRA 4X7CC 5EU3B 1PLGH 5ITFB 1QLEH 3B7UX 1KXHA 4FRWA 3HJ0A 4JY5L 4IKJA 3FQ1A 1H3XA 5FAAA 1IL1B 4EZKA 4P57A 2FX8H 2JCCE 3D0VA 3ALWA 5A16A 2ROYA 4J27A 1AR1B 2X9ZA 2VXVL 1X4YA 3AUWB 1NGXB 4Y19D 1HZKA 2A0LD 1JP5A 2ZOKB 1K4DA 4WHTA 1ZTXL 3AB0B 4FE9A 3WMPA 3QR2A 3CZGA 3S3PA 1A9BA 1NIAA 3FYEB 4OZFA 3VX1A 4WFGE 2JCWA 5ADPL 1L6ZA 2WINA 1UD3A 3UYRH 4ZS6C 4LF3A 4M5TA 3ARYA 5E8EA 5I16B 1PAZA 1S9KC 5EU6B 1UD6A 3L7EA 4OSUL 5KANG 5HGAB 4MAYB 2O5ZL 3O9WA 4GKOA 4K8RC 3DVGB 4NSKA 1M3JA 5C6TL 2ADIB 3BAIA 2ZUYA 1KUMA 3OM3B 4X5WA 2YA0A 5GGTH 1Q0XH 1I3VA 4KQ4L 4Z95L 3UYOD 2A5UA 4CA4A 1WDAA 2IQ9H 2VZ1A 1OAQH 4BIKA 2VQ1B 4NQXA 2BNQA 4OZHA 4BRVA 3CD4A 3CZNA 3G6JE 4PTUB 1IZJA 4HT1H 1B2WL 4M8UA 4R7NA 5CZVH 2WY3B 4BQCA 3CK0H 4Y9CA 3CFMA 1J5IA 1KTDB 3EUDA 2Y23A 2YQBA 3MJ8A 5SWZA 5LWYH 5EOQL 2HJFB 4UQDA 3NDZE 4PG9A 3CFDA 1WCBA 1RJYA 3X1EA 1D5IL 3NA9H 2P7TA 1UJ3A 4A63A 3AXLB 2A9NL 3GBML 4PW4A 2E59A 4K94H 2ICWI 3LMJH 1GZHA 4AGMA 1OAUH 4DGUA 3KPPA 4J39A 3RIAF 3MLXL 3GBNL 4NQDD 2Q7YB 3C2AL 3HBPA 1J1XL 1GH7A 1WBZB 3M1CA 1QG3A 4N2LA 1T4KA 4QYOB 3VGDA 1WAAA 4LFHD 3PWPB 3VDCA 2HG5A 1PGRB 3HG0A 5T5NF 1HESA 1N2RA 4G8FA 3NACL 1J7VR 4X98A 3ZSSA 4AH2B 4WW2F 3RKDD 4BE6A 4CN1A 2YC1A 4NUJB 2HPTA 1LGVA 3ME0B 4ALAH 5EU3A 1LP9F 1MLCB 4YFLI 3HC3L 3PPSA 5ITFA 4LRNH 3MJ9A 5HYEA 2CBQA 3MBXH 1M7DB 5L4MA 1IL1A 1BAWA 4PGCA 4P49A 4RGNB 3NTCH 5KVFE 2DPKA 4YWGH 1AGBB 3T09A 4XHQA 5I15H 1XO8A 1NGXA 1NPJA 1YEHH 5F3FA 1IFGA 1LD9A 5SWSD 4JN1H 2ZOKA 2E7HA 3NCBB 3RVXD 1Q72L 4JW3A 2P8LA 1L9OA 2DLFH 3KEDA 3VXME 1AG0A 3F01A 3DO3A 3NVQA 5T3ZE 3MV7B 3M17B 2ITFA 4YK4B 4WW2B 3EH2A 4ZMTA 2I69A 5I16A 4QRFA 4AL8C 5EU6A 6FABH 2VJ8A 4UZGA 2ODIA 5HGAA 4MAYA 4MLSA 2Q3XA 3L9BA 5IP4A 1U6AH 4FHBD 1LP9B 5JOEA 1N18A 1EO8H 3T6XA 3DVGA 4LSTH 3QFJA 4CVWA 1AG6A 4NZTH 5DD1H 4MASA 2XT1B 4X9FA 2XKUA 4OLUL 5H4ZA 4WSKA 4Q56A 1B4LA 4OLWL 5FGBA 1QSZA 5CUSL 2R29A 2IDUA 3FK3A 3GZQA 1ZD6A 3KXFD 5F7YC 4B53A 4DN4L 4GMSL 4MA8H 2VQ1A 1K3ZA 4N3UA 4ODSH 1JWSB 4PTUA 4WO4D 2BOLA 4PJEF 4Y0GA 2VM3A 1KTDA 3HNTL 2K9FB 4QWWD 3U1PA 3GWJA 1ZCRA 2MCMA 4DKTA 4ELME 1E40A 4AIEA 1CIUA 4KMQA 5IR1B 3AXLA 1DQQB 3RKPA 2BFVL 1PZUB 3HR5A 1V3MA 4MXVE 4N0UE 2YAEA 2A74C 3GI9H 2KHAA 3NSXA 4N2EA 4K5OA 3VMPA 4FZ8L 4APQC 3BYYA 1GGIL 1S78D 2Q7YA 5HGHB 2IOMA 4P3CH 5DMIL 3TCTA 4FG0A 1WBZA 1OK0A 4P06A 4HHGA 5L8JB 4QYOA 1EFXD 4ZS7L 2ARJB 4J4PC 2OSWA 2GABA 1C5DB 1MCDA 1OW0A 2YAPA 3WN5C 5L4JA 2X6AA 5IW6B 4AH2A 4M03A 1ECYA 4NP9A 3KYOB 5IHZB 4NUJA 4PJEB 2PXYC 2MHAB 2QSQA 3ME0A 3WKPA 3L4YA 3EJYD 2BY3A 3V4PB 1MLCA 2IGTA 4DH2A 2OZNA 5IREA 1U95B 2F2HA 2D7PA 4BHUA 6CGTA 1M7DA 2VUOA 3SYAA 3NP4A 3PQYD 4X80H 3ARDC 2ZF9A 3D33A 3RY6A 1KV7A 4KVCL 1AGBA 5DUPH 3U0TB 4FGMA 3OXSB 3KPRD 3MLZL 2OYKA 2F54D 2UUDK 1B0IA 5I28A 3BX7C 5JIHA 5C0JB 2AJVL 2DBLH 1INDL 3FMGL 2AEOA 2F08A 1YEKH 1AVAA 3TLRA 3BD4A 3MV7A 3M17A 3DV4B 2VDOH 1O9ZA 1Z9MA 3MXWL 3SZKC 3BQUC 1VPOH 4PVMA 4WW2A 5KJRL 3RGHA 2PPDA 1KB5H 3GLEA 2XTSA 1N8OE 1UYWL 1PYWB 1ZLSH 3FTXA 4J8QA 1LP9A 1T83A 1X5ZA 5KWYC 2ZP9A 1OSPH 1AI1L 1G7LB 1I7RB 2G30A 3CCHB 4FNLH 2O93L 1EZSA 1UT9A 3T0XA 5I1GH 1RSFA 3GSVB 1JWSA 4JO4H 4Y1SA 1ZVHA 2C1OB 4HOZA 1T5KA 4BCXA 1FVCA 4OCSH 4QTIL 4AEIH 1BVNT 4U05A 5A3IC 3ZTEA 1AFVH 3OXRB 2FHFA 5T1KD 1NGQL 5TF1H 5EN3A 2XRAL 1BF5A 3LZOA 1P2CA 5JW4Q 4IOFD 4WWKB 2Z7UA 5IR1A 1DQQA 4OCLC 5E2UH 1II4E 5HI3C 4ENZA 3SDAD 3TO4D 5I5JA 4FNUA 5HGHA 1KTJA 1HWHB 2B59B 3LEVL 1RL1A 3N1MC 1E2WA 2AQRA 3MROB 1SBBA 1V10A 3MRHB 3NT0A 1ZV9A 1ZGLB 3CDFA 5A1AA 1YVLA 2ARJA 5D7LD 1C5DA 2NY2C 3LRKA 1ACYH 1A5FH 1J1PL 4WDIB 5F6IB 2X6UA 4KV5F 1CU4L 4FXKB 4ODUB 1UCBL 2XKSA 1RZGB 5DD0L 1AHMA 1KBPA 3KYOA 4JQVA 4PJEA 3NEEA 2BSSB 2DV6A 3RIAK 5IHZA 4PCTA 4ZZKA 3V4PA 5AOLA 1XMWA 3D05A 4OY9A 3TVMD 1U95A 1U3HD 2VLME 3FU3A 4G72B 4Y16D 3VRLF 4GT7A 2ENSA 4MSWA 3DA0A 3D5OF 1QP1A 4YPJA 1NANH 2Z34A 4E9VA 5TQ2H 3U0TA 1GGBL 3SDDC 1RURH 3G5XB 3ESPA 1A7NH 1J9QA 5EMYA 2FUTA 4LCVA 5C0JA 2AJYL 2VLRB 1J0KA 1T5WB 1E9OB 2IH9A 1EANA 3QIWC 4YXHL 5C0CD 1P4IH 1FNSH 1QFHA 1PX8A 3A5VA 5I0YA 2YKLL 3DV4A 1CFQB 5HD8C 1OE1A 3KPSD 5E7FA 5D1ZC 1GPOH 1XV8A 1X5XA 5EZPA 1NUFA 4N90E 1PYWA 3BC9A 3QORD 4QNPF 1AXTH 1G7LA 1A2YB 4ELKB 3CCHA 2FK9A 2XQYA 1JDDA 5FYKH 2PCXA 1CN4A 5C70A 4S1DD 4PY8J 2X9WA 4GAGL 3QZPA 4OH2A 4KO7A 2WQVA