3S4SB

Crystal structure of cd4 mutant bound to hla-dr1
Total Genus 44
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
44
sequence length
191
structure length
186
Chain Sequence
MGDTRPRFLWQLKFECHFFNGTERVRLLERCIYNQEESVRFDSDVGEYRAVTELGRPDAEYWNSQKDLLEQRRAAVDTYCRHNYGVGESFTVQRRVEPKVTVYPSQHHNLLVCSVSGFYPGSIEVRWFRNGQEEKAGVVSTGLIQNGDWTFQTLVMLETVPRSGEVYTCQVEHPSVTSPLTVEWRA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Immune system
molecule keywords HLA class II histocompatibility antigen, DR alpha chain
publication title Affinity maturation of human CD4 by yeast surface display and crystal structure of a CD4-HLA-DR1 complex.
pubmed doi rcsb
source organism Homo sapiens
total genus 44
structure length 186
sequence length 191
chains with identical sequence E
ec nomenclature
pdb deposition date 2011-05-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00969 MHC_II_beta Class II histocompatibility antigen, beta domain
B PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3s4sB02
3.10.320.10 Alpha Beta Roll Class II Histocompatibility Antigen, M Beta Chain; Chain B, domain 1 Class II Histocompatibility Antigen, M Beta Chain; Chain B, domain 1 3s4sB01
1FO0A 1MAML 1OSZA 1XF4A 2QQQA 3U83A 4N0FA 5BV7B 3QHFL 2CIIB 4WNQB 2F54A 3BN3B 1U2CA 1DL7L 2DD8L 2DWEB 1VDGA 3SGKC 4DGYL 1A6VH 4I0PD 3OV6A 4AQ1B 4ODSL 4P2RD 4JKKA 2JCCB 5AD0B 4LKXA 1D3CA 5D2LF 4ZSOE 3QIWC 1YN7B 2BDNH 1MI5B 2R23A 4G6ML 5JW4M 3MRIA 2W38A 4OQTL 1RZ7L 4J23A 4AENB 3KYOA 4GRLD 4PRDA 5F1NB 1RURL 1IGTB 4IDLA 4M9PA 1IKNC 1UG9A 3TBYA 5K59E 1N5YL 2P8LA 4OGAC 4S10A 5D1QC 4CADA 4LGPB 1BIHA 2ZCKL 1P4BH 4MMXC 1CLZH 1TITA 4JR9L 3BZFB 4Z7WF 4LP4A 4KVNH 3IDGB 5IW6B 4MA8L 3S98A 1KYOK 4LPYA 4TULL 4ZTOL 4GAGH 4JFFE 4OT1L 5CIPA 4FQ1L 4U6HB 5DA0B 1DUYA 2DMBA 5FM4A 4QTIH 2A77H 3QIBB 2YA0A 2XFXB 1DJSA 1JZ6A 2FBJL 2VLLB 1KJ2B 3BWAB 3QEGH 3I3BA 5ANME 4P46A 4XCEB 4EIZC 4KI5F 5EBGA 3T2PA 3X12A 1YC7A 4KKCD 43C9A 2MCPL 1AXSA 1CZ8L 3VGBA 3INUL 2XKUA 1NCWH 4OLVH 4QHLB 2G60L 4QRRE 5I1AB 1FDLH 3MXVH 2IBGA 4YHMH 4Z78B 2VAJA 3EZJB 4XNYL 4XTRD 3KPSA 1IVLA 5JXAH 3GMQA 5L8LB 5F3HB 4H8WC 4MVBD 2X09A 3G6JE 1DQJA 4XP9H 5GRJL 5HYJE 4JY5L 1X9QA 4GKSB 5E6IB 1RUML 3TBTB 4I2XE 4HFUH 5D1XA 4X7EC 2OQJA 1J86A 5IFAL 1I9RH 1FCCA 1G7QB 3GMMB 4MXWL 2F74B 3LN4B 2LTQC 1X44A 3WFHB 5EDXA 4LHUA 4LSDA 1FFOA 4HPYL 4DAGL 3ZYJA 3ULVE 3RL2A 4YHIB 1MLCB 4K3GA 1M7IB 4APQD 3ARSA 4LCWD 3PQYA 4N8VG 1IAII 1IFHL 5ERWA 1IEBB 4CU8A 1WUNT 1CVRA 2FDBP 2JTDA 5K9JL 1HZHH 1NAML 3HPJB 3HPLA 3VFNB 5DWUH 2APWA 1AE6L 1JHKL 1HSAA 4N5EC 1CLOH 4FXKB 4JFOB 2HG5B 1CXHA 3P9MB 3MZGB 5CS7A 4G8IA 3AREC 1QKZL 3NIFE 1NBZA 5FM5M 1G9NH 4HWEH 4MAYC 4ZOAA 4QF1A 1F4XH 4WW2B 3Q48A 1W72H 1ZA6B 4EBQL 4HWNA 5MERB 3F7VA 4I18A 1I7RB 4HC1A 1HH6B 4LK4A 3GMRB 1U8PB 4I5BA 5HY9A 4O4YH 1CE6A 3PL6C 2D03L 4UNVA 1A6UL 1BQSA 1A4JB 4NQCD 1CDGA 4CMHC 1PX4A 2WBJB 4JPVL 4OF0A 4B53A 2QKIA 5D7IE 2NY3C 2QQNL 1F4WH 3MNWA 4I0KA 3UDWA 2VDKL 4XHQA 5GS2H 3CDYA 2E3VA 3FRPA 4RFNB 3PWPB 3CVIL 3QH3A 5DK2B 3QUKB 1C1EH 2HMIC 3BP5A 1RZGA 5F97E 4M8QB 1LP9A 3UMTA 2Z0BA 4MJID 5DJZA 3VGAC 3VGDA 4UU9A 4TTDD 3UEZA 1EX0A 2WP3T 4B50A 4D0BB 2HAZA 5CUSL 4LQFL 5DC9B 2G5BB 4JRYB 1KULA 1JL8A 5JTWA 1J8HE 5EFIB 1L0XA 1P4LB 5F89B 4UIKL 1EBAA 1U6AL 4AZ8A 1INEL 3I50H 3GIVA 1JF1B 3CC5B 4KQ3H 1BWMA 5SWZE 1NUGA 3G08B 1NLDL 2HJLA 4M6OH 4MQ7B 4L3EE 2B5IB 4L4VB 2FECI 3MRJB 4K9EH 3OF6A 4K8RL 5L7XH 3HNSL 3EO0A 3QO1B 4XNUL 4AEEA 3HC4H 4NRZB 4RMQA 3AS0A 3K8MA 4M48L 3UJIL 5EU6A 5C6TL 2VXTH 3VU2A 3HUJE 1I85A 4I77L 5BS0A 1NEZA 1WWBX 1YEKH 2Q6WA 1T6WA 3F6LA 1JWSA 1YMME 4YDVA 3MPCA 1P2CA 1NFKA 4PG9B 2N56A 4TTGA 4FFWD 4WFHD 4NM8L 1CFSB 3OJVC 1RHFA 3THMH 1GIGH 3PWNB 4L4TE 3WV0A 2GSIA 3NFSH 4PPTA 3BP6B 1KFAL 5C0CB 5IMOB 5HHOD 3W9DA 2KH2B 1IM9D 4K71C 1MHCA 2DBLL 2BSSA 3PHOA 3GMLB 1GC1L 2DBJA 4M02A 2APXA 4HGKC 4BUGA 4KKCC 2MQCA 5K9KB 2ZOKB 4K94L 4NDMB 4P5KB 5JDSA 1TTFA 3BKMH 2YPLA 2VDQL 4BQ6A 1FG2A 4XTRC 1A7OH 5I16B 2PYEA 1FZJB 3ULUH 4L29B 1JRHL 2OLDA 4H26B 3EOYG 4OLXL 3RIFK 1S7SB 3MGTA 1P6FA 4NQDB 5IOPB 5GIRA 2FEEI 3UAJC 4BH7A 1MREH 3BEWA 3VFRA 3O2WL 1RV6X 1OP9A 1PEWA 4P2YA 2YC1A 4R8WH 4PRNB 4LVNC 3QHZL 1G6RB 2RFXB 5F72S 3GMOB 4ZS7H 2ERJC 4YR6B 3QEHB 5FGBC 5FCUL 1SYSB 3LQAH 2DI9A 1ACYL 1G9NC 4HEME 5FO8A 2XKNA 3VFMA 4H0GA 3HN3A 1ZHBA 4K3JH 4QHKI 5FO7B 1TTUA 3B3IB 2EDNA 3ZYOA 4BYHA 3DUSA 2ZJSH 1KB5L 4JY4B 4FFYL 4OF3A 5CP7B 5E5UB 4Y2DC 5CBAA 4OCSL 4UT9L 4WEUD 3BZEB 4G80B 3SDDA 1S7XB 5C0AA 5EOTB 1BIIB 5C09B 4Y4FA 4JLRA 1Q9KB 1CLYL 3UTZB 4O5LL 1KXQE 4CVXA 1JPGA 3L9RB 3IVKB 5E2VL 5EPMB 3U46A 1T3FA 4PBWD 3AXLB 1XZ0B 5TE7L 1WAAE 2YD8A 3IJHB 3IETA 5TDOB 4YHNB 3TZVD 3TCLA 3BISA 4NRXA 2RCSH 1NANI 4WUUE 3QIWB 3UBXA 4RSVA 3ULSB 4FQQB 3UYOD 1AQDB 3H9YA 5DK0A 3BFOA 2HRPL 1I1CA 5KVEH 2DLFL 5FCSH 1VGEL 5IEHB 5E2UH 1RZJC 1D5IL 3O4LD 5D1QB 2X4TA 4JFPB 1YECH 2HWZH 4QTHB 5LXGL 2I07A 3WE6A 3IFLL 3M45A 3W11D 3RTQA 2I60L 5E08L 3O9WA 2D7PA 1NGQH 4JJ5B 4L5FL 3SDXF 1M7DB 2HFFA 3H6JA 1QRNE 4WI6A 3RIAK 5I1KH 1XGYL 5F8QC 4M3JA 5E8DH 3WN5C 5C8JB 2DMKA 4TRPH 5HDQH 1H3XA 4K7PL 2JELL 1OW0A 1QHOA 4JHZA 1ZGLM 4PV9B 2LFGA 2PKDA 5IB2A 4R4ND 2N7AA 4ONOA 2VQ1A 3F5WB 4NBZB 1L0YA 1BBDH 1LP9F 2LE9A 4MJ5A 4LGSB 5IMMB 1I9EA 5GGVY 4X6CE 5C7XL 2Y36L 1VFMA 3D85B 1OF2B 1HWHB 5C0FA 1CIUA 1WBZA 2O5YL 3TIEA 2V9TA 3F7YB 4GMTL 5GSRA 2F8VA 3RX8A 3UROR 5LGKA 4CMMB 3FTGB 3NA4A 4FFWC 4DN3L 5CBEB 3CJJA 1CR9L 2LTQB 2DJ4A 2EECA 4PB0H 1LE9B 4JFYB 3IS1X 2AEQL 4YNYB 2Y4SA 1VADA 4NC0B 1UKTA 1TZGL 1FVCB 4ZSOA 3SGJC 4KJWD 2Z93A 3DUUB 3NOIA 3X3GH 3JZ7A 5IKCB 4X80L 4X5WB 3V79C 3HI1A 5C3LD 2ARJB 3LOWA 3TVMA 4PJFA 5GGTH 3ULUC 3X11B 5K9OA 4FMKA 5FAAA 1INQB 4G6AD 2P47B 5FYKL 3B8SA 1YQVH 3IJSA 3DIFA 1KEGH 2VLRB 3U6RA 1RZFL 3VFTA 4ZQKA 4FQIH 1FHGA 4FS0A 1QOKA 3U0WL 3AREB 1JF6A 1IAMA 3C6LA 3VGFA 4MAYB 5DZOA 3ROLA 4D8PA 4U2ZA 2X9WA 4M62L 4NFDA 2CIKA 1QBBA 4Z0XB 4F9PA 1CL7I 4LF3A 4LRNH 2D31B 4JFFA 2ED7A 2Y6SD 4OF7A 3MR9B 4L9LA 4GW5A 3EYFA 4P57B 4ZPVA 5ALCL 5BO1L 5IP4A 5IROC 3FQTA 4ZAKD 3PL6B 2DJUA 1S7QB 4LARH 1IQDB 2ZUXA 1ZVSA 4PJ8A 1ZSDA 4ZO9A 5DD0L 4GRWE 1V7MH 4XVUD 4A6YB 4CMHB 4OI8A 2HYMA 5ANMA 1FH5H 3UYRH 1OB1B 2NY3B 1LK3H 1DLFH 1XEDA 1BD2B 2I5YH 4N0YL 5GSVA 4QRRA 5IVOA 4ZS6D 2EZ0D 1G1YA 4XPHL 1DBKH 4M1GH 5HYQB 5DO2D 3G6JA 3VGAB 1M6OB 2BY0A 4KY1H 5H2BA 5HYJA 2NLJA 3QCUH 3ARGD 1UVQA 3AAZB 5IB5A 2P8MA 4NP4H 4X99B 5DURD 5T1KD 2DYPD 4BM7A 4WDIA 1ZTXL 1PX3A 2R0KL 1I9IH 3UTSB 2NXYD 5JMOC 1EO5A 5F7HA 4KTDH 3BW9B 3IFOA 3T0EC 1G7IA 2P24A 3T0XA 3MLUL 1S7VB 4JDZA 4OGYH 3ES6B 1HOCB 3TZVC 5T1DH 1WICA 4P2RB 2HVJA 4M6NL 3QG7L 5B4MD 1BM3H 1BVLB 3S3JA 5D5ME 3DGGB 5FA4A 1PGRB 4LDEB 5FO9A 2GFBB 1KN2H 4PTTB 1PYWB 3T65B 3ZT6A 5DQDH 1YY8A 2R0WL 2A6DB 4PJGE 3CLEH 5C6WH 1NMBL 5KSUA 5DQ9A 8CGTA 4NQDE 1MFCL 5FA3A 4J8RB 3TBWB 4M1DH 2Z8SA 2EDYA 3GJEB 5IFHL 2A9ML 4R0LA 3P4LA 4DWHA 4LSPL 1EVTC 3P4MA 4U6XB 5F7WC 3W11C 1EFXB 5D2NC 4LPCA 2VTFA 4WUUD 3U4BH 4UOJA 4AT6A 1U8OB 1WZKA 1NCAL 2APFA 2YPKA 2FEEL 3ZYZA 3LKRB 4K71B 4JPKL 1IC4L 5D7IA 2X4PA 1V05A 2W1NA 3D18A 2HN7B 2OZ4A 4N8VA 1I8LA 3GI9H 3JTTA 4JHWL 4R4NC 1SBBA 3RA7L 1XGQB 3IDIB 5CINL 2IMMA 3UO1L 4D0DB 3MFFB 5C2BH 4HF5H 1HYRC 1N2RA 2DQFB 4QLRA 2DQUH 2H9GB 4LAQH 3SKNA 5D72H 1P7HL 5IHBA 1U3ZA 5I1IH 2NZIA 4V1DD 3QAZC 4KMTL 3HZMB 3EYUL 1J8HA 3RWFA 5I8OL 5ESAB 3KAAA 3T4YA 2P5EE 1SJXA 3DROB 2DQHH 5KG9B 1AR1D 4LVNB 5KOVC 2LAAA 4KK6D 5SWZA 1N64L 1H8OA 43CAA 5KTEL 4QYOB 4D9RE 1LEKB 1JBJA 2ERJB 1P1ZB 2J4WL 2P7TA 5HYFA 3V5DA 25C8L 3PWJB 3DMMA 4PJIB 2GUOA 2Y25A 3BKCH 3VI4E 2IC2A 4LCWB 3KPPA 4X6BA 2CKBH 1PZUB 3M8OL 2W9LA 2I27N 1YY9D 3WSQH 4G6AC 3R06B 5HGBB 5JA8B 5F1IB 1H5BC 4H20H 2VLME 2OJZH 1MF2L 1YMMA 4LU5L 4XHJD 4XPBL 1B88A 2H32A 4J3SA 2L7JA 5DMGD 1A3RH 1CGSH 2A38A 1RK0B 4Y2DB 4YE4H 5ESVA 3GJFH 4AIZB 1RU9L 2AJYH 5CCKH 2A74B 1EEZA 3MLRL 2NMSA 3V6FA 2GTZB 3IXTB 4L4TA 5DRWB 1WBYA 1G9ML 3FOLA 5ISZE 4GG6E 3DETD 3LEYL 5ETUB 3HAEG 4MS8C 1MLBB 3BMWA 3I9GL 3VI3F 3FB8B 4E41D 1M4KA 4ZUWB 4TNWK 5IB4B 5JHDE 4XVUC 4PJFF 4N1CA 3P9LA 1S78D 5DFWH 1JTPA 4XXCC 5IUSA 5BMFL 1T89A 3TN0D 2VDML 2IQAA 4OZGF 5C1MB 4ZS6C 1BWWA 1U3HA 2EZ0C 3MLTB 4MNGA 5DJ2B 3CH1B 5EU7E 3O45A 5DO2C 2BY3A 3E3QC 3UBXI 2GIYA 2EDTA 2CIIA 4UILH 2QEJA 4WNQA 4JVPA 1R5IB 2IPUK 3CCHB 5DVMA 4R9HA 2DWEA 3B9DA 5L2JB 4BQBA 4YGAB 3RKPA 4Z7OF 2OTWB 1AJ7L 2JCCA 5AD0A 1I3GL 4YX2H 2NXYC 1MI5A 3JV0A 3N50A 3WN5B 4NT6A 2GCYA 4QNPE 4BZ1H 4WI4A 1H15B 2IGFH 2CLZB 1UACH 5MENB 3A6CL 4Y2OA 2ZSVB 3RX7A 5AG9A 1QSFE 3TO4C 5K33A 1F8TL 5TQ0L 1XF2A 3HG1E 3BX7C 3RWGB 5B4MC 2ITDB 3VD5A 1PEZA 5LKNA 4JO4L 2X2YA 3BZFA 1NCCL 3TYGH 3VA2C 3O2VL 5TH2B 5C08B 2C1OB 2V2XB 3VXUB 3IDGA 4NO5B 2AJ3A 1MAMH 4YEFA 3JV6B 3QQ4B 4RBPK 3QHFH 1MRFH 3KJ6H 3IU3B 1A6PA 2BRQA 3FAWA 1H3GA 4LSTL 1DL7H 4U6HA 1QG3A 3ZKMD 2DD8H 4KUZH 4BKLB 2DQIL 4DGYH 2OL3B 5BW7A 3V52L 4XWOD 4ODSH 1J1OL 2XV6B 2XFXA 1MQKL 2VLLA 2EXWD 1KJ2A 3CD4A 1WAAA 4IDJL 5E0QA 4G6MH 1WK0A 4OQTH 3IT8D 3NCYP 5EZIL 5HHOB 1IM9B 4QHLA 4JM2F 3WHE1 4AH2A 3T2NL 3X3FL 1N5YH 1OVZA 4W6XB 3Q3GB 1DQDL 1D5BB 4BSVB 5ITBL 1AGEB 4R97C 1JGUL 2ADIA 5FIEA 4JR9H 4X0KB 5IB3A 1SEBB 2FSEA 4X83A 2UV3A 3UP1A 3U2SB 2X9YA 5DJCA 3T0AA 1G7QA 3GMMA 4MA8H 1JWMB 4TULH 2F74A 4ZTOH 4OT1H 2G9HA 3LN4A 2DQGL 3WFHA 2OX5A 4NQVB 3MRMA 1LMKA 3TC9A 2EKSB 4X7TB 4UINL 2FBJH 2OI9C 1L4IA 4RFOL 1AR1C 4KK6C 3SHSA 2MCPH 1CZ8H 3NIDE 3INUH 3LQZB 3VFNA 2G60H 5HGHB 4FXKA 4JFOA 4ONGL 4Z77B 1RAMA 2HG5A 4XNYH 5F9JB 3P9MA 3EUUA 4IHOB 3IDNA 4NKQB 4ELME 3V4UL 3MLSL 3LB6C 3BRFA 1YY9C 4JY5H 4WW2A 1RUMH 5DHYB 1ZA6A 5ENWB 1Q0YL 3O6MH 4MSWA 3QFDA 1IJ9A 3WS6C 1JK8B 5IFAH 1FN4B 1I7RA 2H26B 4XHJC 3HI6H 4MXWH 4U7MA 3VXPA 4ZFOL 3PV6B 3GMRA 1U8PA 3L5HA 1MHHB 4DZBB 1FZOB 1HHHB 3C5SA 3ARDD 4DVBB 4DAGH 3DSNA 3GUTB 1A4JA 4M7LL 5DFVD 3SPVB 2WBJA 3L3DA 3DETC 5F1SA 3MGOB 3T0EB 3C2AL 1VPOH 1IFHH 2IAND 5JXEA 1UH2A 2AV7B 1HE7A 2BVPA 4XWGH 1A0QH 5K9JH 4DGVH 3SGDH 3TZVB 1WFUA 5DK2A 4N90D 1AE6H 1JHKH 4P4RB 5HSFA 4JFHE 1RZ8B 4M8QA 1S78C 4MD4B 4IIQA 4X9FA 3TN0C 3W39A 2YZ1A 3MROB 2UY6A 5D6DA 5IK3B 5J1AB 1LDPL 3FHAA 4JAMB 3F7RA 1KJMB 3HC3L 1H0DA 4EBQH 3QUZD 3Q6GL 3O4LB 3U4EB 4M9OA 3MCKB 1SBSL 1U8MB 5B39B 2KDGA 5F71A 1P4LA 3GBML 1R3HB 3C9NB 5JHDD 2D03H 1A6UH 1ZLVK 3CC5A 1P9MC 3EYVB 5D2NB 4RGOL 4OZHF 4AG4L 3G08A 4MQ7A 4ZFZB 1LQSR 3RY6C 3I84A 5DVLA 1ADQH 2V7NB 4L4VA 3MRJA 1QACA 2QQNH 1TCMA 3P9WB 4HHAA 4PP2A 1TDQA 2VDKH 2CGRL 5I75C 3QNXB 3CVIH 5AYUL 1XIWD 1VACB 3QISA 5IVXF 4ZXBA 5I6XC 3SBWA 2NY0D 4XPFL 3ZLQC 2XZQL 4XMKL 4HKXB 4NC1C 3ROOB 5CUSH 4LQFH 1QFWM 1UM5L 1YEFL 5C92A 2YD7A 5JHLL 1D9KA 2WUBL 2IQ9L 3L3IB 5JW5A 3HZVB 2YOCA 3HLAB 4ODVL 1T4KB 4ZO6A 3AY4A 4UIKH 3QAZB 1U6AH 3P11L 1QQDB 1INEH 5M94B 1A1OB 5C0CA 2D0HA 4Y7MA 5IMOA 3ZKMC 1A3LL 3QJFA 4NHCH 1NLDH 4S1DD 5DSCB 4XWOC 4HBCL 1K6QL 1FL3A 2EXWC 4JO1L 3GMLA 4K8RH 3HNSH 4C4KO 4XNUH 1Q72L 3NIGE 3R1GL 1OD9A 2ZOKA 2HFGL 4M48H 4HUNB 4NDMA 2A6KB 3SKUD 3UJIH 4P5KA 5C6TH 5D5MA 1NFIB 5TQ2L 1BAFL 1J0ZA 4I77H 1ZAGA 4WU7A 1UWXH 5I16A 4LBEB 4IOIB 1KIPB 5I0DA 3TNMA 1H5BB 5EWIL 3VA6A 1BF8A 4J1UA 4DVRH 3TO2A 1M1SA 2WSKA 4G6JL 4OM1L 4NQDA 5IOPA 4NM8H 1TVBA 3ZE1E 5M95B 4YDIL 2VL4A 3CLFL 1JNNL 1S5HB 5C0JA 4YZFF 3CVHB 1RQ5A 3FFCB 1O7VA 4M43H 1KFAH 2RFXA 2H6PA 3C5JB 4N8PA 5KVDL 5ABDE 2Z92B 3QEHA 2DBLH 2LVEA 4DEPC 1C5BH 3IFPB 3V8CA 2CUIA 4M61A 4MJ6A 4NQXB 1SYSA 3VMPA 1EO8H 1GC1H 5CSGA 1JTTA 1WVZA 4JE4B 4L8SC 4W70A 3DRQB 2DWDB 3G5VB 4QRTB 4K94H 4O51B 4J3OC 5TE6L 3ZHKA 2VDQH 4HUVB 4JY6B 5IG7B 1KB9J 3IS0X 1XCTA 1JRHH 5GGQL 4Z7UF 4WHCA 4BSWB 4JZJB 4OLXH 2NX5E 5HHVL 5CJXC 3V5HB 4G80A 1S7XA 4X7FC 4Z7NF 3TT3L 5E70A 3TV3L 5J6GA 1Q9KA 3UTZA 3QCVL 2VAAB 3O2WH 3MRGA 2WUCL 4UTBH 1T1WA 2D9QB 2P5WB 1B0WA 4M6AA 5T1KB 2DYPB 3AXLA 4MXQD 3QHZH 4U7KA 3ARDC 1CFQA 5TDOA 4BSJA 2IALB 2X05A 5E94B 5DFVC 4U1NA 2NXYB 3QIWA 4TVPD 3B9KA 1CG9B 1HXMB 1GOHA 1ACYH 1K3IA 1MQ8A 4G8GD 4LLVB 1F02I 2CXGA 1X5XA 3EYSL 3WLWD 3GSWB 2ADGB 5IEHA 5IF0A 3TO4B 4JJHA 5ITFB 4Z18A 1EAJA 3WFEH 1GHFL 2X4SB 1KB5H 4XP6L 3FO0L 4FFYH 2VZ3A 4QTHA 5FB8B 2J8UE 3MRCB 4KGLA 3SE9L 3N0PB 4OCSH 4BH8B 3E8UL 4P4KC 4UT9H 1RUPL 3K4ZA 3QUZC 4DCQB 4JJ5A 1ZLSL 2OK0L 4LFHD 4O5LH 5D7LB 1FLRL 4FN0A 5E2VH 2R2BB 4WO4A 2RR3A 2W9EL 5ISZA 5TE7H 4GG6A 4EDXB 1L7TH 3HMXA 1AGFB 5C8JA 5EUOF 3X13B 3VXQB 3ZE0F 3L3KB 4WGVB 4EI5D 4U49A 3MXWL 3DTXA 4MB4A 5T33L 3WUWB 2HRPH 4WRLA 2DLFH 3Q5YA 1T7YA 1VGEH 1KPRA 3WIFB 3G9AB 5IMMA 1D5IH 1DQLL 3ZTJH 4GKZB 5B39G 3ZE2E 3VGGA 4R97B 1OF2A 4JFXB 2FHFA 2A0LC 5LXGH 1CIDA 3V6BR 2EE3A 5I18L 3BD4A 2F53B 5DMKA 5E8EA 4NNYA 3IFLH 4MWFB 3O3DA 4GRMB 2UYLB 4D9QD 5CJOL 2I60H 1QEWA 5E08H 3SDAD 2OR7A 3C5ZD 5CBEA 3MREA 4L5FH 2NTSP 1LE9A 1U2HA 1MVFA 4JFYA 3QO0A 1ZV5A 3D39D 3G5ZB 3TBSB 3LRSA 4V1DB 1OWWA 3T0EE 1FVCA 3E2HC 4X9GA 5JPMB 4K7PH 2JELH 2OI9B 4HK0B 1NKRA 3HAEA 1UKQA 4QRSB 4X5WA 5IKCA 4S1DC 3SE3C 5I66B 1G84A 1MRDL 3X11A 4XH2B 3QPXL 1QSFA 3V4PH 1E27B 1UZ6F 4GFTB 3QXAA 1XAUA 5DMIL 1IAIH 4QXTB 2VLRA 1ROWA 3HG1A 1G7LB 1PY9A 4OKDA 3AREA 5C7XH 2Y36H 2V5RA 3GJFB 3BIAX 4C56B 2NW3B 3LS5L 2DICA 3T04D 4FQ2L 1ITBB 2X1WL 4N9GB 4MXVF 4GMTH 1YN6A 2MMXA 2AAVA 1WWCA 1FNAA 2D31A 5SWSE 4DN3H 3E6HB 3D0VB 3RUGB 4P57A 4XNQA 5CZKA 1CFBA 1GC1C 1S7QA 3PL6A 4J6RL 1X4YA 2AEQH 2PTVA 3MV8D 2FNBA 1SYVB 2FJFB 4A6YA 4G8FB 1TZGH 2CUHA 2Q3AA 1EAPB 1OB1A 3EYQD 4X80H 4ZYKB 4E41B 1KV3A 3V0WH 1WBXA 3EAKA 1BLNA 2YRZA 4MX7B 1BD2A 5IIEB 5EG6C 1WTGT 3UTTB 5FYKH 2R29H 4KGJA 1JUFA 4OQ1A 1Z0NA 4NOBA 3P0GB 4KZEL 3U0WH 4RGMB 1M6OA 3B83A 2JJSC 5CSBA 1CLCA 3TN0B 1EHXA 2FO1A 2FEDD 4KI5D 3ZMRA 3AAZA 4U0RC 4X99A 3JWDL 1U95B 5A40E 1ZLWK 2V2TB 4M62H 5LAXB 2E6PA 2Y72A 4BK5A 4JPIB 1ZWIA 5DVOA 1T1ZB 2VR4A 2YZ8A 4IRJD 4LLMB 2VDLH 3TBVB 1JPFB 5ALCH 5DRZB 1MWAB 1NBVL 3BW9A 5DA4A 4IOFD 5DD0H 1FRGH 3IRZA 4Z76B 2EE2A 4MXQC 3RDTC 1HOCA 2B7DT 1CK0L 2WM0A 1KPUB 3KLHD 4G9FB 3MSPA 1MCWW 1BVLA 5C0BD 3P30H 5I75B 3DGGA 5IWLC 2BC4B 4HIEB 4NQSA 2GYSA 1T7ZA 3IF1B 4JPWL 2NX5D 5JOEA 4ELMA 2A6DA 3ARBB 4NUJB 2FX8H 3MV7D 5C07D 4J8RA 2AK4B 5JORB 5EZLB 2XPGB 3GJEA 2WQ8A 1YPZB 1YJDL 4YHYC 2ICWB 4U6XA 1EFXA 4OZIB 2KUTA 2ZCLL 3T2OA 4NKOB 4RRPG 5DXWA 4NPYB 4JHBA 4NKDB 1PSKL 4J7RA 1AC0A 4YO0A 1OTSD 3LKRA 1N7ML 4YH6A 3MLUH 2Y06H 5C0RL 3DX7A 3Q5TA 1BOGA 2J8OA 1QP1A 5HDOA 3QG7H 2HN7A 3GSNB 2VQTA 4YPGA 4EXKA 1D5XB 4EI5C 2IJ0C 3STLA 1T7XA 1OSPH 2I26N 3IXAB 4JRXD 5HPMA 1F45A 3IDIA 2F8OA 1J1PH 5EZOL 4Q9RH 3OJDB 3UC0L 3MFFA 3OSKA 1TCRB 1UGNA 2DQFA 1HCVA 3ALWA 2H9GA 1NMBH 1V3KA 4P23D 1MFCH 4U7SA 1O5DT 4PREB 4JHAL 4LHQB 5IFHH 2A9MH 1GZQB 2H3NB 3HZMA 4LSPH 2P5WE 1A4KB 4JANB 5EA0L 3DROA 2VNCA 3C5ZC 5I1CH 5I15L 1NCAH 3WUWG 4R3SB 4DQOL 4QYOA 1LEKA 1U93B 2ZWLT 3OMZA 1IC4H 4DEPB 4Q2ZB 1IRAY 4PJIA 3FB6B 4L8SB 4L9DA 1I1AD 4JHWH 3GGWB 1W72A 5CINH 4LVEA 4M7ZC 3UO1H 5HGBA 5F1IA 1YEIL 3DYMA 3KPNA 5HPOA 4X6DB 5C9JB 1FFNB 3KXFD 3KPQA 1NL0H 3HTLX 1H3UA 5GS0D 1D6VL 4Y2DA 1UH3A 2PCPB 1I3VA 3HFML 4GOSA 4X9IA 4AIZA 2WQRA 2A74A 1BZ7B 3ESVF 3EYUH 5FV1L 4CJ1A 5B8CC 2E6JA 5CGYD 1R3IL 2GTZA 5I8OH 5DRWA 2AEPL 5ETUA 4X5XB 1MLBA 1SJEB 3OZ9L 3FB8A 1JNLH 4H5SA 4ZUWA 3GBNL 5IB4A 5JPNB 5DUPL 1S9KC 5KTEH 1NAMB 3ARDB 1N64H 2AQ1A 2J4WH 3QRGL 2R69L 4KHXL 4DZ8B 25C8H 7FABL 3V0AC 4P5MA 3QEUA 3HCVB 1N59B 2VDPL 4O58L 4J3UA 3EYQC 2IANB 1D7FA 1Q9LA 4MB5A 1MHPL 4QOKD 4WI3A 4E42B 3ECBA 1D6EA 1CXFA 1HYSD 1JPSL 3FQRA 1KIRA 2RJMA 2F53E 1I1FB 1MF2H 3WFBL 4XPBH 1RJYB 4XP5L 1WIPA 3HC0B 2FEDC 4KI5C 4Q58C 1RU9H 2E9BA 4P4KB 5E5RB 4PD4J 3F7PC 3WLBB 3QUZB 1G9MH 1MCCA 1QHPA 1KCVL 3I9GH 2O26U 1YEDB 1Y6NR 2AV1B 4JKLA 1P7QD 2X6MA 3MRDA 1H15A 1JV5B 4K7PX 5MENA 4QRUB 3QPQD 1JGDB 2Q86A 4WEMB 1E4XI 4PJXE 1JZ2A 1A21A 5BMFH 4QWWC 4YEEA 2VDMH 3RWGA 3KPRD 2WV3A 4OLWL 3CZFA 4OSUL 2L7UA 4TVSa 4NCDA 2W92A 4NZJA 4AEHL 3OWEA 5TH2A 3UCRA 1IGCH 5C08A 3UTQA 2V2XA 3VXRD 3VXUA 4NO5A 5ICZA 1PFCA 3IU3A 1JE6A 4KWUA 2EE9A 4D94A 1HQRB 5ICYB 1GJIA 1ED3B 3NCCB 4F57H 2EYSB 1AJ7H 3SE8H 1I3GH 3TJHD 4XRCB 5FGSA 5TDPB 3MLPA 3SE4C 1AKJA 1I3UA 4PJCB 1QSZA 3E2HB 3QEQD 3SGJA 5DD1L 1IM9A 2K7QA 2B1HH 3A6CH 3UTTE 3KPTA 4FG6D 2VLKE 1F3DH 5LCVL 2UUDK 5DC4B 1OOAA 1S3KL 1F8TH 5IVZB 3Q3GA 5TQ0H 1D5BA 4MQSB 3FT4B 2LAGB 1AGEA 1E4JA 2CK0L 1NJ9B 3AFLA 3PP3K 4X0KA 1T7WA 2Z31D 1SEBA 2Y5EA 3U2SA 2J8UA 4LCIH 4K55A 4O2EB 1JWMA 3V0VA 2DDQL 3IKCA 3RGVA 1FZMA 1JHLL 3L5JA 4NQVA 3TGXA 2AJZB 2W0FA 4N1EA 3SGEI 3ARYA 4X7TA 3V52H 4TQEH 2DM7A 5IROA 1MQKH 4RGNE 3OR6A 4YWGL 4IDJH 1DQQB 3O3EB 5EZIH 4R26L 5HGHA 2NY4C 1LE5B 5JW4R 5F9JA 3X3FH 2JB6B 3CSBA 1UKSA 4IHOA 1DQDH 4H1LH 2AS5M 5ITBH 4D0CA 1GGCL 4MNQE 1JGUH 1I1AC 4C57C 2AK4E 4N9OB 4Z7VB 2D4FA 4UV4H 3NFNB 1FN4A 1DN2A 2H26A 1UFUA 3PXJA 4NGHH 4UDTB 4U0RB 4F15C 3PV6A 3FKUS 5DRNB 4OZIE 2DQGH 4DZBA 1T04A 3QDMD 3BPCB 2A6JB 3GUTA 2R1YA 2WBKA 4NO0B 3JWOH 5AUMA 1CDUA 4W4OC 2QV2A 5EBLB 5T3ZL 3RNQB 4YBHA 2YUXA 4UINH 1YDPA 3MGOA 3KYNB 4QHNA 3T0EA 4I3SL 1WWAX 4RFOH 3D3VE 2V9QA 4K3EH 1QSEE 4DOHB 1MH5B 3RDTB 2EDQA 4ODHL 4MA3A 5EOCL 3TZVA 2QTEA 1A7RH 4P4RA 5AAWA 4X8JB 3TYFB 5KS9B 1IC7L 3C09C 4PJDF 4EDWL 1U8IB 4G8GB 4KAQL 3V4UH 3MLSH 2AABL 2Y5TA 3MROA 5J1AA 2EYRB 5DHVB 1KCKA 1F4AA 1KIQB 2FX7L 4MGXA 1MFEL 1Q0YH 1Q9OB 4PJ5E 1G9MC 3O4LA 2CDGB 3U4EA 1HYSC 5DD5H 3MCKA 4XPGL 4PGZA 1U8MA 5B39A 5L2KD 3CIQA 2R4RL 1OARL 1R3HA 3C9NA 1JWUB 3PWUB 3MA9H 3NGBC 4YHYB 5SWSA 2ZCHL 4EUPH 3EYVA 3OAZH 3REWA 5DRXA 1JPTL 4U1HA 2ZSWB 1UYWL 2YRLA 2V7NA 3C2AH 2F8XC 4EJ1C 2H45A 3DX8A 2YUZA 5ECJE 3ILQC 3QNXA 4PJ9D 1ZLUK 1FYTB 1FL5B 1PG7W 3QPQC 4EI5B 3C8HA 1GGYA 3FQXB 5FGCE 2BCKB 2EEDA 5J06A 4WFGE 2GEEA 1KCRL 3QG6A 2HTKD 1LDPH 3ROOA 3QR2A 3HC3H 3L3IA 3Q6GH 3SJVE 2L4OA 1SBSH 2OR9L 1HCFX 4JREB 3GBMH 1G6RL 2EDWA 1UEMA 4F7PB 1QQDA 1Q9WB 4CUCA 2BNQD 1NBYA 4RGOH 4AG4H 1CDHA 5F7FA 4YHPA 3C5ZB 3LHPL 5GGTA 4UT7L 1FFPB 3D39B 3DXAE 1A7QL 2X4RB 4HLZH 1Q8MA 1KOAA 1ZHKB 2CGRH 1NAKL 3G6DH 4OZ4A 3BE1L 3VRJB 5AYUH 4FXGB 1FNEB 2FRGP 2RBLA 5KOMC 3VW3L 5DEGA 1X7QB 4X98B 2HT4D 5EU4B 3VD7A 4F3FB 4Y4KC 5B22A 4FG6C 2SEBB 4XPFH 2XQYK 4Y5VC 1DBML 2Q8AL 4LBEA 4XMKH 4IOIA 4M7ZB 2XN9D 2CR6A 5F9WC 5T3XD 4GW1B 1EMTL 1UM5H 2ARWA 4L8CB 1YEFH 2FZ3B 5JHLH 4U3XA 2WUBH 1R5VB 2BVTA 2WINB 2IQ9H 5FYJH 3DWTA 2Z31C 5MP6L 1AD9B 1VB9A 4ODVH 4XPTL 3CVHA 3FFCA 1RJZB 3O6FD 1GL4B 2EH8L 1GVIA 1AR2A 2E5EA 3P11H 5B8CB 5GRWA 1CD0A 4U1MA 3CFDB 1A3LH 4MDJB 2L0DA 3IFPA 4PJHE 4YAQB 4HBCH 5E5MB 1AXTL 1K6QH 4JO1H 1F4YH 3MV8B 5DDHB 4U1KB 1Q72H 3DRQA 3R1GH 2XWTB 2DWDA 4QRTA 1QBML 3IDJB 1R5WB 4KUCD 1BAFH 4HUVA 4Y8DC 3ZZ1A 3DVFA 3QZWB 3QJHB 1M71B 1CF8L 4QHUB 4O2FA 5EWIH 4KKLD 4JZJA 5GRXG 4CBPA 1DE4A 4G6JH 4OM1H 4PJ7F 5D1ZD 5DT1L 2ESVB 4RISL 3LV3A 1NH6A 4YDIH 3CLFH 3QDAA 2GI7A 1WFNA 1NFDB 4RGND 1WF5A 3RJDA 2MFNA 2VAAA 1ZANL 2VXQH 2P5WA 2DYPA 5KVDH 4OCYL 2IALA 4CNIB 5E94A 5FUCC 1QR1B 3L5IA 4XMLL 4RRPA 5INCB 4HUWA 3WEXA 2BVQB 3O11A 5IJKC 1MSPA 1B3JA 3H3PL 4LLVA 1SQ2N 3RL1A 4MNQD 1HH9A 1JZ5A 4NZUL 1HEZB 5HHPA 3QDGE 1T1XA 2ADGA 5IEKB 3BIKB 3NZHL 3TO4A 5TE6H 5ITFA 3ZDYE 4J4PD 2X4SA 4RX4D 5C0BB 5FB8A 3C60A 2HLAB 5GGQH 2H1PL 4BH8A 5L8KB 5HHVH 2B4CC 5GZOD 1MJJB 4M03A 1JZ4A 4DCQA 2NR6D 3TT3H 9CGTA 3TV3H 2AEIT 3KNBB 1AGBB 4K3DL 5D7LA 3CFCL 2BMKA 2WUCH 3O3AB 3D3VD 2R2BA 5D8JH 5F7UA 4TN9A 5I76A 4EDXA 1NC4D 1AGFA 3KYKL 1HINL 4QHKJ 3VXQA 1KPVB 1F58L 2OMBA 3DRTB 3RVUD 1U41A 2BRRH 4Q0XL 1TETL 1RJLB 1QLRB 2XXCB 1JN6B 3WUWA 4I13B 3HR5A 2EDBA 2A73B 2HFEB 3DECA 3EYSH 3RU8L 4NKIL 2VLJE 3G04B 1Z3GL 2JLLA 4PJ9C 1JF5A 4PJ5D 3U36B 3UZVB 3WFZA 1GHFH 4XP6H 5F9OL 4JRXB 2PR4L 3FO0H 3UPCA 1WCQA 4JFXA 4P2OA 3SE9H 3QDJB 1K2DB 2F53A 2OP4L 4HPOL 4JZOA 4MWFA 1OP3K 3DVIA 2HTKC 2JIXD 1ZS8A 3E8UH 1PG7X 1BFOA 1RUPH 3F58L 5EC1B 1ZLSH 3V6OC 2OK0H 3R8QA 4JQXC 3TBSA 4V1DA 1ORSA 2M2DA 2W9EH 3L3HA 1G7JB 5HDBE 3M1BB 2LU7A 4HMCA 4XP4H 3VH8G 3ZTJG 4QY8A 2CKBA 3QWOB 2P48B 2FL5B 4XCYB 5T33H 5I66A 4C83B 5BCAA 4O02H 3TP4A 1YEGL 2VUOA 1WSST 2J1KA 4PP1D 2NY4B 4PJXA 3FO1A 2Y23A 5GGSB 5CD3A 3FT3A 5AAMA 3KPLA 1DQLH 4KU1A 1MFAL 1T21A 3O3UN 3QDHA 4XNZC 3WHE0 2HT4C 4HGWA 3GJFA 2IBZX 4F33A 1I1AB 4C56A 3CMOH 1HNGA 2LQRA 5I18H 4F9LA 2BHYA 2GITA 4N9GA 4XXDA 5HI4D 5T1LA 2E7LC 1CS6A 2VERN 5CJOH 1KCUL 3WS6A 2E7CA 1BF2A 2BSTA 4HIXL 4F15B 3G6AB 4A2LA 3E6HA 3D0VA 4M5ZH 2JK5B 4B7IA 5FXCH 5CFHA 2VUYA 5CILL 1F6LL 1SYVA 3LKQB 1XFPA 3O3BA 2FJFA 1AIFB 1LD9B 3CGTA 3SO5A 4NWUH 5CLWA 1EAPA 3DO3A 1MCPL 2C9AA 4OZFB 4ZYKA 1EH9A 2AW2A 1FYTE 1MRDH 4FNLL 3UTTA 1T20B 2UY7A 3W81A 1HILA 3QPXH 2VLKA 3BXNB 4POUB 5DMIH 3QI9D 4HG4K 2UVFA 1X5GA 2K9UA 1KGCD 3C09B 1OD7A 2ARJQ 5GGVL 3L5XH 3LKPB 3L5WB 3DV6A 4HKZB 3LS5H 1FC2D 4FQ2H 4XNMB 1U95A 4QOKB 3VJ6B 2V2TA 1ZXQA 1F3DJ 3H9SE 4JPIA 3CX2A 5D1ZC 1T1ZA 1UXSB 1RUKL 4HH9B 2IPKB 2QSTA 3BQUD 4LLMA 4OD2B 4TSAH 5JUEL 1MWAA 3NGBB 4J6RH 1IAIM 4QRPE 1AI1L 4JKWA 4Z76A 1CICD 1U8NA 1WTLA 3ZDZF 1QUNA 4ZUUB 5HYSB 1U92B 4PIRF 3RY6A 4R2GB 4G9FA 1YZZA 3SN6N 2EXYC 3ARWA 3FB7B 3QZWG 4I3RL 3LN5B 2BC4A 4HIEA 2XTJC 3T1WA 3KYAA 5HHXL 4WHYH 4FQXD 3MRLA 1HK6A 3ARBA 4KZEH 2M26A 4PTUA 4NUJA 5INDB 3GSVB 3KPRB 2AK4A 5JORA 4HULB 4PY8I 5EZLA 2XPGA 4PGCB 4XT1C 5D2LE 3WNNA 3JWDH 5CLTA 5ESQA 2ICWA 1KJ3L 1UB5B 5F7LB 4JFEE 5FOBB 4OZIA 3VXRB 2ZUUA 2X70B 5GZOC 4IRSA 1X5KA 1R3LA 5E00B 4NKOA 5DZNA 4NPYA 2NR6C 4NKDA 1NBVH 4OQTA 2G2RA 3NCEB 3L3OB 4WV1B 3CDCA 3GFUA 3QDGD 5FYKE 4PJAB 1FIEA 3GO1L 1IQWL 4WI7A 1CK0H 2GQHA 1XF5B 1QSEA 4Z7WE 4JRWA 4PLOB 2WIMA 1D5XA 3RAJL 2YEZA 1ZGLP 3IXAA 3MLYL 4JKMA 3HMWL 3QEQB 1N8ZB 1I7ZB 3OJDA 1EZVX 1BEYH 1TCRA 4Y4KB 1I8MB 3QXUA 4UB0H 1N6QH 4Y5VB 2X1PA 3DX9A 2ESVE 4K3HA 3I6GB 5F9WB 4EOWH 4PGJA 2NY5L 5BOZG 3VFUB 1BVZA 1GZQA 2A1WL 2H3NA 3I75B 3QA3A 4R7NB 4X4XB 1YJDH 2Z31B 5HHMD 1A4KA 2ZCLH 3EO1A 3HRZB 3BJLA 1PSKH 1V3MA 3UTPD 4R3SA 4NC2B 2HKFL 1OP5H 1ODAA 1MNUL 1HKLH 1U93A 1N7MH 2BNRD 3SO3C 5LQBH 5C0RH 4Q2ZA 1KTKE 4H1LB 1FAKT 4OLYL 4IEFB 3FB6A 1E4WL 3GSQA 4ZFGH 4L8SA 1RZJL 5CEZD 4M00A 2AI0H 2DKUA 4U6VL 3MA7B 3KWWB 1TENA 3MJGX 5EZOH 3UC0H 3MBED 3NA9H 2QHRL 1XGUA 3HZYA 3O4OC 4X6DA 2R1WB 3C8KA 4IMLB 1NGWB 1UCBL 2PCPA 3PWVA 4OJFH 4JHAH 2GK2A 3OJ2C 3SJVA 4HLJA 5HI4C 4RIRA 3JXAA 1XGPA 1RIUL 4X5XA 3PF2A 4P9HC 3ARQA 2NTFB 3VXSD 5I15H 5JPNA 5B3JF 1NAMA 4YHZL 3QDMB 4PLNC 1GCFA 2PW1B 2VITB 1CFTB 5DJ0A 3H2WA 4DZ8A 1JI1A 2ZG2A 1NGXB 3MV9D 3RWIB 5GRZA 4JO3L 4BZYA 3STZB 3VWKA 3U7YL 4X6CF 1OGAD 3NCYS 4E42A 1B90A 3P77B 5EB9A 3QDJE 1YEIH 3V95A 4ZFOB 1I1FA 5BV7H 3RBGA 3QI9C 4DKFH 1RJYA 3S88L 1YEJH 4UDUB 4L3CB 1D6VH 3DGCR 3HC0A 2OL3L 3HFMH 4P4KA 5IBUB 3RUGF 2EDOA 4QCIB 1R3IH 3QUZA 1ADQA 4FTVD 4PG2A 5A43C 1HHGB 2B0SL 1A1MA 4U6TA 5L2KB 5I2IA 3OZ9H 3BQUC 5FFLA 1MCOL 3BOVA 5CEXB 5DUPH 1XT5A 2XNAB 5TGBB 5EO0B 1YEDA 4HUXA 3S3SA 2MNUA 2DS4A 1EO7A 2VR5A 1TQBC 3QRGH 1JV5A 2R69H 4QRUA 4KHXH 1JGDA 3AS2A 7FABH 4OTXL 4EEEA 4JG0L 3RIFF 4O58H 3ZKSD 5EOQL 4WJ5A 3JWDC 3K80A 3WDHA 1J05B 3GKWL 1MHPH 4PJ9B 3VE0A 1JPSH 4ZDHA 3PIQB 4M8VA 5I74C 1SJVA 1Z9SA 4FQXC 4YQXL 3T0DA 1K9TA 4LSVL 4XP5H 1IL1B 4JFDD 3L7EB 2PO6A 1SY6L 4CGTA 1A5FH 4WWKA 1G9EA 1NGPL 4NNPH 1OGTA 1L7IL 2W60B 4MDIB 4LDLB 2FX9L 6FABL 1KCVH 2DQTH 2A83B 3CDGB 2J8HA 4XRCA 2W59A 1LEIB 4YUEL 3MMEB 1AO7B 5IJVA 5D93B 5IB1B 4NFBA 5EULV 2OTUB 3GB7A 2VZ1A 1A6WL 3HE6C 3SE3A 4O2CA 5MHSD 2F54E 2ENYA 3FT4A 2KZWA 4OLWH 2PW2B 4Q6IC 1YJDC 2EEBA 4GAFB 4PV8A 4AEHH 4XNZB 4ERSL 1TIUA 1HDMB 1YPZF 2IH1B 4ENED 1QR4A 4PRPB 3MRBA 3VXMD 4O2EA 3RVWD 1A8JH 3QUYA 3RWHA 1XR8B 1EIBA 3ULVL 4X7DC 2BOBB 2XN9B 4XC1L 3GRWL 5JA9A 1ZOXA 1R6VA 4S11A 1VEPA 3S34L 5JIKA 5F7DB 2W65A 5DJXA 2YD1A 1DQQA 1ZT4A 5I8CB 5DD1H 1A2YA 3A6BH 1NMAH 3H7BB 2VL5A 2C3WA 4WIQA 2JB6A 5LCVH 2FB4L 1S3KH 1JZ3A 2VLJA 1Z9MA 4PJGF 3OKDB 2XWJB 1C5CL 2HJKB 3PDOA 3OHXA 5GRVK 4LCCA 3RIAF 3QIUD 4YGVB 3HE7C 4LPWA 1U42A 2JJSA 1S7TB 1OAXL 3JTSA 1EK3A 2VRAA 1FJ1B 2DDQH 4PRHE 4ALAL 2CD0A 4L8DA 5C0IB 2NY6D 1RK1B 1JHLH 2PXYB 3BPCA 5FYLD 4NNXB 4LIQL 3TPKA 3FQUB 1GSMA 4NO0A 5D1ZB 3KPSE 5IQ9B 3FFDA 5EBLA 1QO3B 3K81A 4H1LG 2OZ4L 4HWZA 3BJ91 1KJVB 1FL6B 1MH5A 3RDTA 1BFTA 3O2DL 5C0DA 4WFEE 4R26H 3V2AR 4AJ0A 1E28A 4YXKH 1KB5A 1UM6L 1OCWH 4P5TD 5CEYA 4X8JA 2K1MA 2LU4A 4HJGB 1AP2B 5D7JD 5BQ7A 1U8IA 1UXWB 3OGOE 2XTJB 3CUPB 3EJYD 1GGCH 4OFIA 2EYRA 4X6DF 3BZ4A 2GK0B 3ZSTA 1KIQA 3DVNA 3SCMD 4AQOA 4BELD 2I9TB 5EZJB 1I8IA 3U82B 4RQQB 3FRPG 4EN3D 3IJYA 2BY2A 1K5NB 5JOPD 1RIVL 1JWUA 3PWUA 4GAYA 2CH8A 4P0DA 2Q3ZA 5CZXD 2FYYB 1KTLA 4XB7A 1YEHL 3I6LE 3QFJD 3N06B 2BVOA 4NYLA 1T80A 2ZSWA 3QWRD 4N0CD 5T3ZH 1QVOA 1V5JA 4R4FH 3W9EB 2PTTB 4I3SH 1DUZB 4NQED 4NO2B 4F37K 4XBPB 1Z5LB 3B2VL 3U0PA 4ODHH 2I9LA 2X1OA 4R7DB 5EOCH 2XZCL 1A3QA 2ICWI 1FYTA 1FL5A 1UM4L 4X9HA 1NDMA 1HQ4B 4G3YL 5EIVA 4LOUD 3FQXA 4X9BA 2BCKA 4KAQH 4WU5B 1Y0LA 4EUPG 1TJIH 3SDXE 5IBLC 1S9XB 3MUGA 1I3RB 2FX7H 5ACMA 3LKNA 1C08B 3WD5L 2R4RH 1OARH 5J56B 1IE5A 3L95B 4F7PA 4MAUL 5F7MC 5BZDB 1Q9WA 2ZCHH 2JIXB 4L3AA 1JPTH 4ZUVB 3C5ZA 3J8F7 4KK8D 1LP9E 5E8PA 4DTGL 4QRPA 3BN9D 4XP1L 2EDKA 1NC2D 2X4RA 2EIZB 4ODUB 4LP5A 1A1NA 3SO3B 5EBWB 1ZMYA 5ID1B 4OGXL 3RBSA 1EGJL 4FXGA 1FNEA 5JOFB 1N3NA 4YBQC 3SDCC 3SY0A 3OB0K 4I4WA 1X7QA 3ARFD 3REVA 1PZ5B 5E1AA 4F3FA 3RWJB 2C3VB 2VWEE 3O8XA 3QXTA 4K07A 2BOCB 3S96A 2R1XB 2FZ3A 2V2WB 3O4OB 3HB3D 5BRZB 2WINA 3I6KA 1ORQB 2APTA 4JDTL 1AD9A 2DI8A 5D2LA 2OR9H 4HLZG 1EJOL 1G6RH 4GW4B 2IH3B 1N5AB 5B8CA 3D2UD 5D9SB 3CFDA 5EU6E 1ZVHA 4PGBA 4KXZI 3HNTL 4EVNB 1HWGB 3T3MF 4MDJA 4PJCF 1MRCL 3LHPH 2YUWA 3QT2A 2MHAA 4P3DA 5F3BB 3GMPB 1A7QH 3HS0A 4PBXA 3MV8A 5DDHA 5E99H 4D9LH 1NAKH 4C59B 3BE1H 4HXBL 3EGSB 3ALPA 5HD8D 5GGRB 3VW3H 3IDJA 4RMVA 5GGUB 1J0JA 4OCRL 2Q8AH 3T4AA 1DBMH 1LO3L 3QZWA 2Y9RT 3QULA 3QJHA 3S97C 4QHUA 1UH4A 3SGDI 1CD1A 1J10A 2R0LH 1JNJA 3B2UD 3QI9B 2ESVA 3QIUC 1FVEA 5MP6H 3HRPA 5JQ6L 3LRGA 4XPTH 1VFBB 4X6FA 1IGJB 3PGCB 3UJJL 1QLEL 2NY6C 1LK2A 2H41A 4L1HA 1SHMA 5ADOL 3OGCB 1BMGA 3T09A 3BQUB 3LQMA 1MCSA 5INCA 2PYEE 3LSOB 2V5YA 2BVQA 3LPFA 2B39A 4QXWA 5HHQA 3GK8L 2VE6B 3WS3A 1TQBB 1FNSL 3P4OA 2RQ8A 5IEKA 3GEWB 4RA0C 3RI5K 5I1HH 2IBBA 5L6YH 5FYJE 5BOPA 4P46D 4P5TC 4RFEB 3CDFA 4Z7VF 5SX5K 2A9NL 1L9NA 2HLAA 1E4XH 1IC1A 1CF8H 3EJYC 4TYUA 5I74B 4FQXB 5DT1H 3U0TB 3MV11 1DVFA 2EIBA 4ETQA 4JM4L 4RISH 1MJUL 4HD9A 4OLZH 4HT1L 5I19L 4EN3C 1UJ3C 1ZANH 3HZKB 4WVRA 1T2QL 2GSGA 5CZXC 5D1XD 1T5WB 4OCYH 1KPVA 2ORBL 4JFQB 2Z35B 3DRTA 1EXUA 4KK5D 5A2IH 4N0CC 3NIDF 5HGAA 4ELKA 4LHUD 3SE4A 1HHIA 1RJLA 3FQWB 3H3PH 3S36L 2A73A 4NZUH 3CXDL 4NOFA 5KS9F 4UV7L 1S9VB 2Z4QA 3G04A 5E8OB 3LPWA 5L8JB 3NZHH 3HE6B 4G7VL 4ODTL 5FHBL 4YDKH 35C8L 3PQYD 4XAKE 3RPKA 1KLGB 4LOUC 3VD4A 4Q6IB 4K7PY 3CFBA 3QDJA 3WJJA 1K2DA 2H1PH 4KRMB 4TNWF 5GHWL 3H8NA 3T1FB 2DOCA 1A47A 5A1AA 1WITA 5EC1A 2A2QT 4K3DH 3BD5A 3CFCH 2YD3A 1ZHNA 4OCMC 1C7SA 1G7JA 5HHMB 4FQLL 1HINH 5CGMA 1U3YA 1NLBL 1I9JL 1F58H 3QUXD 5EO1A 4KV5F 2YKLL 4JGJA 4KK8C 4Q0XH 2FL5A 3BH9A 3AS1A 5ALBL 2BNRB 3PHQB 4LDOB 3RU8H 4NKIH 2XTJE 5D71L 3RQ3A 4HIIB 1JCKA 1IMHC 5AWNL 3ARFC 4POZD 5EUKB 5F9OH 2PR4H 1I1AA 3ESUF 5GISH 4HCRL 1DBAL 5JIIA 1H3PL 4POYA 2OP4H 1UA6L 4HPOH 3HE7B 5F88B 3JV4B 3MRRB 3HB3C 2P8PB 3D69B 2VDNL 1AC6A 1RI8A 3F58H 3G6AA 4LLUB 4PRBB 4M5YL 1GYAA 1U8KB 1J0IA 2JK5A 2UZYB 1EEQA 2PNDA 2W07A 4A6YH 2HP4A 4Z9KB 4P99A 3ARTA 2BNUB 1ND0B 1CU4L 3LKQA 4W4OA 2HA1A 1AIFA 4GBXA 1VERA 5DTFA 5I9QC 1LD9A 3ELAT 1HSBB 3DX6B 3IB4A 4LLYB 2GJ6E 1PKQE 4OF5A 4S0TD 4HAGA 4L4JA 3S35X 5BVPH 1IAKA 1VFUA 1UC6A 2C3XA 4TSBH 2AXGA 2M8XA 4JB9L 5KANG 1YEGH 2V5MA 2VZOA 1MFAH 3MV9B 1EV2E 2XIDA 5HD8C 2XT1B 5DEFB 3T77B 5I1DA 3OF6D 2D7MA 4OF8A 3VI3E 3LIZL 1OGAB 4XNMA 4QOKA 3TJEH 3VJ6A 1K85A 1EFQA 5EU6D 3SKMB 3U4AA 1KCUH 4KJPD 5C0EA 5FF6B 1X5LA 3VXOB 5BS0D 2F15A 4HH9A 3QRFM 4PJFE 4OD2A 4YFLI 3EOAA 2X10A 5CILH 2E8ZA 1JHTB 1Y18B 3GSUA 2QADD 1DEEB 1ZK9A 3DYPA 5DMJB 3E1F1 4ZUUA 4OZGE 5BJTA 3EDEA 3GSNL 5TJWK 1U92A 4JFZL 1HHJA 1MCPH 4CKVX 2FO4B 2PTUA 1BZQK 1OL0A 4OV5A 3ET9F 4FNLH 2YUVA 1U58A 4LLQA 2DTML 2UWEB 3IDMB 3PGFL 1YYLH 4N8CL 1NQBA 3OAYK 5E2JA 4NZTH 1MCNA 5GGVH 5INDA 5BRZE 4OFKA 3KPRA 4Z7OE 1T66C 3ZE1F 1VFAB 4PJBB 3AB0C 1KTDB 1NFDF 1X4ZA 3MNZB 4M3KB 1ZHLA 4YHOL 1UB5A 2YPLD 1Q0XH 3UYPA 3MYJB 4HFWA 3IAQA 4PRHA 5FOBA 4PRIE 2Y7QB 5ID0B 2X70A 1RUKH 5DHXB 4XAWL 5E00A 2A6IA 4JFDB 4BFIB 3E0GA 5JUEH 4LEXL 3WFCL 5JNYB 5LWYL 2JKXA 3L3OA 3P40A 4WV1A 1AI1H 4WHYG 1S7WA 1IGYB 5D1XC 1K8DB 1JIBA 1A6ZB 5BVJA 3TCXA 4KK5C 1IZKA 4OGZA 2EIDA 3CX5J 3LS4L 4WI8A 4Z7UB 4I3RH 1BHGA 4EI6B 3SDCB 1I7ZA 2R56H 3MRPB 1A9BB 4Y4KA 1I8MA 2DIJA 4KROD 5IMLA 3W0WE 2CO7B 3P3YA 4XZUA 3K0WA 3I6GA 4MD5A 3ZTNL 4PUBL 1KCLA 1U8QB 5IV2B 5F1OB 3VFUA 4QGYA 4Y19B 3I75A 3MBXH 1TLKA 1A6AB 1KJ3H 3AM8A 4PRAB 5CP3H 1UJTA 4HKBB 3VXMB 3C2SA 3HRZA 1CGYA 3PP4L 1DZBA 1LO4H 3SQBA 4GUPB 4XBGB 2OXGA 1RUAL 2CQVA 1NUDA 4HKJB 3RY4A 1TFHA 3GO1H 3SDDD 5C0AD 1IQWH 3HI5L 4I18C 4Y4FD 1LO5A 2VSDA 3IAPA 2CMRL 4H1LA 3QUXC 5J9PB 3RAJH 2Z8WC 3BH8A 1NPUA 3D0LB 1TNNA 3MLYH 1TJHL 3BKJL 4NHUA 3VWJC 2DL2A 5A2JH 3MA7A 3TA3A 1DANT 3KWWA 1PD6A 3KYMB 3EDFA 1UWGL 1YEEL 12E8L 3FT2B 2J2ZA 1NGYA 5J0BA 3SDXA 1F5WA 4X4YA 4IMLA 4PGEA 5EOCJ 3UDWC 3CFJA 2NY5H 4XVSL 2A1WH 2ZUTA 5EUOB 3B4NA 3QIUB 1UZ8B 1FGVL 1ULVA 1K4DB 2NTFA 5D6CA 2Z8RA 3PDGA 2NY6B 5F7YC 2HKFH 1J5OH 3ABZA 3RTQD 1CFTA 1MNUH 2W0KA 3O9WD 1IZJA 3EOTL 3EOBA 5CHNB 1CT8A 2HRLA 1ZA3A 2AJVL 4JN2B 1NGXA 4PS4L 5DD6B 4OLYH 4TUJA 3RWIA 1E4WH 1BQHB 4RMRA 1RZJH 3ZKND 4OUOA 2OSLA 3P77A 4GQ9L 2QHRH 4ZFOA 4P5TB 3LDBC 1S8DB 3GIZL 4EUPA 3QNZB 5CMAB 1UCBH 4I0PC 5A2FA 4GMSH 4H25B 2FGZA 4QRQB 3SKJH 4QCIA 4JQVC 4DK6A 4MD0B 3I02B 4N0UB 4UMGA 3QYCA 4HH8A 4P2QE 2X4QB 4KJPC 4EN3B 1UJ3B 1RIUH 3E6FA 1MIEL 4NRYA 4GRLC 4D3CH 2EH7L 1IEHA 3T08A 5TGBA 5EO0A 1HXYA 4UBDD 3QFJB 4AYFA 2GY7B 1KN4L 1VFOA 4R90L 3D5OF 3BGMA 1NCUA 1RMFL 2R8SL 1T1YA 5IFJA 1DDHA 2QLVB 5J11C 5JW4N 4JO3H 1J87A 2VN7A 3OX8B 2GJJA 4ODWA 5E9DB 1J05A 5LGHL 2DI7A 1AD0B 4PYHA 1B0GB 5GS1C 3PIQA 3DVGB 3HNVL 2QQKL 2CRZA 2GAZA 3TVMD 4TUOB 4OZHE 3S88H 1IL1A 3PJSA 3L7EA 3N1QC 4QT5A 2FHBA 2OL3H 4ISVB 3DUHA 1AQKH 3T3PF 2D9CA 4HUKB 4NUGL 2W60A 4MDIA 3CX5K 5F7NC 2A83A 3C6LD 5DGQA 3V6OA 4QEGA 3CDGA 5FKPB 5IVXE 1MCOH 4YK4C 4W4NA 1AO7A 4OCWL 4MNGE 3BDXA 5IB1A 4JFFD 4DFIA 5KSAA 4KTEL 4MVBC 3MUY1 1JGEB 2WP3O 1PJ9A 4OTXH 2PYFB 4JG0H 1SEQL 1S9YB 2P46B 1NC2B 4PJ8D 5EOQH 1RVFL 1YMHA 2PW2A 5HDLA 3GKWH 4J2XA 4LSSL 4UIMB 1SM3L 3ARFB 4HQQH 2JCCE 2LABA 2BDNL 1ZE3C 1MI5E 4YQXH 4KROC 4PRPA 5H37H 3Q2CA 1SY6H 4QRRD 5AEAA 4BQ8A 4HIHB 2CLRA 5HHNA 4GG8B 2BOBA 1WZ1L 4G6FD 1NGPH 4RDQF 3A0OA 4APQC 1L7IH 4Z8FH 2H8PA 2E27L 2FX9H 5F44A 6FABH 1G0YR 5HYJD 5F7DA 2ENSA 4PJAF 3TIDA 5KSVB 4CVWA 1CLZL 4YUEH 5I9QB 3D2UB 4Y1AB 4XCCL 3O41A 4TVPL 1JYNA 1GGIL 1OSZB 1XF4B 4LKCB 1BFVL 2Q1EA 5KW9L 4N0FB 4GAGL 3TPUB 3WXVL 2HKHL 3ULVD 5E7FA 1BZ9B 4Q9BA 1XCQA 1BJ1H 4QTIL 2NY5C 4I9WE 3A67H 4YZFE 2Y07H 4ERSH 3O6KL 4LKXB 4OKVB 4MLIA 3IYLW 1ETZA 2OS7A 4GKNA 1FJ1A 5IMKB 3QUML 2AKRB 4PY7B 4XC1H 3GRWH 4OM0L 3KYOB 1HHKB 1RK1A 4PRDB 2PXYA 2HJFA 4LNRB 3FQUA 4ORZC 5E03A 2DLGA 5D1ZA 3TBYB 4U1SB 2X7LA 2IBZY 2P8LB 2R15A 4Y4HD 15C8L 2W0LA 5IT2H 3WNLA 5E4IA 2E9JA 4AM0A 1CD8A 3U1SL 1KJVA 5J4MA 2V6HA 5GS3A 1XF1A 3DHMA 4HZAA 3WIHL 4Z7UE 5H8DA 1I9RL 2YPVH 3D25A 3IFNL 3O9WC 4TTDC 4XX1G 4HS8L 3MC0A 4HJGA 5CIPB 1AP2A 2FB4H 3B5TA 4J12A 1DUYB 4JCMA 3RWDA 3CUPA 3UPAA 3ZKNC 1C5CH 4YIQB 2AJXH 3VFPA 3IAGC 2RIKA 4ZUSA 4KDTA 2I9TA 1I8KB 1X5FA 4Y19E 4RQQA 1DTUA 1OAXH 2GT9A 3X12B 1K5NA 4KRPD 4ALAH 3AB0B 1AXSB 1HZHL 1LVEA 1CLOL 4LIQH 4WI5A 2YSSA 5H35B 2VH5H 1HIMH 4Y0GA 3W9EA 2PTTA 2DJSA 1DQJB 1DUZA 4CDGC 4NO2A 1F4XL 1OQXA 1J8HD 3O2DH 2GJ6A 1PKQA 4XBPA 5D1XB 1Z5LA 4UAOC 4FZ8H 1UM6H 1HQ4A 2XG5A 3OPZL 3U48A 3RZCD 4WTZG 5SWZD 4XX1E 4WU5A 4URTB 3FQNB 4UNTA 4L3ED 3RL2B 2F19H 1S9XA 3T0WA 2WK2A 1I3RA 1QFWL 4GS7C 2FWOB 3OBAA 3BHBA 4XMPH 3PQYB 3D48R 5ERWB 5EUOE 1C08A 2ZKHL 3TVMC 1TJGL 1RIVH 2BP3A 2DLTA 3L95A 3PWPE 2PUQT 5BZDA 1FFRA 1FNHA 1YEHH 3BP7B 3JWNC 1YMMD 4ZUVA 4G8IB 4UT6H 4U31A 4ZNCD 1NBZB 5IHZB 1I7TA 4OZGA 5EBWA 5ID1A 3B2VH 1FAIL 3F7VB 4L4TD 4BJLA 4JRYE 1IGML 5JOFA 2XZCH 3QUXB 1UM4H 1PZ5A 4L9LC 5DEZA 1VEMA 2CSPA 4G3YH 5F21B 3RWJA 2C3VA 3VWJB 4NO3B 3VFOB 1LO2L 2FJHA 4OFPA 4PJ8C 4WEBL 1FE8L 3K2UL 2BOCA 3V5KB 4LL9A 2R1XA 1MFBL 2V2WA 4M6OL 5BRZA 2RAMA 2YD6A 1A9EA 2QKIB 3CVHH 3P0VH 4L4VE 3MNWB 4I3GA 1MUJB 5T3ZE 2XRAL 5L7XL 4U05A 2KKQA 4GW4A 2IH3A 1EZVY 1N5AA 2EEAA 3HC4L 1F90L 2ID5A 3QH3B 4PRIA 5EIIA 1U3HD 3QQNA 1C12A 2VXTL 5CJ8A 3BP5B 1DANU 5C0GA 3I2CL 3LEXA 2FGWH 2H2SD 1UZ6E 5DJZB 5DR5L 4DTGH 4UU9B 1WC7A 4XP1H 5EN2A 5FYKU 4XBEH 5D7SL 3H42L 2QSCL 5AZEL 4OGXH 1EGJH 3THML 2VZTA 1XGTA 5GGRA 4MXVE 5E9DE 5GGUA 1IM3B 3ULVC 4BUHA 3WO4C 5C0CE 1BJ8A 3UJTH 3C08L 3W0WA 2HJLB 3LDBB 3NFPB 4YHLL 3QI9A 5L9DL 1DQML 3EBAA 3GSOB 5GQBA 2JJTA 5GJTL 4I0PB 1EJOH 3EO0B 1VFBA 1CGUA 3PGCA 3OKLA 3BO8B 3ZKQD 4BFGA 4FRWA 2CJUL 4JM2A 1DSFL 3OGCA 4ZFFA 4ORGB 3KDMB 1NEZB 1A6TA 3BQUA 1MRCH 4Y4HC 4GRLB 5T5NF 5B21A 4M7LT 2VE6A 4R0LC 5J6HB 4P3CL 3BP4A 4UI2A 5CJ5A 1T0PB 1O0VA 4ODXB 1MREL 5J11B 3OXRB 3RJQB 3X14B 4OV6F 4OCRH 1T83A 1RJCA 2GSIB 4RFEA 4X7CC 4N68A 3KJ4C 3NH7H 1LO3H 3W9DB 4KUCF 1ZT7A 4Z5RA 5GS1B 3NMEA 2VXUL 5KSBF 1KC5L 2R2HA 3U0TA 3ZDXF 1G7HA 5HYIA 2OM5A 4CW1B 4Y16A 5JQ6H 3CSGA 4JGMA 4HXAL 4KRPC 4ZUTA 3L6FA 3UJJH 1WIUA 1QLEH 1JFQH 3DV4B 4H0IA 2UZIL 2YPLB 1T5WA 3MNVA 5ADOH 4Y1AE 2Z35A 1VEOA 1BVKA 5E8NB 4YK4B 4EXPX 3GK8H 3FQWA 4OAWA 3MJ9H 3L1OL 4EKXA 1KXTB 1FNSH 1QRND 5E8OA 5C09E 3HE6A 4FP8L 3TWCL 1C16A 5JLZB 2HLFD 4NSKB 3BEWB 3VD9A 5IESL 1N4XH 4ESKA 2YC1B 3RZCC 3CPLB 5HXMA 4Q6IA 2A9NH 4LMQE 3TT1L 4WCYL 1AY1L 2O5XL 1NCDL 2RCSL 3T1FA 2AXFB 5GS0L 4KROB 3VXTA 4JM4H 1MJUH 5FO8B 4BQCA 4HT1H 1CQYA 2XKNB 3KHOA 1ZHBB 4FFZL 1QSVA 4RAUA 1M05B 4KJWC 1T2QH 4OCXH 4APQB 4P2QA 1ONQB 3DUSB 4YC2C 1DLHB 4K7FA 4ZD3L 1DBBH 2HWZL 1T0MA 4PJDB 4LCUB 3NN8A 1CDCA 3TLRA 3CU1A 1U91A 1P84J 2GY5A 5CBAB 2WWMD 4MB3A 3S36H 3EFFB 4PGDA 3CXDH 2BNRA 2J6EL 3PHQA 4UV7H 4P59H 1NGQL 3BVNA 4HIIA 2ADJB 4JLRB 4G7VH 4HSQA 1JYVA 4ODTH 4LCYB 3MRQB 5FHBH 1J18A 35C8H 4CVXB 1JPGB 5EUKA 5JXED 3U46B 3V6ZB 4BZ2H 1L0QA 3BYTA 4KHTL 2Y6SC 4WWID 3MOQA 1A7NL 2HTLD 3MRHB 1NCBH 2F5AL 3HE7A 4OZHA 4ZAKC 5FUOL 1S7RA 5D70L 3QXVA 2P8PA 2V9RA 3D69A 3PV7A 4LLUA 3TF7C 4PRBA 4NQCB 2IADA 1T89C 2RHEA 1CBVL 2BFVL 4YHKL 3MRFA 3OKOB 3DURA 3IGAB 3M17B 5GGRY 4FQLH 1U3HC 5HYEA 1FPTL 2HVKA 1CGVA 2G75B 3DX6A 2J7LA 5DJ8A 2EC9T 1EVUA 2BSRB 4PB9L 1NLBH 2VIRB 1I9JH 5IVXA 3TFKD 3KGRA 4JN1L 2YKLH 2I07B 5ALBH 4MJIB 3CNKA 3O9WB 5D71H 1KT2B 3ARGC 2V17L 5AWNH 2AJUL 5LGJB 2HFFB 4L4VD 5DEFA 2OR8A 3T77A 1W0WB 1QFOA 2KL6A 1GRWA 4HCRH 1DBAH 1H3PH 4DW2H 1AH1A 1UA6H 4JGUA 4HX1B 1YN7A 3MO1B 3X3GL 3SKMA 4OBRA 4ZXBD 1MWAH 5IB2B 3VXOA 1MAJA 3CSPA 4M5YH 3FCTB 4JQIH 4AENA 5F1NA 5F70A 4RWYL 1IGTA 4HWBL 3JV5A 1KEGL 4CJ0A 4GO6B 2HH0L 1D9KD 1DEEA 2VLRE 2C7UB 3L3GB 1JMZA 3IRPX 1NUNB 4EQ3A 4YBLC 2JJWA 5C0CD 4JB9H 5GSRB 1CFVL 5TFSL 4UAOB 5IW6A 2QSVA 4LNVA 5F6HI 2UWEA 3S37L 3MJ8B 5BW7C 3S6CA 3FN0L 4LARL 1CDJA 3QIBA 4XCNB 4ZTPL 1VADB 3DPBA 4HDIB 3LIZH 4PJBA 3BWAA 2CDEB 1R3KB 3MNZA 4GS7B 4XCEA 5DD3L 3TEUA 4QHMB 3MYJA 1DLFL 1RZ7H 5ID0A 1OHQA 3TVMB 1BJ1J 4KMQA 4JFDA 1BD2E 5K9OB 5I1AA 1RURH 4Z78A 4XCFL 5JNYA 4MJ4A 5I1EL 2NXZD 1TNMA 1DBKL 4PJHF 2O5ZL 4NQDD 4ZQKB 5F3HA 1IGYA 3GSNH 4Y8AA 2BSED 2Q7YB 4KY1L 4JFZH 2MOVA 2ZCKH 5KVMC 1JGLL 2WNGA 4GKSA 4Q9CA 5E6IA 4D8PB 3TBTA 3SEPA 5DUML 4NP4L 4DUVA 3RNKB 4KKNA 4WY7L 4Z7UA 4E9LA 2CIKB 4KQ4L 2VYRE 1MFNA 4LF3B 4EI6A 4JFFB 3SDCA 2DTMH 4KJYB 2XQBL 4PJ7B 3UTSE 3PGFH 4L9LB 1A9BA 4OI7A 4PJEF 4FQ1H 3GMNB 4XPAL 4MA7L 2HLFC 1UADC 4OLUL 4PJ8B 1ZSDB 4YHIA 3QCTL 2XYCA 4WHDA 1KUMA 1MLCA 1U8QA 5IV2A 1M7IA 5ANMB 4Y19A 4YHOH 4P2RE 1IEBA 3RHWK 1P84K 3RP1A 3VXMA 3HPJA 4XAWH 1K4CB 4QRRB 3OAUL 1I1YB 4GUPA 2OBGA 4LEXH 4LEOB 5LWYH 1W8NA 1KN2L 4G7YL 5KANI 4WW2C 2MCG1 2YA1A 4B5EA 5H2BB 5GRJH 2NLJB 2R2EB 3JUYA 1NUFA 4M1DL 3GBLA 1EA9C 2P8MB 3BDYL 4I2XB 4KXZH 5MERA 3LS4H 4LSUL 4HV8B 1GH7A 3MGAA 4C58B 2P5ED 4PY8J 5J13C 3ARRA 1CI5A 2RB8A 1HH6A 5DMGC 2XOTA 2VQUA 3QIWD 2C4FT 3FT2A 1X6LA 3B9KD 4HPYH 4D9RD 3ARPA 2IPTL 4MNHB 3IFOB 3WO4B 2BERA 5FM8A 2B4CL 3ZTNH 1KENL 2P24B 4PUBH 1B0RB 3NPSC 3K2MC 5EUOA 2HVJB 3QIUA 5DS8B 1NAMH 1X5JA 2WIIB 3PWPA 3PP4H 2VLMD 4IIQC 3QUKA 1BFSA 5FO9B 1MPAL 1RUAH 1YY8B 1OM3L 1QKZH 4KRLB 4JN2A 4Y4HB 5DQ9B 3CU7A 4D0BA 5TDNB 5FA3B 5DD6A 2CMRH 4HWUA 4KFZC 3TFKC 4U1JB 3ARUA 2G5BA 4WO4D 4R0LB 2VZVA 1TJHH 3BKJH 4JRYA 3MZTA 4PYGA 5ISZD 5EFIA 5F89A 3GI8L 1TVHB 1UWGH 12E8H 4P5TA 1T03L 1JF1A 1S8DA 3MUJA 2MPAL 4Q6YA 1GAFL 2YPKB 3KJ4B 4KMLB 4WTZA 3VRIB 5CMAA 2ICCA 4JPVH 2IG2L 5TE4L 5D7IB 4XVSH 1YC8A 2P43B 2X4PB 4H25A 4QRQA 4MD0A 3T2QA 3I02A 4PJIE 5MI0C 2BXYA 3PHSA 3QO1A 4LCWE 4ZXBC 1FGVH 4NRZA 3JTTB 3SBWC 4KRPB 4FQJL 1RPQA 3H3KA 4U33A 3LY6A 4PJDE 4NZRL 5C70A 4H20L 5JIPA 1N2RB 1D9KC 2WW8A 4L1DA 3KS0H 2AJVH 1A3RL 4PG9A 3QWRA 3SKNB 4YFDB 1ES0B 1TZIB 3MRKB 4NM4L 5FOJA 5SV4A 1CFSA 5CCKL 3OX8A 3S36X 1J8HB 4FQPA 2ATPB 3RWFB 5E9DA 1FLTX 2NY2D 3FONB 3PWNA 3NABL 4GQ9H 3EFDL 2XWBB 3DVGA 4NJAL 3BP6A 1AHWC 3RZCB 4NWTL 5T3XL 3GIZH 3MOBL 3WJLA 2P7TB 4ZOCA 2X4OB 4L3EB 1QSFD 3AMKA 4ISVA 2VLRD 1AGDB 3HG1D 4FOMA 2GUOB 2P49B 3ARED 4OFVA 5K9KA 5FKPA 5GRYA 1MIEH 3PABB 4G43B 2EH7H 3DBXB 3HUJB 2NXZC 1CGXA 4YC2B 5TF0A 1KN4H 1YMMB 1FORL 4J3TA 1FZJA 4L29A 1YUHB 2H32B 5F8RC 4H26A 1JGEA 1RMFH 1QFHA 4AIXA 2PYFA 1S7SA 2UWEF 1XMWA 4X6EB 2APBA 1EEZB 2AP2A 1MY7A 2XG4A 5LGHH 4L4TB 5FYJU 4HJ0D 3FOLB 4UIMA 3WO3B 3WNKA 5KAQF 3ARFA 3Q6FB 4PRNA 3HNVH 4PJBF 2QQKH 1G6RA 3GMOA 1BD2D 4U1LB 2HFTA 4YR6A 5I71C 4HIHA 4GG8A 5EBMB 5MENE 2HMID 3LD8C 4ZAKB 3VFWB 2CK2A 4NUGH 3P9LB 5FM5O 3DSFL 5J1SC 5FO7A 5A16B 2DB8A 3B3IA 3JSSA 3ZKXC 2CXKA 5SX4I 1KELL 3MFGB 5L88L 1U3HB 4Y1AA 3RFZC 2ZUQC 4OCWH 1VESA 4JY4A 5C08E 3U9PL 3VXUE 4KTEH 5CP7A 1G7MB 4G5ZL 4LKCA 1RIHL 3BGFC 5H37G 4UQ3B 3TPUA 1IT9L 1MRFL 3KJ6L 1SEQH 3H7LA 1BZ9A 1FV1B 3BZEA 3VD3A 1RVFH 1BIIA 5EOTA 4KUZL 4WFHE 5C09A 3QNYB 1PAMA 3ARGB 4NBYB 1DN0B 4LSSH 1PW3A 3L9RA 4U1IB 3IVKA 5EPMA 1SM3H 5DURB 3S9DB 3SGKA 1XZ0A 3IJHA 4OKVA 3B9KC 4Z7QF 2EC9U 4YHNA 1QPXA 2JJUA 4NT6B 2GCYB 5IMKA 2AKRA 3PG2A 4PY7A 4Z95L 5HHOE 1WZ1H 1HHKA 5FCUH 3ULSA 4FQQA 4LNRA 1AQDA 1IGIL 4OFDA 1KEML 4U1SA 2E27H 3ULUE 3K3QA 1XF2B 2O61B 2X4UB 1IKNA 4BA8A 5D1QA 4PR5B 4XCCH 2WANA 1MY5A 4JFPA 4TVPH 1EFXD 1GGIH 2AJ3B 3TH2T 1BFVH 5KW9H 4YBLB 2PN5A 4PJ7E 3WXVH 2HKHH 2LV4A 4KTYA 5DHVH 3TH3T 4FQCL 5IVNA 2ED8A 3IU4L 1VGKB 4RZCB 1WISA 4WO4C 4YIQA 1CLYH 1M7DA 1K3ZA 2MSPA 1I8KA 2CRYA 2DQCL 3O6KH 1BOYA 1J88A 6CGTA 5I1LB 5J89A 1JPST 3QUMH 4PV9A 4WUUB 4JFHD 2YXFA 4OM0H 3EIFA 3DHJA 4AH2B 4WI2A 3F5WA 2AJSL 4I48B 3UZEA 5H35A 4FMFA 15C8H 4LASL 2ADIB 1XIWC 3U1SH 5IB3B 5EU7C 5T5FL 2FSEB 3D85A 3O6ML 4QGTA 3UAJD 5DJCB 3FO9B 3WIHH 5IM7B 2NY0C 3IFNH 3HI6L 4HS8H 2G9HB 3K8LA 3F7YA 3H9ZA 3VRLF 4CMMA 4TNVK 3FTGA 4D2NA 3MRMB 3FQNA 1QRNB 3WFDL 2NY2C 3IDUA 1XGYH 4YNYA 4N0RA 5EORL 2FWOA 1VPOL 2E7HA 2R0ZL 4S1RL 3W82A 3DUUA 5GRUL 4XWGL 1A0QL 4DGVL 4P9HL 4Q74A 2X89D 2ARJA 5DF0A 5ELIA 3BP7A 1GGTA 1MFDL 1INQA 1ZGLB 3EJJX 2EDEA 3MJ6A 3IDNB 4Y2DD 5IHZA 5DI8B 3S4SB 2FD6L 4GAJL 4DGIL 4X6CB 3V4VL 1EEYB 4MSWB 1RZIB 3QFDB 3O4LE 4MAYA 5J57B 5AG8A 2IFGA 3MV01 3VXPB 2O5YH 4RBPH 3QUXA 5EC2B 5TF1L 3K1KC 3IKKA 1F2QA 3OPZH 5GS2D 4Z0XA 3VWJA 1JVKA 5H94B 3C5SB 3MQIA 2CLVB 4NO3A 4F58L 3VFOA 5J13B 3MR9A 5D2NE 1CR9H 3V5KA 1Q38A 4Q97A 1PDKA 3C8DA 2ADFL 2DF3A 1P5VA 3GKZA 1IQDA 4HJ0C 4LIQE 3L3DB 1QFWH 1ADQL 5CZVL 3U9UB 5F93C 1MUJA 2ZKHH 1KB9K 4TUKL 1TJGH 2BVPB 3NPSB 3OKMB 5BZWB 3S5LB 1IBGL 3H9HB 3P73B 3P4NB 3OKEB 2OMNA 5IHUL 3O6LL 2X5PA 3HA0A 1YNTB 3CFKB 2ICWJ 3ALXA 4IIQB 2C4FU 3W39B 5HYQA 1RZFH 4P48A 1H0DB 1FAIH 1W0YT 1IGMH 2E8YA 2R39A 1IM3A 2QJDA 2NPLX 2VXVL 3T0VA 2VOTA 1M7XA 4YFEA 1LO2H 2JF1A 4LSQL 1FIGL 3UTSA 3N9GL 4WEBH 1FE8H 3K2UH 4NHCL 5BO1H 5MEND 1MFBH 3NFPA 4GRWB 3GSOA 4G8EB 4B41A 4HHAB 4PP2B 1S7VA 3GNML 2XRAH 3ES6A 4I0PA 2BVEA 4P2RA 1F90H 2MWCA 3BO8A 3BPLC 4JQVA 4HS6B 5MI0B 5C08D 4N0YH 4ZXBB 3VXUD 3I2CH 4ORGA 1F6AB 4KVCL 3KDMA 5DR5H 4GRLA 2DKMA 2GFBA 4PTTA 4R96B 1PYWA 4XPHH 3T65A 3WLWC 5I6XB 1SMOA 4DVRL 5D7SH 3H42H 2QSCH 1D9KB 4ZOBA 3ZHDA 5AZEH 5CKGA 5J6HA 5JQHC 5JW5B 3LMJL 3TBWA 4ODXA 4IS6B 3PUCA 4JKPL 3OXRA 3X14A 3GJFK 3FFCE 4KH2A 4YDLC 1ZTXH 4M43L 1AKJD 2R0KH 4HW6A 1LNUB 3C08H 3QJFB 5GS1A 1U8OA 4KZDL 1AHWB 4YHLH 5L9DH 1DQMH 1C5BL 3ZDZE 1FL3B 3ULUD 1EO8L 3RWEB 4CW1A 1CFNB 5GJTH 1ITCA 2FLBT 2OCFD 5F96L 4M6NH 4WUKL 1RD6A 3CK0L 4FABL 3DV4A 4CDHA 1EHLL 5D5MB 2CJUH 1DSFH 1XGQA 1LILA 4WU7B 2BJML 5E8NA 4CN1A 4KDVA 3RGVD 4D0DA 3TNMB 2NXZB 4HZLB 4PJGB 2R0WH 4J1UB 1BQLL 1SMAA 3TO2B 4Y5XC 1TVBB 4P3CH 3E3QE 5CEZL 5JLZA 4NSKA 2ZG1A 4W6WB 5C0JB 4UTBL 1P53A 5HVFB 3FB5B 1ZLVH 4IMKC 3CPLA 5ESAA 1KLFA 2H6PB 4GXUM 2LVCA 4CVUA 3SDAC 5CP3A 2J12B 5KG9A 2VXUH 2VISB 1KC5H 1J8KA 2AXFA 4LGRB 4O9HL 4M61B 1TQCC 4MJ6B 4LSRL 1P1ZA 5FGBA 4JPKH 5I71B 2DM3A 4HXAH 2BVYA 4GLRH 3PWJA 1M05A 3LD8B 4APQA 1ONQA 4LCWA 4OB5L 1TXKA 2UZIH 3RA7H 3WFEL 1DLHA 4OD3L 1NCTA 2IFFL 5C71A 1Q1JL 2DM4A 3R06A 4PJDA 2ICES 1XCTB 3ZKXB 4LCUA 5F7KC 2ZUQB 1GGUA 3F8UB 3L1OH 5C86A 3EFFA 1CXIA 3R0NA 1RK0A 3BGFB 5HJ3B 2QR0B 1P69B 5J6GB 4FP8H 3TWCH 2ADJA 4LCYA 3MRQA 3T0ED 4KMTH 5D7LE 3MRGB 5IESH 1T1WB 3IXTA 3V6ZA 1L7TL 1CFQB 3TT1H 4WCYH 4B7LA 1AY1H 2O5XH 2P5EB 3KR3L 3KS0J 4N5UA 3MRHA 1NCDH 2R9HD 5K93A 4K23L 4U1NB 3B9KB 5GS0H 1N26A 3NCMA 4NQCA 4NZDA 4FFZH 3S4SG 3OKOA 5IF0B 3IGAA 3M17A 2DIAA 4JVUA 4OZFH 3M8OH 2G75A 4LVHC 1HNFA 2BSRA 2CRMA 2VIRA 4ZD3H 1MAKA 3NCJL 1IKFL 4LMQI 3MLTA 4QXUL 5DJ2A 3CH1A 32C2B 4J3XA 4LU5H 5SWSD 4AIOA 4MJIA 4X4ME 2J6EH 1B6DA 3W2DL 1KT2A 1WEJL 1R5IA 2Z91B 5LGJA 3CCHA 4EIGB 4K9EC 3MLRH 4NIKB 5K9QG 1W0WA 5L2JA 4V1DE 2C4XA 4WO4B