3S5LB

Crystal structure of cd4 mutant bound to hla-dr1
Total Genus 44
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
44
sequence length
191
structure length
191
Chain Sequence
MGDTRPRFLWQLKFECHFFNGTERVRLLERCIYNQEESVRFDSDVGEYRAVTELGRPDAEYWNSQKDLLEQRRAAVDTYCRHNYGVGESFTVQRRVEPKVTVYPSKTQPLQHHNLLVCSVSGFYPGSIEVRWFRNGQEEKAGVVSTGLIQNGDWTFQTLVMLETVPRSGEVYTCQVEHPSVTSPLTVEWRA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Immune system
molecule keywords HLA class II histocompatibility antigen, DR alpha chain
publication title Affinity maturation of human CD4 by yeast surface display and crystal structure of a CD4-HLA-DR1 complex.
pubmed doi rcsb
source organism Homo sapiens
total genus 44
structure length 191
sequence length 191
chains with identical sequence E
ec nomenclature
pdb deposition date 2011-05-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00969 MHC_II_beta Class II histocompatibility antigen, beta domain
B PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3s5lB02
3.10.320.10 Alpha Beta Roll Class II Histocompatibility Antigen, M Beta Chain; Chain B, domain 1 Class II Histocompatibility Antigen, M Beta Chain; Chain B, domain 1 3s5lB01
1RURL 4XWOC 1SJVA 3MA9L 3B2VH 2MFNA 3O3UN 5ANMB 4HW6A 1IEBB 3O8XB 1CFVL 2HRLA 2O61B 4M03A 2W92A 4PREB 5DJDA 1SBBA 2XKNA 2XY1A 2YD2A 5HHQB 4OGZA 1MH5A 2GTZA 3MR9A 4ZXBD 1MSPA 5IR1A 2V2XA 3ARVA 4DAGL 1RMFH 1I8IA 1J05B 3H9HB 2VXVL 1H3PH 4YO0A 3FL7A 2DLIA 4NQDE 5CZXC 3V6OE 4PLJD 3PWPD 3WKML 1AO7D 4GXUN 4WFHE 5FAAA 3V4VH 3L3IA 5DFVC 1D3CA 1BIIB 2CDEB 2DQEL 2WSKA 5EOQL 3SDYH 1FVEA 3FONA 3IT8D 1B6UA 5FGRA 1KPRA 4YX2H 3QQ3A 4I3GA 3T0VA 5C0RL 3R0NA 3GIVB 1AD0A 1EFQA 1TJHH 5DJ8A 1T1YB 3MXVH 5TDNA 2PO6B 3WN5B 3ARBB 4HPOH 1NMCC 2RQ8A 4Y2OA 1P4LB 3BPNC 4U3CA 4K8RD 3T3PE 3E3QE 3MGAA 2R56H 5LWYH 3UZEA 3Q3GA 1TJIH 3SDXE 2DKMA 3CSGA 3L3HA 3HE6D 2IBZX 5MEOB 2R2EB 5HDBE 1TETL 4OM0H 4Y1AD 3I9GL 2QQQA 2YR3A 2NXYB 2OL3H 3QJFB 4M8VA 2EZ0D 3QIWC 2D03L 2R1XB 3GSXB 4WW1B 4Y4FB 4O02H 5J57B 1ZVSB 4PRHB 3SCMA 2ICCA 2NY2B 4N8VG 3TH4T 1UG9A 1VADB 3NIDF 4WTWA 5F7NC 2FX8L 4EKXA 1AR1C 4Z7UF 2VXSL 3PWJB 2LABA 3AS3A 4M6MH 5JZ7C 4CBPA 3BD3A 2JB5H 1YYMH 4XX1G 5IQ9A 5GRZA 3P4NA 4WGWB 1WBZB 5B38B 5I71B 4LDOB 4HF5H 3MV8E 4RGOH 2AQ3A 2D7TL 3WNOA 4GRWE 5J6GB 3OKMA 2IBGA 4YHKH 1XF3A 3B5TA 3VWJD 5HGBB 5JW4Q 4GAJH 2QSQA 4KUZL 3RHWF 5I1JL 1I8MB 2EIBA 2PTTB 4KKBD 1KTKE 3DSNA 4G9FD 5BO1H 2EH8L 3OKNB 3IFPA 2GTWA 5DZLA 4YQXL 1FVDB 5B3JE 1CD1B 1I3RB 1L9MA 1MCPH 1CIDA 1KJVA 3LQAC 3GMPA 4HWZB 4MNQA 1R3KB 3LPFA 1NFKA 3P9LB 3C6LD 3BH8B 3IDJB 1XIWA 3MRMB 4LCYA 3V6ZB 1MJUL 2HWZL 4IS6A 4FQHB 4HLZG 1XGYH 4DEPB 1JMXA 3UROR 3HPLB 3P0VL 4HT1L 4YAQB 1AGEB 2EDRA 2GFBA 1B4JH 4XPFL 1H3XA 3S5LG 5TE7H 1YEGH 3D39D 4U49A 4X8JB 3OPZH 5HD8D 3V4PH 1JPFA 4FFYL 4PJBF 2O93L 3U7YL 4IOSD 4PJXE 1O7SA 3GSWA 1D9KB 2AJ3B 2X44D 3PWLA 1JI1A 1MCWW 2IG2L 5DR5L 3QG7L 2HT4D 4IOFC 4WUUE 3EO9H 3F7YB 3OAUH 5EUOB 1AXSB 4Z5RA 3TPUA 4P23B 4OCYH 5FYLL 1C7SA 1ZA6A 2JIXD 4H25A 1OSPL 2HFTA 4HGWA 2DYPA 3KXFE 1OP5H 5MENA 4JANA 5AZ2L 2A6JB 1JFQL 1WT5A 4J3OC 4JDTL 2NY1D 2DQGL 3KLHD 3KPMA 1JZ8A 2EECA 4HSQA 2CIIB 1QTYT 2BVQA 2V7NB 1CFNA 4HUXB 1KENH 4YHPA 1F2XK 1U8HB 5E8DL 5IW1A 2HT3D 4Z7OF 3MCG1 4HIIB 3VFWB 2DBJA 4ZXBA 3SE3C 5CEZE 1CZ8H 5GGQL 1CLYH 1KFAL 1NGWA 2OXGA 3EYSH 3R1GH 2A83A 5SX5K 1KN4H 4OGXH 5KVDH 4PJ8B 4OF6A 3WS3B 1KJMB 3PWPA 4EUPB 2ID5A 3I50H 1AO7A 3S4SG 4XBGB 5DEFA 4YHNA 4S10A 3EOTL 2CK0L 1AGFB 2HTKC 4XCNA 5E8PA 1BFOA 4NUJB 2IANB 3KHQA 4ORZC 2I26N 4JFDD 3L3OB 1YECL 2JELL 3U0WL 3D9AH 4JG1H 4XVUD 5FHBH 5CSGA 5I15L 5IW6A 5GS3A 1FGNH 4MAYB 3HE6A 5C0FA 4FTVE 1H0DB 5EN2A 5KJRL 4PGEA 4P3CH 4NT6B 4XH2A 4N0FB 1G7MA 4ZUVB 3S8WA 3HAEA 3DJ9A 2O5XH 1MEXH 4WW2A 3GMMA 1A8JH 4GT7A 3QHFH 2IPKB 2F8VA 4F7TB 3FO9A 1YDPA 1ETZA 1HHKB 5LCVH 4C4KO 1FFRA 1VFUA 3ZHDA 4R8WH 1KBGL 2DLFH 2BSTA 4XGZB 3ARGC 1E4WL 4PJDF 3P2TA 4PJAB 5B4MD 3U4AA 3QUXB 4FFWD 4HZLB 3ZKXB 4P2OC 1A7PH 5TH2A 3VWJA 5J11C 1FZKB 4OLEA 3S37H 1J1PL 4C55A 1REIA 3MLTB 1S8DB 1T22A 5J7CC 4MJID 5DQ9B 1QQDB 3G5XA 1VACA 5DK2A 5FA4A 1N6QL 2CKBA 5IIEA 4F2MA 4Q6IB 3O3DB 5CGMA 4HPYH 2AAVA 4MYWB 1UC6A 3SDAD 3JSSA 1U58A 4NHCL 5EZLB 1NAKH 3UAJC 4JJHA 5EZJA 4AEHH 4EIZC 2YD6A 3CFKB 2PYFB 3C6LA 4U1NA 2VERN 3P4OB 1OAKL 2DWEB 3GFUA 2AJYH 3AY4C 4P9HL 4NKOB 1L0QA 3MLUH 4YHIB 4OJFH 3TH2T 4D3CH 4L1DA 1M1SA 4IRSD 3RVXD 2GI7A 5CIPA 3OTTA 3R8QA 4UT7L 4P5TB 3W39B 1QSFB 4CNIB 5EWIH 2BSED 3D39A 3I84A 1I8KA 5FCUL 3WD5H 1ORSA 4TSBH 1B0RA 2WUBL 4LHUG 3V5DA 4WU7A 1EJOL 1YY9D 4M4RA 2ZPKH 2AJXL 1FH5H 5EBMA 2JIXA 4X6CA 1WZ1H 2QQLH 4TQEH 1KXVC 3IETA 5HHOD 1ES0B 1CGTA 2ZWLT 3V6FA 3RZCA 1Y6NR 4H5SB 3NABL 1S7RA 2VQ1A 1GZPA 1QYGH 4LEOA 4MWFA 5E08H 3RIAF 3RPKA 1AFVL 1F58H 3A6CH 3DVGB 1OAXH 4WHTA 1N6UA 2EXWD 5AWNL 3QUYD 4LIQE 2VR4A 1MUJA 3VFUB 1CE6B 2I9TB 4X99B 3V5KA 2VE6A 4IRJB 2A0LD 2HH0L 5JPNB 4I18B 3IU4L 2B1HL 4DKFL 1G7QA 1PLGL 5FXCH 3V2AR 4DN4L 4QRQA 4MD5B 3UTSB 5JR1L 3U9UB 3HKFA 1ZEAL 4KZEH 3QFDA 3MGOB 4PRNB 5DD3L 3QCUH 4FQCL 1K8DA 5C0DA 1FJ1B 1CDIA 1NFDB 2F54B 5FM5O 5CFHA 1BOGB 4P9MH 4PRAB 2D9QB 3GMNA 5CZVL 5LG1A 1KCVH 4RAUA 5HSFA 2F58L 4JFDA 4KTYA 1HZHH 3SQOH 3VI4E 2R2CA 3B9EA 5IB1B 4CRPA 4M62H 4NUGL 2RCSL 3LKPB 2FO4A 3LHPL 3MO1B 4KI1A 4GW1A 3Q5TA 4MX7B 1G9EA 2CUMA 4KTDL 2SEBA 1RULL 2YD9A 1WWWX 1WZKA 3T0BA 4XHQA 3NCFB 4ZNEE 4OKDA 2OZ4H 2NZIA 3L5XL 2Y36L 2B4CL 4GG6F 5F88B 1CTOA 2Y25A 1W0YT 1WGOA 5BOZG 1NUFA 2A74A 2IQ9L 5EPMA 3Q6GL 3DX9A 4XNXH 4NJ9H 3S88H 5BVPL 1PDKA 3REVB 2FJHB 3CFBB 1ADQA 3U36A 2DTML 2D4FA 1Y18B 4WHYG 3W9DA 5HGHB 1QLRB 5F1IA 1MHHA 2Q8AL 1LP9A 1T03H 1K4DA 2APVA 2IEPA 1G6VK 5TDOA 1W0VA 1UYWH 2ITCA 4FQXB 5KW9L 5CUSH 5TQ2H 3T0EB 3AXLA 5KVFL 4ESKA 4V1DE 3U0TA 4N8PA 3EFFA 5IG7B 4OLZL 1TLKA 3NACH 2JKXA 1DBAH 5I0DA 5FV2A 5DJ0B 2X42A 2ADJB 3MUHL 1P1ZB 1T5WA 5JO5A 2W65B 1J86A 4JFHD 5C07E 1R3LB 1NH6A 4M6AA 5E9DD 4XPAL 1SQ2N 4KK9C 4C56E 3V52L 5D5MA 4L9LB 2X9XA 5C0IA 3MOBH 4RFNC 4PJDE 2ZOLB 5F8RC 3BPOB 4LCWA 4O4YH 4JZNA 1X4YA 5DJ2A 4LCCC 1EHLL 1KCSH 3LKRB 4EN3D 4UIKL 4NRYA 2ENSA 4JG0L 3GRWH 3LB6D 5I8KH 5FHAL 5HVHB 4IRSA 2BJMH 1UWEL 4OCNC 4UB0L 1XFPA 3HN3A 2VDKH 3FFCE 5L6YL 5D93C 4FFVD 3ZDYE 3F65A 5F89B 5DJXB 3RVWD 3PV6B 4KY1H 4HV8B 2EKSA 4R0LA 1A6TB 3ZDXE 2M2DA 1Q1JL 4JQXA 3G08B 3G5ZA 3MFGB 2L7JA 4R2GB 4WUKL 3CK0H 5JORB 1A1OA 4QRPD 4OCRL 5HHOA 2FEEL 3PGCB 1CF8L 5DS8A 2EEBA 5CP7A 1IGIL 3TO4A 4D9QD 5HDOA 4JRYD 4L3ED 4R97B 4ZTPL 1P4BH 1RZFH 2BVOA 3HRZA 4OCXH 3FN0H 4ZAKA 4KJQD 3IU3B 1M7IB 3O3AA 4KTEL 1TNNA 2C3VB 3QUYA 3SBWC 3NH7H 1AQKL 2IF7A 3KLAA 4GSDL 2WQRA 1JNHA 4ELKB 3O6KH 5HHVH 1H8OA 3W2DL 2NNAA 1I3GL 2EEAA 2Z92A 1MIML 2DM2A 1JIBA 3AM8C 3LKQA 4D94A 2B1AH 1YYLH 3DV6B 4HKZB 2BNQB 4J12A 1F00I 5JW3H 3WFBL 1RZKH 4PB9L 3JV6A 3OBAA 5IVZB 4IHOB 1YEFL 1DBBH 2YPKB 3M17B 4FQIH 3TN0B 1CGSL 1LE9B 1F4YH 1T20B 3RWDB 3TJHC 2VLKB 3LMJH 2B20A 3BKCL 4PJFA 3IFLL 1R6VA 2WZPD 3HLAB 2Q3AA 2YPLB 1JHKH 5I17B 1RJYB 1T2QL 4AG4H 1GGUA 4WVRA 3K2UL 4D9RE 1NFIB 5KAQF 3B43A 2OTUB 2YHGA 3DX7A 3ZTNL 1QLFB 3KPSB 1UADC 4PJ9B 4ZQKA 3U6RA 4HZAA 4QOKD 4DGVL 4PGCA 4UILL 2LU7A 3QHZH 2PTUA 3EGSA 3L3DB 2P24A 3MBXH 3LDBB 2FB4L 2NR6D 1A7RL 3K80A 1MHCB 1DBJH 1VCAA 1VGEH 4JR9L 1H3GA 1JNJA 1A4JA 3CLFL 2ATPB 2JJWA 5EBGA 1WK0A 1IC5L 8FABB 1BGXH 2XACC 4OZGE 4L5FL 4GG6E 4MD4A 1A1NB 4KZDH 4RNRB 5T3ZD 1NFDF 1D7FA 2EICA 1YJDL 4PP1D 3VFRB 2PKDA 3DVNA 4GKNB 3TZVC 4XC3H 2BX5A 5C0GA 4WWKD 3VFTB 4M61B 5EU6B 3ULSB 2YSSB 1MAML 1AXTH 5E9DA 2H3NB 4KROC 3FT4A 4KRMB 1I4FA 3RVUC 4Y19B 3EBAA 3F5WB 5DMGC 3FQWA 3B8SA 4QHKI 5DMJB 1YNKL 3C8KB 5JLZA 3QULB 4MAUH 4JZJC 2QSCH 4Y16B 5HGDA 3WFDL 4JRXD 4X6DE 5D96C 4EN3A 2APBA 5F6IB 2FD6L 4QRSB 1FZMB 2NY6C 4KUCF 3U48A 1J8HD 4GKSB 4YZFF 3IXTB 4P2RB 3JVGA 3VFOA 4CUCA 4EVNB 3WNKA 3CDYA 4Y5YB 3CDCA 4DWHA 3OAZH 1FQ9C 4N5EC 1PKQA 5IMLA 1CFBA 3TBWB 1I7TA 1HHJB 3PP3H 1T7VA 2D7NA 3NGBB 1GL4B 4HEME 1PSKL 1CR9H 12E8H 1E6JL 1MFCL 5GGSY 4DVBB 4BKLB 2ZNWA 3D0LB 2BHZA 1RJZB 4QRPA 2VAAA 1GVIA 4KMTH 2OLDA 1YEDB 2E7MA 2BERA 4U6HA 3G5YA 1DEEA 4JRYA 4L3EA 4UT9L 2NW3A 1K85A 3HC4H 2P8MA 3MFFA 4I2XA 1U8IB 5HHPB 4M3JA 1I9JL 3NBNA 1P9MA 2YUWA 5INCA 4WFFD 5SV3A 1TITA 5I18H 3H42H 3QIBB 4LF3A 2FHFA 4WGVB 1MAJA 3MCLH 2G75B 4OGAC 2NYYD 4K7FA 2D31B 1I1AC 1GH7A 2EDKA 1H15A 4LRIC 5DRNA 5A16A 2FR4A 3DX6A 4RGNC 4IMKC 2PR4L 3PDDA 4LOUD 4R4BB 3IRPX 1QRND 4RIRB 5DA0B 1A5FH 2CMRL 4G7VH 1SVZA 1D5MA 1F8TH 2YD1A 4TRPH 4DKEH 2V5RA 4YFLI 3EOAB 4JDZB 4R4FH 4GMTH 1KSRA 1IAIL 1NGXA 3S9DB 3BP4A 2VL5B 4HS8L 4XBEL 4I3RL 3NFPB 5IGXH 4PJHE 2DQFA 5DI8B 4K3JL 1JTOA 3G6DL 3CUPB 3GMLA 4RCAA 4A6YB 1EH9A 3V4UH 1EFXB 1HQRA 4FXGA 1IL1A 2YN3A 1BEYL 5F21B 5D9SA 3AB0B 3S96B 2WLYA 3SJVE 2LAAA 4NKIH 4WO4D 1XGPB 2NLJB 4NN6B 2OL3A 3RP1A 3HFML 3RNQA 3NCBB 1X5IA 3T77B 4L29B 1NJ9A 3B2UD 1CG9B 3UZVB 2FBJH 3JTSA 4M1CD 4CU6A 5CCKH 1WC7A 3Q48A 4P4KD 4LKCA 2JCCA 4G8FB 5EOTB 4UI2A 4YHLL 4L4TD 1CQYA 4KVCL 3WNNA 3GNMH 1FNHA 3QNZB 4LCWE 1S9XA 1RK0A 4K3DL 2FL5B 4UUJA 4PRPD 1IC4H 5C0JB 1A3LH 3P73A 4AZ8A 3BPLC 5HY9A 1BBJA 3L3JB 3ZHKA 5D7JD 3BKJH 3QXWA 3SDDB 4UV4L 1F3JB 4MA7H 4U7SA 4TNVK 3MRDA 1FFOB 4LBEB 2UZIH 2ZG2A 4RSVA 5AD0B 1HH6A 3RUGA 5SWZB 2D0FA 3RWEB 2ESVD 3O2DH 4FQPA 3ZKSD 1VFBA 1H8NA 3SY0A 3LY6A 5HI5D 4J1UB 2O5YH 1JHTB 3QFJD 1UACH 3FFDB 5BW7A 5I9QC 3O45A 3QI9C 4LLQB 1YMHB 4AIZB 5JW5B 4K3EL 3P0YL 4NHUB 1X5ZA 3ARED 4Y4HD 4EBQL 1WLHA 3BDBA 4JRXA 1Y0LA 1EEYB 3B6SA 1OSZB 2J88L 3QXAB 4IRZH 5HDQL 5K9JL 5F1KC 3CLEH 3RGVD 1UEYA 2HVJA 3NCYS 1J8HA 3N1MC 3KDMA 3BVNA 4AENA 1EEUA 4TTDD 2LQRA 3I85A 1LK2A 3OKOA 1LO4H 5AUMA 3RVTD 3HNTL 4KDTA 2ZUQC 4CVXB 3BDYH 5DTFA 1FVCA 3CDGA 3QEQB 5J56B 4I3SL 1MQ8A 3MZTA 1IARB 2IADA 3EYOA 4RX4D 3EHBC 2RFXB 4EJ1C 3HCVA 1K8IB 3G6AA 5LBSL 1J0KA 2EDLA 4JVWA 3I75B 4GQ9H 4XRCB 3ULVE 1WAAA 4HWEL 5MHSE 3RDTB 4P2OD 4ZYKA 2OR9H 3PWUB 3QIUB 4XCYA 4YZFE 3VXQA 1RUPL 3UJTH 1CFSB 3WIFB 5HYJE 4AEIH 3QWOB 3C60B 1KIRB 1TFHA 4ALAL 4L4VD 4FN0A 2XPGA 2DQJH 5E2UL 3WSQL 2C4XA 1A6VH 3R4DA 5IESL 1S9YB 5TGBA 5JNYA 3UX9B 3TYGL 3PL6D 1ZGLB 2BMKA 2IFGA 4OQTH 3Q5YA 4I48B 1GGBL 1ZLVK 5E70A 1U8QA 1ZOXA 3LKOA 4LQFH 4FHBD 4Z7WF 3TYFA 1QRNA 3N0PB 5TQ0H 2CPCA 4H8WH 5DJDB 5DMYA 5IJKA 4G80A 2XKNB 3FRUA 4A6YL 5T5FH 1CGXA 3U4BL 1MH5B 3RZWA 3MR9B 1JGLH 3T2PA 4WFEE 5IB2A 1JHLH 3WIHA 5IR1B 2V2XB 3OF6D 1I8IB 1Z9MA 1G7JB 4UU9A 3BGFC 2Z93A 1HCFX 1PZUB 1KEML 5E94A 4YO0B 2R69H 5HI3C 4KRNA 3WKNA 2YD7A 4GJTB 3VGAB 3EYUL 3WS6C 1HHHA 2H1PH 4OKVA 4KK5C 7FABH 3L3IB 5DD0H 1YEKH 1XEDA 3TO2A 1YUHA 1FVEB 2ZOKA 3FONB 3N9GL 3OJDA 1W8NA 4WO4A 5GGSA 3QQ3B 4NM8L 1AD0B 1Z0MA 3O8XC 2P43B 5DJ8B 3DROA 3RVVC 1T2JA 4Y7MA 4OZIB 2J6EL 2R2HA 5TDNB 2J5LB 3U1SL 2XWBA 3MACL 3QHTC 4FZ8L 5ITBH 2BFVL 2MWCA 1ZLWH 2VITA 4P4KA 3DX8A 3BIKA 3Q3GB 2VXQH 1RUKL 2YD3A 4L4TA 5F1SA 3L3HB 4JFFD 2BOCA 4OIIH 2VJXA 4YEEA 2MJWA 4OCWL 4OTXH 1RIUH 4APQD 1AD9A 1EHAA 3FHAA 4LHUD 4YE4L 1MPAL 1CLCA 4G6ML 1G6RH 4OF7A 1N5YL 4OZ4A 2ZKHL 3P30H 5SWQA 4PRPA 5IBLD 4FP8H 3PIQA 1RHHA 4I13B 4XAWH 3RWFA 3SCMB 4JRWA 5D7JA 1NANI 3CX2A 1QKZH 4U31A 2YUZA 2W0FB 5CEXB 1WCQA 5DRXA 1P7HL 3BQUD 2QADD 1U8NB 5GSVA 2EDJA 2PO6C 1JNLL 3WN5C 3ARBC 5JOPD 1V8HA 3P4LA 2ESVA 2HFFA 3MRGA 5TPWH 5IQ9B 3P4NB 4YBLB 4HC1H 4NPYA 4EDWH 2PW2A 5JHDD 1OT1A 4NN7B 2VDNH 1MHPH 5DO2D 5C0AD 3OKMB 1QFWI 4K94H 1XF3B 4Y4HA 3OB8A 4HIJB 2NXYC 4ELMA 4D9QE 1G9MH 4DKAA 4XCEA 5CLTA 4Y4FC 2A9NH 2GTWB 2WWMD 3MV7D 2DKSA 4I2XE 4MZ2A 3RGVA 3GM0A 2NY2C 4LPVA 1KJVB 4X0KB 3HG1E 4XB7A 3I6LD 1OM3L 3GMPB 2RR3A 4QTIH 4MNQB 5F7YC 1UWXK 2MCPL 2BDNH 2NTFA 3DV4B 4NO2A 5C0BB 4YEFA 1RUML 2VLME 1AHWA 1OWWA 2F53D 1XIWB 4X9GA 3MLYL 3NPZB 2BVPA 3ARFD 2B2XL 4LCYB 5FDYA 3LN4A 4IS6B 4E5XA 1KEGH 3O41A 4RX4A 1OTSD 5EB9A 1BQHA 3K74B 5I1CL 3C9NA 4ZO9A 2GFBB 2LTQB 1CFQA 4ENEC 5JOEA 5IB4A 4HMCA 3MLZH 3F58H 4KDVA 3MODH 1JPFB 5HHMB 1U91A 5DVKA 3GSWB 3PWLB 4L4VA 3DXAD 4YDIH 1G9NL 2JTDA 2EEDA 4Z5RB 3TPUB 1YQVH 1NANH 3UTTE 3B5HA 1ZA6B 2N56A 5EIQA 5EZIH 5BZDA 3PL6A 4H25B 3B9KD 4WCYL 3TIEA 1UWGH 2YS4A 4HGWB 5MENB 4JANB 1DBKH 3ZMRA 3BI9X 4HUKB 1GPOL 1XCQA 1FRGH 1RJCA 3KPMB 4M43H 1ROWA 3LEVL 4JPKL 5M7QA 3CVHH 3DETC 2BVQB 4DEPC 1CFNB 4YHPB 4J3SA 2R29L 1MOEA 1T83C 5IW1B 4M7JH 3O81A 5EU3A 3NA4A 4U1GB 5D2LA 4ZXBB 3BZFA 2X1PA 1S7XA 2E7BA 5EOCH 3OF6A 1NGWB 5C0EA 4KI5F 3RWGA 1ND0A 1D9KC 3VD3A 4PR5A 2A83B 4P9HC 4EUPG 1F42A 3PUCA 2P4AB 1CGVA 4G8GE 3PWPB 4Z7WE 4P23C 1NCBH 1SY6H 2J1KA 1AO7B 5KVEH 1S7UA 1FNGA 3EOBA 4NP4H 5A3ID 4GBXD 3SOBH 1FPTH 3FT2A 5DEFB 5CMAA 3PGFL 1WICA 1HXMA 3PQYE 4YHNB 1CE1L 1GOHA 1IJ9A 3LV3A 5GS0L 4KAQH 4XCNB 5E8PB 4EQ3A 1BFOB 2W9EL 4GAGL 5JXED 1A7OH 3GSUA 1OGAE 4LLMA 2XQYG 1P7KA 5CJQH 2OP4H 5C08D 4QHUA 1U95A 4Z7NE 4OM1H 1V7ML 5IW6B 1X5XA 3ARPA 2WV3A 4HQQL 3IDXL 3FO1A 3HE6B 4JFFA 5C0FB 5FECA 5CBEA 2BC4A 4PJ8C 2LFGA 5EN2B 4PGEB 4M8QA 4APQA 4XH2B 2VH5L 1RQ5A 4LHUA 3HAEB 1UT9A 1S5IL 5ALCL 1BD2E 1HIML 3FB7A 4WW2B 2AABL 3GMMB 4R90L 3ZSSA 4P4RA 4U05A 3W0WD 4KKAD 3ZE2F 3I3DA 4HUUA 1CICA 3FO0L 4NO0A 1EGJH 2V7HA 1MFNA 3PNWA 1YDPB 2DJUA 1ETZB 2QHRH 3BQUA 4XVSL 2YBRA 1M7XA 4S0SD 4WNQA 7CGTA 2F5BH 1EO8L 4NM4H 1IKNC 1N64H 1I9IH 2YEZA 3OB0H 4RRPG 4F57L 1F4AA 2BSTB 1EUUA 4MAYC 3UBXG 3ULUH 1DLFH 1OAQL 5DEGA 5IP4A 4OZIF 5C0AA 3VDBA 5TH2B 3RU8L 3VWJB 1J8KA 3G6JF 3GRWA 4ZPTA 1BBDL 1T22B 4JCMA 3H9SE 3G5XB 4G9FB 1VACB 5DK2B 5FA4B 1CXHA 1S7TA 2YZ1A 3QEHA 1QBML 1EV2E 2CKBB 5IIEB 1T1XA 4F2MB 1EXUA 4LLUA 1ZE3C 3QDGD 1RK1A 43CAA 2B4CC 3TPKA 1U58B 5JQ6H 4P3DA 4NZDA 3OKLB 5DMIH 5EZJB 1SVCP 3MJ7A 3W82A 2F53A 3C6LB 2W9LA 4U1NB 1V3JA 2EE3A 3ARFA 2OK0L 3UBXI 3EAKA 3O0RH 2NQCA 2DWDA 3BX7C 4EUPH 4TUOA 3VXSD 3QUXC 1MCRA 3ZKXC 5HVGB 2OJZL 4A2MA 5CIPB 3QR2A 5A2IH 1MQKH 1CDCA 1QVOA 5JIHA 4S2SA 4UV7L 3JXAA 5H37G 3D39B 1I8KB 4TVPL 1TJGL 4XNUL 1ORSB 5HHXL 2R4RH 3DXAA 1B0RB 3V5DB 4KK6D 4WU7B 2ZP0T 5IFHH 2WW8A 5CLWA 2J4WH 1RJLA 3QWRD 4Q6IC 3DUUA 5EBMB 2JIXB 4X6CB 2X5PA 3B9KA 1IGCH 3MRCA 3IETB 4OLXH 4KU1A 3OKKA 3GO1L 3V6FB 2NY1B 1NUDA 3HI5H 3EZ8A 1S7RB 2VQ1B 1GZPB 5DHVH 4LEOB 3LN9A 2P8LA 4MWFB 1EDQA 1Q0YL 2E3VA 4WHTB 4G6KH 2ZUTA 3UTZA 3V8OA 4P5TC 3CMGA 3X3GH 4CJ0A 2KL6A 5KOVC 4WEBH 4JFEE 3V5KB 2VE6B 3MZGB 1ORQA 3T0XA 4HK0A 2ARJQ 1VKXA 1RUQH 1G7QB 3C08H 4YHML 3H3PH 4HXAH 4QRQB 4PG2A 3DMMA 1CD8A 2G5BA 3QFDB 4GBXA 2CLRA 3ZT6A 4K8RL 4Q9CA 4DW2H 5C0DB 1K8DB 2P1YA 4O2CB 4PLKD 1GGIL 3BEWA 1FL3B 3UYPA 3CJJA 1JWUA 2VO5A 4PYHA 3GMNB 4HMDA 4MS8D 4RAUB 4JFDB 4BFBD 3O4LD 3CXHK 4L8SA 2H8PA 1SJEA 2Z8WC 2FO4B 5C08A 1CU4H 1A14L 3BHBA 4GW1B 3WIIL 5LQBL 2SEBB 4LARL 4IRJC 2A6DA 3GBMH 2DOCA 5DJCA 2FX7H 1A6WL 5T5NF 5I74B 1G0XA 3FB5A 5T3XH 4U6VH 1H3VA 5ESAB 1PX4A 5FGBA 2A74B 4PJ5D 2OR7A 5DWUH 5T1DH 4MDJA 5EPMB 3DX9B 3FOMA 2F5AH 5E5RB 3W0WA 3MJ8A 4XP6H 4P2CG 3KYNA 1YPZE 4KXZI 5I8CA 5ADPH 4LPTA 3U36B 3W11C 4DCQA 3C5JA 5CJBA 3W9DB 2MTPA 5F1IB 4DGYH 1MHHB 2XN9E 2IGFL 4G6AC 1LP9B 3N1PC 1K4DB 5TDOB 4HMEA 2ITCB 1FV1A 1N0XH 5I1AA 3PHQA 3AXLB 2CR6A 1AKJD 3U0TB 4YHOL 4HH9A 2IH1B 1NEZG 2UVEA 5KSAD 4HKBA 1I85C 3EFFB 2C1OA 4JB9L 1U0QA 4O9HL 4YC2B 4M1GL 4MXVE 4FQJH 5CINL 1N8ZB 1DQLH 1T5WB 5JO5B 1HQ4A 2X4UA 5D7KD 2QQKH 4P0DA 2ZCHL 3UTQA 3ZT5A 2VLRD 3QO0A 1LO5A 1FE8H 1OARH 3BP5A 3T2OA 5D5MB 3QDGA 3SDAB 1JNNH 3SO3B 1HINL 3T65A 5DQJA 4LKXA 3QXVA 4MNGE 1JRHL 4F7EB 4JZNB 3ZZ1A 5IHLB 4FQXC 5LVEA 3FQUA 5DJ2B 3T0EC 1IM9D 4JHZA 5HDLA 2FLBT 4W4OC 3F7RA 5K9KA 2I25N 2IPUK 3VXSA 2ERJC 4IRSB 1DSFL 2ZG3A 3VXOA 2DICA 3VH8A 3AS0A 5FYJE 4N90E 2VDRL 2JJSA 2VNCA 1JZ3A 3ZDZF 5IVNA 4XP4H 5MI0B 3V0AC 4PJCF 3B3IA 5IJVA 3SE8H 1FHGA 4MQXD 3CD4A 5DD1H 3W5MA 1YJDC 2EKSB 4L9LC 3QWRA 4R0LB 2NY5H 4KXZH 1SHMA 2OI9B 4TUKH 4XPTL 1QSVA 3G5ZB 4M3KB 3BPOC 1A1OB 3L6FA 5GISL 4CW1A 5HHOB 3QZWG 3VD9A 1A9BA 3GGWA 3TO4B 5CP7B 2FHCA 4JHWH 3UTPD 1IE5A 1RZ7L 1FNAA 2R0ZL 4DQOL 3C09B 2BVOB 5HVHC 3HRZB 1A3QA 5E8EA 1PFCA 4RMVA 3VFGH 3O3AB 3VI3E 3BJLA 5C1MB 3QUYB 1JJUA 1EHNA 1EERB 2Y7QA 2DJ4A 5GGTH 3KLAB 1RD6A 2QKIA 4XI5D 1JNHB 2NZ9D 1W72H 2NNAB 2Z92B 4I1NB 4LP4A 1MCKA 3WXVL 1YNLL 1PQZA 1MLCA 2WBKA 5GS1A 1WBXA 4LSPL 3LKQB 5I8OL 5EO0B 1H5BA 4PGDA 4RMQA 4JM4L 4U4BA 3QYCA 5MEQA 2B8OT 3H7LA 1Q38A 2JLLA 1A3RH 4R2GC 5DUBA 5FUCE 4X5XA 4HGKC 4OT1H 4JY6A 4QYOA 3C6SA 1QG3A 4OCMC 5FUZL 4R97C 3IF1A 3O4LA 4PY8J 1T5XA 5KZCD 4G6JH 5IQ7H 3HPJA 4X6CF 4PJFB 1QBBA 3OAYK 15C8L 2AJUL 5EIVA 5DVOA 2DM7A 4KV5E 4ZFOB 1ADQL 2H45A 3AC0A 3BPCA 3D85A 4Y5XB 3DX7B 4ZQKB 3U6RB 4M7LL 1FAKT 2UUDK 4X7SH 1WUNT 2R2BB 4J8RA 4PGCB 1OQOA 4NNPH 3CC5A 1S7VA 4PJ5A 3EGSB 5JMRA 2P24B 2NY7L 5ABDE 4Q0XL 3EZJB 2J8UA 1A4JB 5EORL 5F72S 3VJ6A 3QUZD 3TN0C 3GEWB 5E95B 1CDUA 3O2DA 1VPOL 3LH2L 4FXKA 4TSAH 2VZOA 4MD4B 2UWEE 3BT2H 2BK8A 5A2FA 3U30B 2Y72A 3GJEB 3WLBA 3WUWG 1Q9LA 1CLZH 1NCWL 3TWCH 4FQ1H 1JE6A 4QHKJ 4P99A 1U8KA 5KSAA 3DVNB 3O6LH 4YHZH 4QHLA 2VZVA 4PJ9C 1ED3A 4QXWA 3R0MA 3BESR 4N8CH 3VFVA 4FABH 5E9DB 3LDBC 2VLRA 3FT4B 4D9LH 1I4FB 1Q9OB 5GRJH 5H8DA 1AE6L 1KB9K 3E1F1 5CJXC 4R7DA 3FQWB 4DN3H 2WNGA 5JLZB 3QDJE 4HG4J 5DLML 4ZS7H 3SGJA 3NIFE 5HGDB 1CBVH 4XP1H 4O58L 5C6WH 3D18A 4EN3B 2AERT 1RZIA 4YXHH 1DANU 5HPOA 1D6VL 2RGSA 1XGQA 3PJSA 1EO7A 3VFOB 1LP9F 4K9EL 1FNLA 1UJTA 5FKPA 2B0SL 1PKQB 5IMLB 4M00A 4ZUUA 3TM6A 2MKWA 2PCPA 2BSRA 1LO2H 4B0MM 4UIMA 4OQTA 3BWAA 1A7NH 4F9LC 2DS4A 5DD5H 4OCSH 3D25A 1IEAA 4QRPB 2VAAB 5IBTH 1HWGB 2EE2A 4JPWH 4Y16C 5GSRA 4X7EC 4M5ZL 4L8BA 3LCYA 4U6HB 1JK8A 1DEEB 3G5YB 4JRYB 4L3EB 2NW3B 4WFGD 3RWCB 3MFFB 5F6IC 2X2YA 5D5MF 4PJCE 4J6RL 1U92A 5INCB 4D0CA 1VB9A 4LF3B 4OCLC 2GCYA 2VXUH 5F9OL 2EYSA 4Y5YC 4TPRL 3LS5L 5EC2A 4K7FB 5I1DB 5DRNB 5A16B 1H15B 1HKLL 5HYQA 2FR4B 3DX6B 3MJGX 1FZJA 3MLSL 2ZCLL 3CXDH 3NGBC 4YWGH 2H32H 3MLRH 2YC1A 4F58H 3OXRA 3ROLA 5EUKA 1JGVH 1D5MB 2F19L 1OAYL 2VKWA 4UOW1 2HRPL 3MCKA 3VXMD 1FAIL 1NGXB 1S78D 3BP4B 3PF2A 4ZFOL 1T66C 2LU4A 2DQFB 3CH8A 5TJWK 2EO9A 3KAAA 2UYLA 4P2YA 3F7PC 4WHDA 2EH7H 3GMLB 3JUZA 3BKMH 3UJIH 2YKLH 4OF5A 4WTXA 2ITDA 5FYJU 1OTTD 1IAIM 3QIBC 3NZ8A 1HQRB 1ITCA 4FZEH 1IL1B 5D9SB 3MLVL 5L88L 3LRHA 4LU5H 3TT1H 4QRRD 4ZOCA 1C08A 2N1KA 2OL3B 3RNQB 1G6RA 4QOKB 4R3SA 5DMKA 3RNKA 2VXTL 3K8LA 1MY5A 1NJ9B 1T1ZA 1WWAX 3JTSB 2XRAH 4BYHA 2VDQL 4LAJH 5GQBA 1WC7B 4XXCC 4PP2A 2FHBA 3L7FA 4LKCB 1A2YA 2JCCB 5D1XD 2J8OA 2O5ZL 5IWLA 3B8YA 3X3FL 1CDBA 1S9XB 1RK0B 4GH7B 3WFCL 5CJOH 3K4AA 3S36X 1HHIA 3N85L 5ALBH 1X4ZA 4UUJB 3ULUD 1MRDL 3C2AH 4HCRA 3P73B 2WMPA 5HY9B 2Y07L 3TJEH 4NN6C 4GRWH 5E2TL 5CD3A 1KCRH 2VN4A 4JO4H 2KUTA 3MRDB 4P59L 4F37F 5I1EL 5JOFA 1SYSA 1ZKAA 4WWKB 3TNNB 3QXDA 4MCZA 4NZUH 3RWIA 1HH6B 3RUGB 1UM4H 1A7QL 3I6KA 1NMCB 2I60H 1VFBB 5L7XL 3BPNB 1W0WB 3SY0B 1NLDL 2P5EA 1UEMA 4E41E 1FO0A 4QKXB 3O45B 1MRFL 1QP1A 2ARWA 3VCLA 3BUTA 3T2NH 1E4KC 1L7IL 1OPGH 1KLGA 3MLWH 5DZOA 4AH2A 4JRXB 3EYQC 1Y0LB 3B6SB 1C16A 4Q9RH 1KCLA 4UDUB 1FNFA 3ARXA 1NMAL 5ELIA 2HVJB 2QJDA 3UJJH 4F15B 5IT2H 1J8HB 5ID1A 3ARDD 3SDDC 3KDMB 3BVNB 3B2VL 1XGTA 4AENB 3P11H 4NOBA 4Z0XA 5AUMB 1GCFA 4OZFH 4GKOA 5DTFB 5HPMA 5LXGH 5KBNC 3CDGB 2VN7A 2BSSA 2AK4E 2YD8A 2IADB 4NIKB 4U1SA 3HCVB 5KSUA 4CN1A 1RMFL 4X4XA 1H3PL 2QQNH 1KNOA 4ZYKB 4XCYB 2A38A 3VXQB 3CVHA 3SE4C 5ECJE 5K9QI 1R5WA 4P2QE 4KJPC 3V4VL 2XPGB 4CMMA 3DSFH 1HNGA 3WJLA 5CBAA 5BRZD 1RFDH 3V0WH 1GZQA 5JNYB 4J23A 4YX2L 5KSBF 4ODSH 5CEZH 2BMKB 4YPGA 1TJHL 1T0MB 1U8QB 3LKOB 1SY6A 3DURA 4KI5C 3TYFB 4HPOL 1QRNB 2CSPA 3QPQD 4YBQD 3LRGA 4PLNC 2R56L 4G80B 1IM3A 3FRUB 5LWYL 5T33H 5J6HA 1TJIL 4OZHA 3RDTC 3VXMA 5DC4B 2CRZA 3QIUC 4PJEE 5IB2B 3MV9E 4X6BA 4OM0L 4PD4K 4EI6A 5IOPB 4UU9B 2Z93B 3C60C 3O6MH 4AEEA 2OL3L 1KACB 5E94B 4LCUA 1C5BH 4O02L 5SV4A 1HHHB 5D2NA 3DRTA 4OKVB 1IGYA 1T0PB 3UMTA 4GKZA 3TO2B 1YUHB 3SKNA 2ZOKB 5BS0E 3OJDB 1LGVA 4WO4B 5T3XD 5GGSB 4M6ML 4CAGA 4QRRA 2JB5L 1G9NC 1YYML 3MBED 5FEBA 3DROB 2KZ1B 1G7HA 2R2HB 4JGMA 4BUGA 3UPCA 2VABA 2XWBB 5DJAA 4HF5L 4NSKA 4RGOL 4KQ4H 4LCIH 2J8HA 2VITB 2C4FT 4P4KB 3DX8B 4WWID 4I9WE 4YHKL 3BIKB 5J1AA 5D1XA 4GAJL 1MAKA 2NY3D 2FGWH 2D0HA 4RISH 4L4TB 4ZUTA 1XF4A 1OQXA 5BO1L 4YFEA 3LEYH 3VGAC 1AD9B 3D3VE 4LRNH 1MCPL 3KYAA 4UINH 2BNUB 4OGYH 2CXKA 5FO8A 1I3UA 4OZ4B 5SWQB 4QHNA 4PRPB 4POZD 2Y6SD 3PIQB 1RHHB 3RWFB 4X4YA 5D7JB 4EDXA 5EOCJ 4PRDA 5DRXB 2GSGA 2VQUA 3L1OH 2ZUYA 3P4MA 2J5LC 5GSVB 1XGYL 3OX8A 2XFXA 2ESVB 2BP3A 2HFFB 2YA2A 3MRGB 1B4JL 5K33A 1FDLH 4NPYB 2PW2B 5TE7L 4O51A 3UEZA 3QFJB 4UNTA 3GSNL 2W0PA 1YEGL 4U1MA 3V4PL 5ISZD 3OPZL 5GS0C 4M7KH 3RI5F 3WJJA 3T09A 1WIUA 3AREB 4Y4HB 1T7ZA 3EO9L 4QY8A 2DMBA 3OAUL 4ELMB 4Q9BA 4OCYL 5CZKA 4OD1H 4ZTOH 4XCEB 2AV1A 4HFUH 2P49B 2JCCF 3HNVH 5TDPA 3SCMC 5IMKA 3RGVB 3CGTA 3GHBH 3ARDA 4FG6C 2NXZB 2GUOA 2NTFB 3O9WD 4NO2B 1LDPH 1J7VR 1AHWB 2HLFD 1OD9A 4LSRH 1KENL 4WI8A 4ZG1A 2BVPB 1DVFD 1F3DH 5GRVL 1NCTA 2CR3A 4YBLC 5D7IA 4E5XB 2BVYA 3PDOA 4NN7C 1INDH 2Y4SA 1BQHB 1ZHLA 1INEH 5M94B 1CZ8L 3C9NB 1OD7A 5CILH 4ZPVA 2H2PC 3EYSL 3R1GL 3U46B 5F7FA 4P2OB 5IB4B 3VRLE 1KN4L 4NRZA 4OGXL 5KVDL 5FOBA 5DHVA 3RUGF 3G5VA 4KKLD 2CIKA 2BY1A 4S1SH 3TIDB 4BQ6A 4XHJC 3I50L 1U91B 4L4VB 4PJ7E 2L0DA 5ERWA 1A21A 4M93B 4ODUA 5DUMH 3TESA 5BRZA 1ZGLM 3MRFA 4LIQH 3GIZH 4NQUA 1IAMA 4OFYD 5BZDB 2XG5A 3FHQA 3PL6B 3SEPA 4UBDC 3DECA 4GW5B 3TIEB 3HMXH 3K0WA 1OGTA 4JPIA 1XIWC 2W59A 3GJFK 4PRID 5IHUH 3K4DA 3D9AL 4LLVA 4JG1L 4NWUH 5FHBL 4W68A 4DFIA 1PBYA 2IBZY 5GGVY 25C8H 1FGNL 2PYEE 2LTQC 5EU3B 3UBXA 1UQSA 5IM7A 5D2LB 5A2JH 1S7XB 4P3CL 3QDME 5KSBE 1YMMD 5C0EB 3RWGB 1J0HA 1P2CA 1ND0B 2YWYA 2NTSP 4PR5B 2O5XL 1HYSC 1MEXL 3VXTA 5H94A 3ZKMC 2CO7B 3QHFL 2DMKA 1S7UB 1TCMA 1FNGB 1WAAF 3QEGH 3EOBB 3KLSA 5CP3H 1MCIA 3FT2B 5CMAB 1HXMB 1WZMA 3PHSA 4U2ZA 5LCVL 3LV3B 1WT5C 3FQRA 1IRAY 2AQ1A 3GSUB 3MBEA 4MDIB 4R8WL 1A4KA 2DLFL 35C8H 4LLMB 1P7KB 1KTRL 1Z6JT 4MGXA 4NC1C 4ZUSA 4XT1C 5EA0H 2XTJD 2F74A 1KLFA 4QHUB 1U95B 4U1GC 1J9CT 4ZXBC 4BFIA 1A7PL 3C87A 2MSPA 2P5EE 4CVZA 1H3TA 5DC9B 3S37L 3MV01 3FO1B 4JFFB 5CBEB 2BC4B 3HAEG 4PLJC 3RTQD 4APQB 1T89A 2YMXH 4LHUB 4C59B 2JJVA 2VL4A 4HPYL 3FB7B 4MA1B 3L3GB 4M7ZB 1NAKL 4AEHL 3FAXA 2V7HB 3NPSB 3PNWB 4JDTH 1UA6H 2Z4QA 2AJYL 3BQUB 1UH4A 3NCJH 5I1IH 2YBRB 2QADB 4WNQB 3MLUL 3ARGA 4OJFL 2O26U 2YEZB 4D3CL 5J12B 2BXYA 2D3VA 4OBSA 4K8RC 3MOAH 4B41A 5JHDB 5EWIL 3VFSA 4BZYA 5ISZA 2HFEB 3WD5L 3HE6C 5CSBA 5DEGB 2AXGA 5I75B 5C0AB 3TBTB 2WUCH 4TSBL 1IZKA 3O2VH 1O5DT 4ZPTB 1NKRA 2EZ0C 1CTNA 1YC8A 2ZPKL 1FH5L 4OLYH 4WW2C 4YNYA 3TNMA 1WZ1L 4PJGA 1S7TB 2QQLL 4TQEL 3MV7B 3QEHB 3HNSH 1T1XB 1EXUB 4LLUB 3QAZB 1RK1B 5E8OA 43CAB 2VLJD 3O9WA 2CUIA 1QYGL 3MJ7B 2F53B 5E08L 3DYOA 2DLTA 1F58L 3ALPA 2P5WD 1LEIB 3UO1H 5JDSA 3A6CL 3ARFB 1DVFA 3DHJA 3B9VA 1OAXL 2H41A 1S7SB 4NCDA 2IBBA 2DWDB 4YR6A 2I24N 2C26A 1A1MA 4U1JA 4TUOB 4W70A 1MJJA 5KTEH 2AEQH 1NCAH 5J8OA 2X89D 1QVOB 3VXME 3VWJC 3ZE0F 2Y06H 4Z76A 2XYCA 4DGIH 1TZHA 4KKBC 1OAZH 3DXAB 5GGRY 4NFCA 4KZEL 2BHUA 2VDLH 3QCUL 4FRWA 5DJZA 1RJLB 3RWJA 3DUUB 4FQ2H 1QFUH 4P9ML 4OFYA 4LSTH 1AXIB 4NQDD 3B9KB 1W72A 1IGMH 3QUMH 1KCVL 3HB3D 1T80A 1GAFH 1HZHL 3C6LC 1SYVA 3SQOL 3OKKB 1IKFH 1WJ3A 1B90A 3NAAH 3AS1A 2XZQH 4PRIA 2CRYA 4M62L 4WFHD 4QRRE 2RIKA 3S34H 1K3ZA 2P8LB 4LNRA 3HAEH 1NKOA 2AEIT 5K59F 4XVTH 4G6FD 3PP3K 3UTZB 1NEZA 2OZ4L 1SEQH 2H9GB 5HD8C 1ZLUK 1T1WA 4Y88A 1MFAH 5JHLH 1YMMA 1V3LA 1ORQB 5D1ZD 2AJVH 1VKXB 2HT4C 2Z9TA 4XNXL 4NJ9L 3S88L 4WV1A 2G5BB 4K2UH 4GBXB 1KTLA 3MNWA 2CLRB 2E9JA 3BEWB 5IVXA 1HXYB 4GRMA 2OTWA 1T03L 1JWUB 2NY1C 1BVZA 3KLHC 1HE7A 1UYWL 3ES6A 5IF0A 1HNFA 1X5JA 5EFIA 2R23A 1SJEB 5C08B 2HT3C 3BE1H 1BX2A 2CKBH 3NACL 1DBAL 4L1HA 1X9QA 2ADFL 1WF5A 2A6DB 1FLRH 1KJ2H 4JY5L 5DJCB 5B39A 2DI8A 1WISA 1ONQB 2EXYC 3RTQA 4D8PA 3ZL4H 2DF3A 3FB5B 3OGOE 1A6PA 4P46D 2QTEA 3MV8D 4MDJB 3MOBL 3FOMB 3MUZ1 3W0WB 3MJ8B 2WBWB 4A2LA 3KYNB 5I8CB 2E6PA 4O4YL 4W4NA 4DCQB 3GZKA 3QZWA 1KCSL 3EDKA 4KRLB 4M1DH 3GRWL 3IFOA 5I8KL 4JN1H 3MSPA 1GC1H 4XX1E 5I1AB 3PHQB 4XVUC 2EYRA 2BJML 4HG4K 4U33A 1F13A 2VDKL 4HH9B 2EKJA 4HKBB 2C1OB 4JQIH 2XI9A 2OTPA 2LAGB 2A6IA 5I74C 2JJUA 4K7PX 4KY1L 1HQ4B 1LQSR 2X4UB 2K7PA 3DI2B 3UTQB 2JJTA 3QO0B 1QSZA 3BP5B 3HUJA 3CK0L 1T0NA 3FB6A 3QDGB 3VG0H 3QEUA 2VLJA 4CMHB 3T65B 5DQJB 3FJTA 4WUUD 3QQ4A 1P4BL 4LKXB 1RZFL 2DBLH 2P5WA 3LPGA 3FQUB 4OCXL 3FN0L 1IFHH 3JTTA 4H20H 3GBLA 2VZUA 1KUMA 4HWBA 3NH7L 4B53A 3KXFD 5T1LD 5B4MC 5K9KB 4UNVA 4Q9QH 2ZCKL 3VXSB 4FFWC 1J11A 3VXOB 1KULA 3V6BR 3VH8B 3O6KL 1HSBA 2X89A 4XWGH 4YC2C 4H1LG 1N4XH 2P48B 1H9VA 2B1AL 1YYLL 3B3IB 5IJVB 4MA8H 1T7WA 1FGVH 4XNMA 3WFEH 3H3BC 5JW3L 1RZKL 2BNRA 2YK1H 3SDAC 2Q3ZA 2DTMH 3SO3C 1KV3A 4NQDA 1DBBL 4FQIL 3V6OA 3MOQA 3ESUF 1NGYA 3L6FB 2H32A 1F4YL 4CW1B 2BCKA 3H2WA 1A9BB 3GGWB 1NC2D 5E5MA 2MPAH 3LMJL 3ZE0E 4ZSOE 3DYMA 5IFJA 5D96B 1MIEH 4R6UA 1K5NA 4LAQH 5DRWA 5GRWA 5F9AC 4JAMA 1JHKL 4W81A 5E8EB 4IRSC 3RVXC 4U2YA 4AG4L 3FRPG 2QBWA 1X5KA 2G5RA 2X9YA 4D2NA 1CVSC 4YIQA 2ADIA 2GY7B 4TULH 2Y7QB 4LPCA 3OR6A 2OQJA 3MROA 5MI0C 3MRHA 2ICWI 2R1YA 2R0LH 2QKIB 4U1HA 5J13B 1U41A 3QHZL 2FYYB 5D1ZA 5DYOA 2DM4A 5SX5H 3MBXL 3L9RA 1PQZB 1MLCB 5GS1B 5GJSH 4R0LC 1DBJL 2IFFH 1VGEL 2OI9C 3SDXA 1H5BB 1AJ7H 4PGDB 1MCEA 5TE6H 4JQXC 3ISWA 4JFOB 4FTVD 3T3MF 5MEQB 3OZ9H 4O2FA 5DUBB 4K9EC 5MP6H 4X5XB 1ZSDA 1BGXL 1G7PA 5L2KD 4JY6B 4QYOB 3TBYA 3TO4C 3DVIA 4M6NH 3C6SB 1NGPH 1CS6A 3RHWK 43C9A 4B5EA 3IF1B 4KZDL 3C09C 3O4LB 1T5XB 4IMLA 3HPJB 5I6XB 2BY2A 2EXWC 4S1RH 3QUYC 3DUHA 5A2KH 3RIFF 5L0QB 5GGRA 4P5KA 1URLA 4Y0GA 3VXUE 4CVWA 4XC3L 1R24A 2A0LC 3BPCB 4XMPH 4QXGH 1AXTL 2FO1A 2R0WH 2DQIH 4OFPA 3IJHA 1J88A 3KJ4B 5T1MB 4J8RB 3MV8A 4WIQA 4PJ5B 1QHOA 1S7VB 3CC5B 4XCCH 5GZND 3A6BH 5D70H 5FYKE 1U3ZA 3LVEA 1T6WA 1QRKA 3RY4A 1IQDA 4PJGE 1AI1H 2J8UB 4MAUL 3GKZA 4RWYH 2QSCL 4N0CD 1BLNA 4AIXA 3VJ6B 4FA8A 4F8TA 2MMXA 4YFDB 1RZJH 4EQ2A 4FXKB 4H1LH 5I1HH 5SWSE 5ICXA 1AKJB 5F3HA 4OSUH 3WLBB 4JN2A 1Q9LB 3TZVA 2YPVH 1KPVA 4YDLB 1F6AB 5KSAB 5HYSA 5A1AA 4QHLB 4Y5XC 1UENA 1ED3B 5DT1H 1HDMA 1DQJA 2EYTB 1ZLWK 1FYTE 3OKDA 1UH2A 1GOGA 3EDEA 1CR9L 12E8L 3H9YA 3VFVB 3B9AA 2VLRB 3GBNH 4F33A 3CZFA 3S98A 3SGEI 4KMTL 4R7DB 4OZFA 3RAJH 3HS0A 1U8JA 4WUUA 3HC4L 5EU7E 4G42A 4O5LH 3QP3A 5IBUG 1BVKB 1A64A 1UVQA 2I9LA 3ARUA 5GHWH 5J1SC 1IM9B 1NCUA 2K1MA 5I18L 3MGTA 3H42L 3U30C 4Z7VB 1IBGH 3KXFA 4YPJA 3MCLL 3BKYH 1Q8MA 1RZIB 3VA2C 5T1LA 1QD0A 3ULVH 4MQ7A 1FC1A 1XGQB 2BRQA 1WFTA 2E27H 3PJSB 3ZKQD 1JF1A 3VU2A 5F9JA 2X1WL 3WXWH 3QXTA 5FKPB 1A5FL 4U1LB 2DIJA 4G7VL 2XZAH 1FCGA 4KK8D 1F8TL 1BQLH 2PCPB 4TRPL 4DKEL 2WWKO 4R4FL 1WFNA 4GMTL 2CLZA 3E6HA 4UIMB 3BWAB 3SKMA 4QNPF 4BZ2H 3D25B 5IGXL 1VA9A 2EC9T 4OIBA 1IEAB 4LSSH 4Y5VA 1NC2A 4L8BB 4YXLH 1CWVA 1JK8B 4EN3C 3V4UL 1BECA 5EULV 1FL5A 2V9RA 4UTAH 4NKQB 1EVTC 4OD2A 3LB6C 1TXKA 1U92B 4P3WA 4BK5A 4D0CB 1I1AA 1GSMA 4NKIL 5KSVA 1FG2A 2EYSB 1HEZA 4NQCE 4OIAA 4UOW0 3FOLB 4FFVC 2ZUQB 4X6FA 5HYQB 3GB7A 1FZJB 3FZUD 4FNLH 1CD0A 5FO7A 3LPWA 3RVWC 2FBJL 2YC1B 3ROLB 5CCKL 5EUKB 3IDMA 3SGEH 3QWQB 3LRSA 4FTVA 4H26A 3MCKB 2Q7YA 1LO0H 2G60H 3BD4A 4OQ1A 3GNML 5L2KA 3VXRE 4GAYA 1KF9B 4JY4A 2UYLB 4J3VA 2VZSA 3NOIA 1IC4L 1A3LL 5KZCB 1WCBA 4KJQC 1P9MC 2ITDB 3GM8A 4IDLA 2AI0H 4JM2D 3NZ8B 3BKJL 5HHNA 3CNKA 3WHXA 4MA7L 5C71A 5IMMA 1HK6A 3T3ME 2UZIL 2QR0A 1P84K 1C08B 4V1DD 1G6RB 3O2DL 4R3SB 3AUVA 1JN6A 3RNKB 4Y8DC 1DQQB 1T1ZB 2O5YL 3HZYA 1SMOA 1UACL 5C0CA 1VERA 1RSFA 2UZXB 2GT9A 4PP2B 4RDQG 4NWTH 3HRPA 5C07D 1A2YB 1KIUA 1EMTH 3RWHA 3QUZB 4LPYA 4IEFB 4IRZL 2FJFB 4C56D 5C9KA 2DRUA 4D0DA 3CLEL 2RAMA 3HZKB 3KPRE 1HHIB 3U4EA 5BV7B 1OHQA 4RBPH 1FYHB 2DYPD 1QPXA 1LO4L 1U8LA 3D1MC 3WFHA 4ZS6D 1J87A 3BDYL 5CD3B 3BFOA 1T4KA 1OB1A 4XPHH 2EIEA 1SYSB 3QXDB 3RIAK 1ZLSH 3CFJA 3RWIB 4MXQD 4HUWA 3I6KB 4JZOB 2GJZB 5E7FA 2YUXA 4NZJA 4GQ9L 2NR6C 3FFCD 3MXWH 1FIGH 2Q87A 1HSAA 2OR9L 1QA9A 1MI5E 2RBLA 2ZUUA 1NL0H 3UJTL 4AEIL 3MRLA 2BNRE 3IRZA 5E2WH 5K9OA 3FTGA 3VRIB 3VCLB 4UZGA 5AYQA 3T0AA 3QCVH 3LIZH 2DQJL 4JKWA 3BN3B 1D6EA 1KLGB 4AH2B 2YWZA 1A6VL 5D7SH 2PXYA 3DTXA 1KJ3H 2J8UF 5FF6A 4PP1C 4OQTL 4F7PA 4EZMA 4XC1L 5ID1B 4Z8FH 2R8SH 3CIQA 2HKFL 4YFLF 3VA6A 4LQFL 1XGTB 4WWKC 5D7LE 3R06A 3M07A 5TQ0L 4H8WL 5HPMB 5FYKU 1QOKA 5HXMA 3QRGH 1UCBH 5T5FL 5JIIA 2WBJD 1MCLA 2OMBA 2B39A 1JP5A 1JGLL 4JFPA 3HMXA 4U1SB 4JFZH 1JHLL 5BW7C 4X4XB 4KVCH 1KNOB 5EC1A 5JW4R 3TBVA 2R69L 4NDMA 3CVHB 2ZUWA 3EYVA 2B5IB 1R5WB 1A47A 2H1PL 3A0OA 1OP9A 7FABL 5DD0L 1BAFH 4CMMB 1YEKL 5CBAB 4TNWK 5FGCB 4F15C 1GZQB 2XQBH 4XXDA 1CXLA 2XZCH 4QNPE 2X4SA 4YPGB 1EBPA 3IDGA 3VD5A 4KDTC 3M45A 1EX0A 4LVHB 3CH1A 4NZTH 3DURB 4Z7VF 3RL1A 3OV6A 5ITBL 1J1XH 5CP3A 5BXFA 4DOHB 3ILQC 3RKDD 4GG8A 4D9RD 1IM3B 3SN6N 4ZNEA 4WY7H 5T3ZH 5BOPA 5J6HB 2VXQL 4OZHB 3C8DA 2X1XR 3VXMB 1KC5H 2XY2A 5GZOD 2FZ3A 1PG7X 4OIIL 4X6BB 4EI6B 4OTXL 3NCCB 4UQ3A 1RIUL 3PWVA 1KCUH 3OJVC 1NUNB 1G6RL 3P30L 1F3DJ 4FP8L 1FG9C 4WI3A 4XAWL 4JM2A 1HHGA 5D2NB 5D6DA 3DRTB 5ID0A 1QKZL 3BSZH 3WDJA 1IGYB 2NYYC 4GKZB 4J3XA 4RFEA 3SKNB 1BFTA 4Q6YA 4X7CC 3GKWH 4IDJH 4KVNH 2WWKT 4QRRB 5KVMC 4LOUC 4NQVA 5IHZA 1TTUA 5D6CA 4V1DA 5F7EH 3B83A 5TPWL 3BJ91 5HHQA 1FNSH 1G7HB 3C2SA 4HC1L 4EDWL 4JO2H 5IJKC 3BZEA 2VABB 3REWA 2QEJA 2E7HA 5DJAB 2XWTA 2VDNL 1MHPL 1X6LA 4WDIA 2C3HA 1I1FA 4NSKB 2R4SH 3ILPA 5KS9E 1TVBA 5C07A 4K94L 1NAMH 3GMOA 5J1AB 5D1XB 1D5BA 1ZT4A 3AROA 2Z8VC 4BFGA 1KOAA 4NQEE 2GJ6E 3Q1SH 4ZUTB 1XF4B 2LVCA 4C56A 1G9ML 4GOSA 2A9NL 5FUOH 3S35H 5AEAA 4PJDA 1L0YA 5FO8B 4QHNB 4M4PA 2FX9H 4QTIL 4Q7DA 4LGSB 2X4PA 3TT3H 2BDNL 2CK2A 4X4YB 4WO4C 4HULB 4EDXB 3JWNC 3RZCD 2PO6A 3TVMD 3VWKD 4PRDB 2GSGB 4TTGA 3P4MB 1KEGL 1QPPA 3B2UC 3UZQA 3OX8B 2XFXB 2Z91A 4QXUH 1Y6KR 4M1CC 1Z9SA 1CLOH 2OXHA 3BRDA 3FFCA 5E2JA 4G5ZH 5C09E 4O51B 4P4KC 3BD5A 2W38A 3QXUA 3MLZL 2V9TA 4U1MB 5CEYA 3F58L 3MODL 1J0JA 5DGRA 3BMWA 2EXYD 4QY8B 2N7AA 1YQVL 5DVNA 3EJYD 2AV1B 5EZIL 5TDPB 5IMKB 1UWGL 5D7JC 2GITA 1FBIH 3ARDB 1DBKL 5C92A 4HBCH 1FRGL 2GUOB 4PUBH 3OL2A 4M43L 4RGNE 4R4ND 3WIHH 3JWDH 3CVHL 5B38A 1H3UA 2D7PA 4S11A 5JXAH 4YXKH 1TCRA 4DFHA 2WBJA 2X4NA 1BQHG 1XT5A 4M7JL 5HI5C 5D7IB 1NMBH 2X4OA 3PDOB 3QUMA 3NMEA 1ZHLB 3BUYA 1C12A 5EOCL 1YNTA 4ZPVB 2GEEA 1X6NA 4HK3N 2VTFA 3FAWA 3AREC 5JW4M 4Y4HC 5DHVB 4NYLA 3G5VB 3ZE1F 1JTPA 5L2KE 2CIKB 1MFBH 4DUVA 1NCBL 1SY6L 5KVEL 4NP4L 2GY5A 2AKRA 5ERWB 3SOBL 1FPTL 1IAOA 1UCTA 4R26H 3RGVC 4ODUB 5BRZB 1EAPA 3MRFB 5HVFB 1VEMA 3HC0A 2NXZC 1X7QA 4KAQL 3ZO0A 3KYOA 5DD6A 1A7OL 2X70B 4TTDC 1AHWC 3SDCD 1R0AH 3RVTC 4HS3A 1BJ8A 2VZ1A 4LPWA 1OGTB 1MFDH 5CJQL 2OP4L 1NCCH 4KJWD 1MFEH 5J1TC 4LLVB 1N5AA 4L8DA 1MCOH 3QQ9C 4OM1L 5ILTH 3F7VA 3SJVD 4X8JA 2LE9A 5LKNA 5ACZA 3BAEH 1T6VN 3ARSA 5C0CE 3UBXB 1UQSB 1H3WM 5IM7B 5C0ND 3NIDE 3VMOA 4M6OH 4Z7UE 1P2CB 4HEPG 3IKCA 4OF0A 4M93C 4UNUA 3VXTB 4PS4H 5H94B 2DQUH 1BFVH 4MXWH 3J8F7 1EGJL 3PL6C 1MJ8H 4JKKA 1KJ2A 4OZGA 4NNYA 2QHRL 4LCWD 3V5HA 4GG6A 4LLYA 3FN9A 2V7NA 1G1YA 2DQDH 2F5BL 3FQRB 4NM4L 1R5IB 4X4MA 1N64L 1I9IL 1Z5LA 1NGZA 3MBEB 1A4KB 1XR9A 2D4DA 1AQDA 3VFWA 3KYKH 3BIAX 4ZUSB 1T21A 2Q7NA 2F74B 3TF7C 3ULUL 1PYWA 3CVIH 1DLFL 4KJYA 3VXNB 4BFIB 4K55A 4WI4A 2JK5A 1U8PA 2FBOJ 4CVZB 4RWHA 2NY3B 1DUZA 2E7CA 1CGWA 1S5HA 1OT2A 3CMOH 5DUPH 5C2BH 5E7BA 2K9UA 2BZDA 2J12B 3H0TA 2IANA 5JQ6L 5DMIL 1ODAA 3L95A 4ONHA 4X6DA 3TO4D 1MJ7H 3TVMA 3VWKA 1KTDB 3O0RL 1OW0A 1PAMA 3DNKA 3EO0A 3KJ6H 4HHAA 4PJBE 3K2MC 4ZAKD 4JDVB 4AJ0A 1A6ZA 2AQ2A 2NW2A 1MQKL 2L7UA 1H0DA 3VFSB 5ISZB 3MJ6A 3RA7H 4ZUVA 2AXGB 2R4RL 4ODTH 2XNAA 4APQC 5IFHL 2J4WL 5DQDH 4ONGH 5JIKA 1GOFA 5IBLC 3ULVD 5EDXA 5MHSD 4MA1C 4X6EA 4YNYB 3LN5A 4KH2A 1V3MA 2AJZB 4M7ZC 3JBG7 1IGCL 4XP9H 1HHKA 4Z7OE 5HYJD 2EDBA 2Z31D 4HFWA 4OLXL 5FYJH 3NPSC 3JWOC 5E8OB 5LGJA 4QRUA 3HI5L 3O9WB 3BQUC 5EUOF 2ZNXA 2QADC 4MB5A 3P9MA 1ZWIA 4TVSa 3ARYA 5J12C 1OAUH 5GPRA 1CFTA 5JDSB 3ULUF 1DVFB 1N59B 3WE6A 1M05A 1CGYA 4HZLA 4G6KL 1TTGA 3X3GL 3LKNA 4YR6B 1A1MB 4U1JB 4WEBL 3JV0A 4U0RB 4W6XB 1MJJB 1FZKA 5I75C 5DO2C 2X1QA 2C3GA 1KXQE 1RUQL 2YA0A 5J3HD 4Z76B 3C08L 4JVUA 3H3PL 4HXAL 1TZHB 5ESVA 1CT8B 2V17H 2WWMC 1OL0A 4WFED 4TNWF 4DW2L 5DJZB 3K8MA 3RWJB 3T4AA 4PJIB 4PJHA 3QAZC 5F7WC 1MREH 1J18A 1W72B 5ANME 3SDCA 1SYVB 4YHIA 3TFKD 1ZLVH 3ARFC 4PRIB 1JYNA 4BH8A 2VIRA 4LVNC 1XF5B 1CU4L 3ZE1E 5FYLE 5HGAA 4CJ1A 1OTSC 1QSFA 4LNRB 3SJVA 1E27A 2ERJB 4PIRF 3FQTA 3GBML 2YUVA 4EXPX 4XPGH 1NEZB 3OWEA 2FX7L 2HA1A 5DXWA 3UC0H 3BISA 1T1WB 4FQQA 1YMMB 5T3XL 4U6VL 3JWOH 1GXEA 2FGZA 3F62A 5D7IF 5DWUL 5T1DL 3KNBA 4MVBD 4QO1A 1S7WA 2F5AL 2WIMA 1EK3A 4XP6L 3IYLW 4WV1B 1RVFH 3WFZA 5ADPL 1IQWH 1KTLB 1TVDA 3MNWB 3B9KC 3T1WA 4LSDA 1Q0XH 4DGYL 2YXFA 5IVXB 4GRMB 2OTWB 1MHEA 1UKTA 1ZAGA 1JF6A 1N0XL 1UKSA 4BJLA 3ES6B 5IF0B 1LILA 5EFIB 2EDQA 1RZKC 1X5GA 2R23B 1C7TA 1UZ6F 2FIKA 4S1QH 4UTBH 4X99A 5E1AA 2XTJB 3BP7A 5F96H 5JPNA 2DQHH 1BX2B 4I18A 2ENYA 2Z8SA 4FQJL 1RIHH 3G04A 1DQLL 1F6LL 1P5UA 4H1LA 4MD5A 2A1WH 3FQXA 2FSEA 4NO3A 3GI8H 2QQKL 4PJAF 3RTQB 4D8PB 1FE8L 1OARL 4PG2C 3WEXA 3OKYA 4PRHE 5CGYD 5A3IC 2ICWA 3NVQA 4GBXC 3MRBA 3HC3H 1JNNL 5CAYB 1UFUA 3QNYA 5DC0A 1QO3A 1XGRA 2X05A 1C5DA 5JXEC 3O6FD 4BFEA 3QZWB 4N0YH 2VWEC 2WM0A 3SKOA 3IAQA 3CFCH 3BYYA 4L8SC 3HG1D 3IFOB 2OX5A 5H35A 2EYRB 2IMNA 2VLMD 3FRPA 4U7KA 1K4CA 2Q6WA 4XP4L 3GSQB 4DVRH 3O2WH 1J1OH 2A6IB 4HXBH 3SE8L 2EDNA 5KVGH 5DD1L 3IDYB 4Z95H 5FGBC 1B9ZA 5DJYA 2NY5L 4TUKL 4GXUM 3S36H 2P42B 4KKCD 1PZ5A 1JPGA 4UDTA 4KKAC 3HUJB 2H26A 4ZFFA 4GMSH 2Z31A 1T0NB 5HYJA 3JV4A 4XNYH 1ZA3A 3FB6B 4FQXA 3QEUB 4JHWL 2VLJB 1UWXH 2VDMH 3OQ3B 4QLRA 3DO7A 1I8LA 3QQ4B 4W4OA 3ARZA 1F6FB 2P5WB 3UTTD 4U3HA 1GYAA 1JZ4A 5IK3A 3JTTB 3VFGL 3GUTA 2DM3A 3J7HA 3PXJA 3VH8G 5DJ0A 3K8KA 2WQ8A 5GGTL 1A6AA 1CYGA 1HSBB 4Z7QF 1W72L 4I0PD 1F4XH 1K9TA 1SBSH 3IDIA 5EUOE 1WBYA 4XNMB 4J7RA 1A3RL 2EIZA 4CVUA 1RUAH 1Z0NA 2ZUVA 1KB5H 1XZ0A 2KPNA 4LPUA 4OT1L 5BMFH 4MD0A 2ICWJ 4NQDB 4CMHC 4KRPD 4G8GD 2H32B 4RA3A 2BCKB 4LHQB 4G6JL 2DQCH 5E56A 5E5MB 5IQ7L 5F7UA 5IFJB 4X4ME 5D71H 5HGGS 1CDGA 1K5NB 3S3JA 4N9OB 5DRWB 5IW3A 3PQYD 3EO1A 4JAMB 1TIUA 4PV9B 4WHCA 3MA7A 3WUWB 3KHOA 1ZANH 4G6FB 4JB9H 1UXSB 1Z2KA 1OGAD 2JJSC 3Q2CA 4YIQB 5GJTH 2ADIB 1U42A 4NC0B 3MROB 4X7SL 3MRHB 4U1HB 5F6HI 5ESQA 5DURD 5D1ZB 4NNPL 5DYOB 4KK6C 5B22A 3L9RB 1J5OH 5IB3A 4YLQT 4WTZA 5JORA 1IGJA 3UYRH 3SDXB 4FQLH 3G9VA 5HYEA 2IANE 1Z3GH 1ZSDB 3WMSA 1G7PB 3TBYB 1CGUA 4TSAL 1BD2D 1UGNA 43C9B 2K7QA 3BT2L 5F7DA 1TNMA 4BUHA 4PJIF 2NPLX 1CLZL 4IMLB 1LEGB 3TWCL 1P53A 1HYRC 4FQ1L 3ARTA 1I9RH 3O6LL 4YHZL 5GGRB 4P5KB 3QDHA 1NCNA 4F3FA 1R24B 4UQ2A 5E8NA 5J13C 4N8CL 4FABL 2I5YH 4MZ3A 5GS1C 3IJHB 3ILQD 3E8UH 4D9LL 5CKGA 5GRUH 2EC8A 4P46B 5GRJL 4XVJH 1H5BC 3MV8B 1I1CA 4JO3H 3VMPA 1F3RB 3LD8B 4ZFGH 1WSST 4GRWB 5D72H 4PLKC 1IQDB 3TN0A 1LE9A 1XCTA 1T20A 1BQUA 3ROOB 4MLSA 4ZS7L 1CBVL 4XP1L 3H9SD 5FDWA 3O6FA 3ORJA 4MS8C 5J06A 5C6PB 2ZSVA 2CRMA 5I17A 3C8HA 4YXHL 3HG1A 4QGYA 5I6XC 4H0IA 4PJAE 1VEPA 4YDVA 3Q0HA 5F7LB 5L0QC 5ICXB 5E4IA 3MUJA 5FM4A 1IGTA 4BQ9A 3V79C 3CFEA 4JN2B 1KPVB 3MRJA 3BWUC 5FO9A 5HYSB 5DHYA 1Y6MR 4PGJA 1HDMB 1DQJB 3OKDB 1LO2L 2AVGA 1QLEH 3KJ4C 4JQVA 2C9AA 2VZ3A 4KDWA 4RA0C 1A7NL 1RU9H 3QT2A 1JPTH 1CD9B 2ATPA 5DD5L 4OCSL 5J89A 5FV1L 4F33B 3CZFB 4HWUA 5ADOH 1GHFH 1LK3H 1PVHA 5IBTL 1JV5A 4JPWL 4I0KA 4PJXB 4LSVH 2XA3A 4OZFB 4G7YH 3HS0B 1U8JB 4WUUB 4G42B 5AZEH 3UTTA 1IAKA 2AV7A 2I9LB 1UVQB 4N68A 4X9IA 1I7UA 3MGTB 3TP4A 1NBVH 2VXUL 4IM8A 2VKXA 3KXFB 4YDLC 2W60A 5T1LB 5CSZA 5KSAC 1QSFE 2C3XA 1ZGLP 4MQ7B 1LMKA 4U0QB 4MJ2A 1UM6H 4I0PA 3CXDL 4GS7B 1JF1B 4YWGL 5F9JB 3MLRL 5DA4A 4F58L 1B2WH 3ZYIA 1JGVL 4XP5H 1AP2A 3DGGA 1WV7T 3E6HB 4JFED 4ETYA 1P4IH 3SKMB 3UDWA 4F7MA 4LSQH 1KN2H 3CPLA 3PGDA 4G8GA 2DMCA 1NDMA 1W2KT 4Y5VB 4Z7WA 4ZNCD 5C3LD 2EH7L 1NC2B 3BKML 3UJIL 2YKLL 3I3EA 3MV11 1NLBH 5INDA 1FL5B 2XA8H 4FZEL 5BJTA 4OD2B 3PQYA 1A6UH 5E2VH 4PGBA 4OLVH 4MA3B 3GMRB 3NZHH 1YEJH 3BYTA 4LU5L 5IROA 5KSVB 1NBYA 1FG2B 1OGAA 1HEZB 3TT1L 4K71B 3ZKND 2Q8BH 1KIQA 4X4ZA 3TCLB 3ALWA 4NQTA 4X6FB 1DL7H 3GB7B 5FO7B 3UTSE 4MQXC 4OD3H 2XRAL 5KOMC 3UCRA 2IPUG 4N0UA 3QISA 1KGCE 3FB8A 3IDMB 4DJMA 1NFDE 2F54E 1L6XA 3NA9H 3LRSB 4FTVB 4JGJA 1NDGB 4Y4KD 4H26B 2Q7YB 1JMZA 4S1DD 3WDIA 3S7GA 5L2KB 4H8WC 5C6TH 5GGUA 1N3NA 1AR2A 4GAYB 5HHPA 1BD2A 5CJOL 2HTLC 5ALBL 4JY4B 3C2AL 1CXIA 1WCBB 2N4IA 1NAMA 4QRTA 3TJEL 5EO9A 5HHNB 5BVJA 2NXZD 5IMMB 5IB5A 3L5WA 2XN9D 1KCRL 2NY0D 3CSYB 4JO4L 1GGCH 4XI5C 2NZ9C 1BVLA 2QR0B 3MPCA 4NZUL 2BY0A 1UM4L 2W0KA 2I60L 1JN6B 4K07A 1RIVH 1LNUA 3QQ9D 4KPHH 1DJSA 3HZYB 1KG0A 4K23H 1VGKA 3HE7D 1E6OH 4L3AA 3LZFH 2GT9B 4YGAB 3T2NL 5KANI 1OPGL 1IGFH 3H9SA 2DDQH 2EDFA 3EYFA 3MLWL 2HFGH 3RWHB 3T3PF 3VGFA 4NC2B 4Q9RL 3T0EE 1TQBB 3S3PA 3SDXF 4ONFH 4YHYB 3QSKB 3UJJL 5HDBF 5IT2L 1P7QD 3U4EB 3PXHA 4POYA 3P11L 3T77A 2EIDA 4L29A 1ULVA 1U8LB 5ITFA 3WFHB 5LXGL 1T4KB 1OB1B 3H6JA 4J4PA 4ORGA 2GSIA 3DPBA 4CDGC 3CFJB 2E6JA 1IT9H 4HUWB 1JZ5A 5FYJD 4N90D 2GTZB 4X7TA 2QQNL 3QH3A 1HSAB 1QA9B 2J6EA 4HAFA 3QUZC 1U93A 3MRLB 5IWLC 5K9OB 4M48H 3AAZA 5CS7A 1DDHA 4H88H 3DSFL 1D6EB 2YRLA 4WI6A 1RFDL 3V0WL 5BV7C 4ODSL 5FF6B 4IIQA 5CEZL 3SKUD 4F7PB 4K94C 2OCFD 4EEEA 1KPRB 4LASH 2XV6B 1CDYA 1G9MC 5HI4D 3DVFA 3R06B 1HOCA 1S7QA 4G9DA 4NZRH 5T33L 3BIBX 4RQQA 1OF2A 4JFEA 5T1KD 2AEWA 4JFPB 4HJGA 1HH9A 3SE4A 3FQNA 5AG8A 1TZGH 3O6ML 4GW4A 3NTCH 5EC1B 2HG5A 3ELAT 4HGMA 3TBVB 4NDMB 2KZWA 2KQMA 1C5BL 1PJ9A 5ETUA 3CFDA 1C8PA 5KN5A 1ZTXH 4PJXF 5F9DC 1CICD 4NO0D 2AK1H 4XXDB 1ITBB 2X4SB 3C5ZD 4ODVH 3QDAA 3IDGB 4S0TD 3RX5A 1DN0A 3CH1B 2BRRH 4BZ1H 3RL1B 2NCMA 1K8IA 1EPFA 3I75A 3VW3H 5BXFB 2BNQE 1F2QA 1R3JA 4GG8B 4KQ4L 4LCIL 2D7MA 2HT2D 5BV7H 4J3TA 3WIFA 4V2BA 4HCRH 4PBXA 4Y4KA 1XGUA 5EIIA 1EHXA 2FGWL 4RISL 3WL9A 2XXMB 1KIRA 1DTUA 3VFNA 2FZ3B 5GRXG 1ZHBA 2B5IC 4UQ3B 3LEYL 3PWVB 3BN9D 4LRNL 4UINL 2VLKE 4OGYL 3VD4A 4CKVX 4ZD3H 4D0BA 1II4E 3IFPB 4QGTA 5C3TA 1YPZA 3WJLC 2VSDA 1M6OA 2GKIA 2YPLE 3BOVA 4I48A 1X5LA 1HHGB 1SJHA 4JM2B 5ID0B 1WVZA 3OAYH 2HMIC 2R0KH 4GXVH 2J3SA 1X44A 3JV5A 2XN9A 3L1OL 1CI5A 3DLQR 4RFEB 4DUXA 1FO0H 3KPSE 4LVHC 1WIOA 1VSCA 4OUOA 2D0GA 4NQVB 1PW3A 5IHZB 5D6CB 4V1DB 1S9WA 1NBQA 2MQ0A 2UUDH 1FDLL 3EFDH 4XCFH 3BZEB 3REWB 2W07A 3HE7A 3IJSA 2XWTB 4WDIB 4NQSA 1G7JA 1I1FB 1BZQK 4M7KL 3ILPB 4NFDA 1TVBB 1S78C 5C07B 2R9HD 5C7XH 4LEXH 3GMOB 1D5BB 1ZT4B 3KPTA 4DTGH 4JREB 3DI3B 4LSUH 4C56B 4OD1L 4ZTOL 2ZZUT 4HFUL 1JYVA 3HNVL 5E99H 1OTTC 1U8MA 2AJSH 1MF2H 5D2NC 4PJDB 3GHBL 1P7QA 3QDJD 1BF2A 2X4PB 4MNGA 2DYPB 5BCAA 1LDPL 1FFPA 1FORH 4LDEB 4OZIA 1AC6A 5HJ3A 1OCWH 4LSRL 1P6AB 5EU6E 3G6JA 4ZMAT 5ICYA 4TOYH 1DLHA 2UV3A 1INDL 2Z91B 4R96A 5C9JA 1INEL 4Y19E 1PG7W 5CILL 1TDQA 5DRZA 3FFCB 4JKLA 4K3HA 1QFWH 4LMQE 5D1XC 5CEYB 3QPXL 1CN4A 5E24E 4S1SL 3T08A 5I66A 1DQMH 2Y9RT 4Z0BH 3D87B 5DUML 3NN8A 3DMMD 3H3KA 4LIQL 5I30H 3GIZL 1U36A 3ULUC 4X5WA 2W0FA 2PNDA 5CEXA 4P2RE 4PLOB 3HMXL 3MC0A 2GITB 1NUGA 1U8NA 3IB4A 3X11A 1ZT7A 1D5IH 2IC2A 1MVUA 9CGTA 5IHUL 1S3KH 4NWUL 4M9PA 2ZJSH 1LE5A 4K7PH 25C8L 1TCRB 2WBJB 2X4NB 3SKJH 5T1KA 2X4OB 3QUMB 4N0UE 5ICZA 1GIGH 2CGRH 3BUYB 3QA3A 2R1WA 1C12B 1UM5H 4HIJA 1OTUD 1YNTB 3WJJC 3QG6A 3N50A 5FOJA 1N6VA 4ETQA 3HZVA 3UYOD 2A77H 4NYLB 1G7MB 1JUFA 1K6QH 3W81A 4JPVH 4NBYB 1QSED 2JE8A 4X7DC 4X0KA 3DIFA 2E7LA 3QEGL 3CAFA 2LVEA 1QFWM 2AKRB 1IAOB 1DFBH 5C0BA 3DV4A 4YH6A 4ISVA 1EAPB 3ARDC 4F9PA 4L8CA 4KQ3H 1S9VA 3FO9B 2NX5D 3HC0B 1X7QB 5GRYA 3KYOB 5CD5D 4QWWD 3C5ZA 2DLHA 5DD6B 1KIPA 3U9PH 4HS3B 4U7MA 35C8L 3I2CH 1LWRA 1QR1A 1DEDA 4F7CA 2M1KA 2DN7A 5D1QD 2EDYA 5EA0L 5HVWA 2Y23A 1N5AB 4X80H 2XICA 4L8DB 1G84A 3F7VB 2W9DH 1C1EH 1TZIA 1AH1A 3GSNH 1QBLH 3U0PA 5ACZB 1MWAH 2ZUSA 4HH8A 3OKEA 3HA0A 2YMXL 3CU7A 3IKCB 2V2WA 2P45B 4P48A 2X09A 4HKXA 5BQ7A 2PTVA 2Q1EA 3KR3H 4LPXA 1UA6L 1KJ2B 4OZGB 4NNYB 3V5HB 3NCJL 4GG6B 5I1IL 4LLYB 2UWEA 1Z5LB 1NGZB 4C54A 1N2RA 3QPQC 4YBQC 1XR9B 1AQDB 3MOAL 3LQZA 2FEDD 1CK0H 3EDFA 4OFKA 1T21B 3LQAH 4PGZA 3VI4F 1PYWB 4XPBH 4TSCH 4KJYB 5JA8B 2Q86A 4HIEA 4OUUA 2A2QT 2WUCL 2JK5B 1U8PB 3O2VL 1DUZB 2IH3A 4OLWH 1EVUA 1S5HB 1NSNH 1MRCH 2M8XA 3BXNA 4OLYL 1O0VA 4E41D 3BP6A 3HNSL 3L3KA 3QDJA 3H0TB 2VB5A 3D69A 4JHBA 3L95B 3TCXA 3ESVF 4ONHB 4X6DB 3RZCB 1MVFA 4QHMA 3TVMB 2CDGA 3VWKB 1ACYH 3INUH 3RL2A 3SE9H 3UO1L 4P5MA 3MBEC 5SWZE 3EO0B 4HHAB 1DQDH 4JM2F 2WLZA 2AGJH 2DD8H 1A6ZB 3L7EA 2H2SD 2X4RA 3KPPA 5KTEL 1U3HD 2AEQL 2NW2B 1F97A 1NCAL 4QF1A 1MUJB 4Y1AA 2Y06L 3FCTA 2NY3C 4YJZL 4DGIL 3MUGA 3D6GA 2AK4D 3V8CA 3UPRA 2XNAB 2VR5A 4NJAH 1OAZL 4ERSH 1LO3H 2VDLL 2IQAA 1T89C 5HBBA 2GAZA 1C5CH 1JGEA 4HBQA 4HLZH 1ACZA 4LLDA 4FQ2L 1BM3H 1QFUL 2DKUA 2Y6SC 3LN5B 2I07A 3AU1A 3OHXA 4LSTL 2CLVA 3BGAA 4X6EB 4DZBA 1IGML 2FDBP 3QUML 4HFWB 1GAFL 4Y2DD 3FMGH 2ED9A 1IKFL 4P2QD 3NAAL 2XZQL 5LGJB 1ZT1A 4QRUB 4KMQA 1QEWA 1BJMA 4PJCA 2DTSA 1WITA 3QEQE 4KI5E 3I6GA 1YA5A 5FA3A 3CDFA 3S34L 4XTRD 3IKKA 3P9MB 1ZWIB 3N1GC 1R3IH 1CFTB 1KB5A 3K1KC 3WE6B 1M05B 4XVTL 1FLTX 3KPNA 3AFLA 3LKNB 1SEQL 1AIFA 5TFSH 1MFAL 5JHLL 3D85D 4IOIA 2AJVL 1QFPA 4JHAH 1F5WA 4G9FA 4ZOEA 3STLA 2ORBH 3MYZA 1OLLA 4LLAA 2C4FU 4OI8A 1KELH 1QSEA 5ESVB 4K2UL 5F70A 1BHGA 1E4XI 3MV9D 3OKLA 1QNZH 3T4AB 3ZDYF 5MERA 3H7BA 4PJHB 1NCDH 2COQA 2NX5A 1G7LA 4HDIA 1Q72H 3O9WC 3ZDXF 2FECI 3SDCB 2HLFC 1RHFA 1W0VB 1CL7I 4DZ8A 2NY5C 4F8QA 1DVFC 4BH8B 2VIRB 5D1QA 3N1FC 5E6ID 3BE1L 5HGAB 1MELA 4NGHH 5BS0D 2CKBL 3VD7A 4AQ1B 3RPIA 3SJVB 4U0RC 3W5NA 4PB0H 1E27B 1F11A 4JCLA 3FQTB 1BREA 5DVLA 3ZE2E 1FLRL 5CKAA 5MEPA 4M02A 4CADA 1KJ2L 4EIGB 3GSVA 1JPSH 4F37K 1XR8A 4KKLC 4FQQB 3ZL4L 3X14A 4HUVA 3KNBB 1U6AH 3OXSA 1LDSA 2IALA 5I1LA 1S7WB 4I9WD 3EW3B 5C0IB 3U83A 2P7TA 4R7NA 2Z8RA 3MQIA 5EU7C 3WHE1 1DUYA 4LCWB 4LHJB 4U6XA 1T7YA 2VDOH 2Z0BA 2A9MH 3D3VD 4AT6A 1MHEB 2MKLC 1TQCB 4AMKH 4M1DL 1SM3H 4OZIE 4WEMB 1BIHA 4WW2F 5B21A 1DR9A 4JN1L 1GC1L 1QACA 5J4MA 3G6JE 4NRYB 2ATKA 4ZODA 1YEHH 5FYKH 2FIKB 4J2XA 4LGRB 5E1AB 5D4QA 3BP7B 4KHXH