3T0EB

Crystal structure of a complete ternary complex of t cell receptor, peptide-mhc and cd4
Total Genus 39
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
39
sequence length
218
structure length
195
Chain Sequence
FSWGAEGQRPGFGSGGDTRPRFLEQVKHECHFFNGTERVRFLDRYFYHQEEYVRFDSDVGEYRAVTELGRPDAEYWNSQKDLLEQKRAAVDTYCRHNYGVGESFTVQRRVYPEVTVYPALLVCSVNGFYPGSIEVRWFRNGQEEKTGVVSTGLIQNGDWTFQTLVMLETVPRSGEVYTCQVEHPSLTSPLTVEWR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Immune system
molecule keywords HLA class II histocompatibility antigen, DR alpha chain
publication title Crystal structure of a complete ternary complex of T-cell receptor, peptide-MHC, and CD4.
pubmed doi rcsb
source organism Homo sapiens
total genus 39
structure length 195
sequence length 218
ec nomenclature
pdb deposition date 2011-07-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00969 MHC_II_beta Class II histocompatibility antigen, beta domain
B PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3t0eB02
3.10.320.10 Alpha Beta Roll Class II Histocompatibility Antigen, M Beta Chain; Chain B, domain 1 Class II Histocompatibility Antigen, M Beta Chain; Chain B, domain 1 3t0eB01
3HR6A 1ZGLP 5DVMA 4OAWB 1MCPL 4N90E 1QLFB 2N4IA 3UZEA 4Y16D 1I7UB 1WAAF 1I4FB 2IC2A 5GZOD 2ERJC 1ND0A 4NC2B 3HE6C 5EPMA 4YDKL 3CIQA 2AQ3A 4NQVB 2G9HB 4ZNCD 3BPNB 2H26B 1AKJA 1IZJA 3BP6B 4PJEF 2OMNA 4B7IA 1R3HA 1YUHA 4RFOH 5C0BB 3H3BC 4PB9L 1EA9C 2B39A 4AL8H 3GJFK 1MCSA 1EAPB 3IU4H 1WK0A 1NBVL 4UB0L 4PJCA 1MHHB 1U8KA 3OXRB 5DJYB 5JXAL 4ORGB 3ARTA 3QULA 3I50L 2CXGA 1TJHH 1PFCA 4PV9B 3FQXB 5EZIH 1KCRL 4UTBL 1NJ9B 4X6CA 2ILLA 5CKGA 4RBPK 4IBLT 2IALB 4ZAKD 5TDPA 3ES6A 1I8MB 1FNSL 1KJ2B 4PGCA 5FK9A 4O4YL 1PKQA 2IQAA 3PL6D 4XVUD 2XZCL 1O7VA 4GMTH 3VMNA 2W9EL 1KCSL 3BE1L 4LPWA 2D7NA 4OCWH 1CXIA 1NPUA 5DURD 4RA3A 1NGQH 1NGWB 2HFFA 3FO2B 4W4OC 3TO4B 2YD4A 5FUCC 1RZFH 3KPRA 3H42L 3N50A 1MJ7L 2NNAA 2OP4L 1JGVH 4Y2DD 1E4XH 3EYQD 1P7KB 2QHLA 3G6AB 4M61B 4OLEA 1OF2A 3SDCD 3V0WH 3O8XD 1KN4L 1GGTA 4XAKE 4E5XB 5GIRB 1QQDB 3GBMH 2R0WH 5I1HH 3GZKA 3LVEA 4JFYA 2F5BL 3MRFA 5CHNB 3QEUB 4L8DB 5I0ZA 1BD2B 2EDWA 2XI9A 4LGPB 2VIRA 3LKQA 5JUEH 1SVZA 1E4WH 5C0GA 4JO1H 2YUZA 3QWOB 5LKNA 1H3UA 4WFGD 2D7PA 3NCYS 3E8UH 1QSFB 1C5BH 4XMPL 2OR9H 2YSSA 5F8RC 2UWEA 2VXUH 1TCMA 4TVPE 3VWJC 3NACH 1YN7B 5D5ME 5J0BA 1G9NH 5CEYA 4C4KT 1HNGA 4NZTL 4K3HA 2VLME 1NMCC 4F58H 2CKBH 4K8RC 5BW7A 1N6QL 4MNQA 2H1PH 3QIBB 4P49A 4YK4C 1JGLL 5IGXL 4LFHD 3GBNH 3CLEL 1WUNT 4P46C 3KJ4C 5T33L 2P42B 3QCUL 1EO8H 3IDYB 1SY6L 4QHKI 3M17B 4OZ4B 3QRFM 3JUZA 3PWJB 5C08B 3RA7L 4KZEH 1KIPA 4Z95L 4HF5L 1GAFH 4I0PD 1KCUL 3RWFB 3EOBB 1PYWB 4KJQD 2X9YA 1HHJB 1P84J 4GG8B 3MZGB 4TOYH 2AEIT 4LAJH 1KLGB 5CGTA 1AO7A 2PYEA 1UB5B 4HS6A 3L7FB 3LEXA 3CK0H 2XQYG 3MGOB 4PJ7F 4M7KH 4YXLH 1NAMB 2R2EB 5JO5A 4DN4H 1RU9L 4DUWA 4Y4HD 5JMRA 2R1WB 3JSSA 1E28A 4NRYA 5LCVL 1AP2A 3RP1A 3VXTB 4X7TA 4RIRB 3SHSA 2B0SH 1QR1A 5GS0L 2RJMA 1MH5A 1F3JA 5JW4N 5GGRY 1OB1B 3GMOA 4JDZA 4WW1A 5GISL 3ZKSD 1B2WL 3WFCH 4XPHL 3REWA 5ACZB 3EOTH 3EZ8A 3BP7B 3P2TA 2R0LL 1GPOH 5ERWB 1JFQL 3HA0A 3VRIA 1CFTB 1X9QA 5DEFA 3CDCA 2PO6C 3NOIA 3TVMB 4OGYL 1R5WA 4LQFH 2VDNH 1OLZA 4P4KB 4OI7A 1Q9KB 1HIML 3ULVF 4LOUD 3FO0H 1MJ8H 2J1KA 5CIPH 5AWNH 4XNZC 2FHFA 1T1WA 5L9DL 3BT2H 2GYSA 1MPAL 2JJSA 4G43A 1IGFH 4TRPL 3FOMB 5A3IC 1FV1A 2P7TA 2CD0A 3VXNA 1CE1L 4LCWE 5FOBA 5FKPB 1CG9A 4Y16C 2ZNXA 5HHMD 4BSJA 5GZOC 4TTDC 1L6XA 1G7IB 5DGRA 5EU6D 3WS3A 4JN1H 5IJKC 3SDDD 1A6TA 1XF5A 1LNUA 1WLHA 3MO1B 3UPRA 1TQBB 5I8KH 1NUGA 3F5WB 3HAEA 4L29A 2GHWB 1HINL 4XNQA 4EQ3A 4NKDA 2Z92A 3NA4A 2VDOL 1HI6B 4NN7C 3QIWB 3OJDB 3P4MA 3CVHH 4JZJA 3V4UL 1JHTA 5J89A 2DYPD 3QJHA 1Q9LA 3NFPB 4MB4A 2NXYB 4FQHA 4YHOH 1WWCA 1U2CA 4TPRH 4NJAL 1AR1D 3H2WA 4JM2D 4LEOA 4ZSOA 3BJ91 4PGEA 1CLYL 3Q5TA 2WP3O 1BGXL 3CCHA 3NZHL 3NFSL 5D1QB 1N3NB 4ZAKC 4DVRL 4KXZI 1L4IA 2GY7B 3WUZA 3CH1B 4POZD 4FS0A 4OQTH 1XF2A 1MHCA 3PL6C 4XVUC 4OZFG 5ALCL 2IH1A 5CJXA 2CLVA 4LLWA 4IMLA 2AQ2A 2VQUA 2ZUTA 3AUVA 3DI3B 5F96L 4LVHC 5B8CC 5HD8D 5IV2B 4PTUA 1ZA3B 4RMSA 1NAKL 4R7DA 3MCLL 3MJ7A 2P44B 4HUVA 4JFDB 25C8H 2DIAA 4JFQA 3FFDB 4LLUA 4Y2DC 3VFUB 1C12B 2HWZH 2YD7A 3EYQC 4KQ4H 1MAKA 5KSBB 2DQGH 1G7PB 3BZ4B 3VGDA 3O8XC 4HC1L 1X5LA 1S5IH 4A6YB 5F44A 1RUAL 1EERB 3V0WL 4AG4L 4APQA 4XGZB 5DZNA 5IFHL 1OP5K 4RX4A 2AEQH 4ZFZB 3RWCA 4F57H 4MXVE 4XWOD 5DD3L 1G6RB 5B38G 2VKXA 5ESAA 5EU7C 3X12A 5FYKL 1BPVA 5D7JB 1IM9A 3KPRD 3NH7L 4JO4H 1JGDA 1I3GH 2ZUVA 3QDGA 1JTOA 2VXSL 4WEUD 1CYGA 1L7TL 4ODTL 3GEWB 4S1SH 3DLQR 5FF6B 3MV7E 1LE5A 3VDBA 2OZ4H 2VN7A 3BKMH 1MI5D 3HG1A 1MEXL 2AJYH 5FFLA 2YBRB 3C09B 4ONGL 1I85A 1RPQA 2VLJB 3FT2B 1G7LB 4XP4H 4D8PA 4E0RB 1GC1H 1AY1H 3B2UD 3QCVH 4BK4A 3THMH 3UEZA 5HGHA 2NXZD 5E8EA 5MEOA 3D2UB 5F3HB 3L3KA 4PJIF 1AGDB 4F9PC 1U3ZA 5CSBA 3UTZA 3FCTA 3O6FB 4OCRH 1YEKL 4N0RA 3TNMB 2AABL 2ARJQ 1EHAA 4I0PC 2UY7A 3MLXL 4JHAH 4G6FD 4JY5H 4GKSA 5EB9A 4K9EL 1NUDA 4DOHE 3O2DA 1CLZH 1FZMA 1OARH 4MQ7B 5D8JL 1ADQH 4YIQA 4LKCA 4PJ5D 5E0QA 1A9BB 1RHHA 1EFQA 4CMMB 1QFOA 4HFWB 4M6NH 2O5XL 1QHPA 4FXKB 2O93L 1JIBA 1HQRA 1R3IH 3HZKB 3C5ZD 1TPXB 1V05A 4C57C 2FB4L 1BX2B 1OAYL 2V2WB 3OXSA 4OZFB 1JGEA 5C0AE 1PSKH 4LHUG 4LP5A 4Y4HC 3NN8B 4DEPC 5CINL 2JJTC 2C1OA 5FCUH 2JCCA 2V5SA 2XTJE 3DXAE 1S7UA 3DRQA 5HYIA 4U7KA 4JAMA 3D85A 2FEEI 4HUWA 1PDKA 5JW4R 4XP9L 1RFDH 3OPZL 4H8WH 4Y4FB 5JOFA 1U9KA 3MROB 1ITCA 3SKOB 1BJ1H 4HUXA 5KVGL 1X3DA 1NCWH 1AXIB 2JIXD 1DQDL 3SKMB 3Q6FA 5I1JL 3VFWA 3QUZB 4GG6B 3TP4A 3A6BL 1J10A 2A38A 1CFBA 5EU3A 3H8NA 5HYEA 2VDLH 4P59L 1BOYA 1FGVL 3KPMB 2KQNA 4HULB 5BS0A 3ULUL 4YLQT 4QGTA 3L1OH 4DN3L 4I1NB 2VAAA 1UM6L 4LSVH 3BIBX 5B38B 3O9WB 1UEYA 2IAND 1KJ3H 4P5TD 5ID0A 3O6ML 3T65B 5CZVH 4LLMA 2CDGA 3DJ9A 2UUDK 5T1DL 1HHIB 1Z9LA 2GI7A 4Y19E 3WNPA 2H41A 3MXVL 5F7DA 1N8ZB 4NFCA 1U6AH 4WU5B 2QQLL 5EZJB 4PJ9B 2NY0B 4KK8D 1JZ2A 5T1KD 4EVNA 5T5NF 3IFOA 1NFDA 2CDFB 1KB5L 3SDDC 1BZ7A 2EECA 4BSVA 1JYVA 5J57B 2BCKB 3SJVA 4NC1C 1PZUB 5I6XB 4JPVH 3WIFA 5D1XB 2BY1A 3PWPE 5EG6C 5DRNA 3BDYL 4R7NB 5KN5A 1LO0H 1T0MA 4HWBH 3IXTA 4ORZC 5JPMB 1KC5L 4HKBA 5DHYB 1ZANL 3RVUD 2FX9H 3BWAA 4Y5XB 4YQXH 5E2WL 3VG9C 4MD4A 5E9DE 3UTTA 1GCFA 3CLFH 4U3HA 2DL9A 5SV4A 4IHOB 3TO2B 1I8LA 1J1PL 4LSPL 3VFRA 3VCLB 1AR1C 4JM2C 3BPCB 4UDUA 4TPRL 4FP8L 2G60H 5IEKB 2ZUYA 1VFOA 5IVNA 3HC0B 4J3WA 2BRQA 4MDIB 3V2AR 2EDEA 4POZC 3U2SB 2O5ZL 2APXA 2OJZL 1G7HB 5FYLE 2DLIA 2YXMA 3TGXA 1RJYB 2EYTA 2J4WL 2ARJA 4GMSL 4WNQA 1JWUA 1EVUA 5GGTA 1ZVYA 2B1HH 3S96B 4KGJA 3DX6A 3IB4A 2BZDA 5HD8C 1FLRL 4XCFL 2R23A 4PLJD 4AEIL 4L9LA 1WTGT 4TSAH 2IBZY 4PJEA 5CBAB 3WS6C 5D6DC 1TVHA 4YHNB 1MIMH 1Q9WA 4Y7MA 5F7UA 5GRUH 3O6LL 4M00A 3NZ8A 5J1AB 3D0VA 4NPYB 1NMAL 3MBXL 3VI3F 5MI0C 4RGMB 2XOTA 4LCUA 3PIQA 2EYSB 4GJTB 3OR6A 1S5IL 4QRPB 4YBQD 3LQMA 5DD6B 3L7EA 5ELIA 3ROLA 1UWEH 3GSNL 3FRUB 5D1ZA 2CO7B 3AFLA 2Q6WA 3TCLB 1I7ZA 5IROA 4YFDB 4BQ9A 4I2XB 1DQQA 4KRLB 1MWAA 3DRTA 4KKLC 1URLA 1M71A 2PNDA 2BHUA 4RBPH 4FG6C 4JPWH 3MREA 4Y0GA 1GOHA 5LQBL 4LCWB 1T5XA 4NKMA 2VXTL 3FB7B 1VENA 4HJ0D 2OZ4L 2L7UA 3SDAC 3BKML 4MAYC 4UT9L 4F7MA 1A6AA 1D6EB 3MRRA 3TJEH 4W6YB 1EK3A 3B2UC 4B7LA 3TT1L 4WW2C 1T80A 2E7LA 3MV11 4P2RB 1Y0LB 4PJBB 5EU4A 3VGAC 2CDEA 3MRHA 4QHLA 4BUGA 3TBYB 2XZZA 1EUUA 4N5ED 3C60D 2QL1A 2E7HA 1ODAA 4Q0XL 1QRKA 3AS0A 1YY8B 5IVXB 1MRDH 1I9IH 2F74A 4MHHG 5GQBA 3DMMC 1V7MH 2XNAA 2FHBA 2VITA 1DBAH 1I9JL 4U6VH 3CPLA 2XA3A 5D71L 5EZOL 1A3RL 4G5ZH 4JHAL 4GFTB 5IW6B 3ISWA 2IGFH 5LWYL 2ZNWA 4S1RH 5BJTA 4P2QB 2ZOLB 2IH3B 2VZ1A 1I1AA 4MQXD 3C5ZC 2F54B 5AAMA 2H6PB 1D9KB 2GTWB 3OAUL 3AVEA 4MQTB 3GRWA 4HUUB 3GMQB 1PSKL 3B9KA 5F7EL 1MAML 1KTKE 3GSUB 3LN4A 2AK4D 4LPYA 4H8WL 4D9QE 3BQUB 4U7MA 3VFTA 5IMMB 3TIDA 5DTFA 2O26U 4P9MH 4UDTA 3TN0D 4XMKH 2QSVA 1FFOB 1A6VL 1PY4A 3LPGA 3L5WB 4Y5YC 2J6EA 3V6OE 4QHKJ 5GGSA 1YEJL 2NZ9D 4HDIB 3NA9L 3LH2L 2A9ML 3D85D 4WFED 1F42A 2QSTA 2BOCA 4FNLH 4BH7A 3LQAH 1QTYT 4PJ7A 4NQCB 5JNYA 4P5TC 4GKZB 3O3BB 4I0KA 1QRNE 4JN2A 4WI3A 1G9NC 3IRZA 5D72H 3MV7B 3OB0K 3ZL4H 1QSED 4NWUL 1DDHB 1OL0A 5KVFH 3MFGB 4L8SB 4QY8B 2BDNH 2XZQL 1ZS8A 5BS0D 2W0KA 1DN0B 5C3TA 3HNVL 5C70A 2LVCA 1RZ8A 2P5WE 3E6HB 5ICZA 5CJ8A 4L8BA 5JLZA 5J56B 3RKPA 1A6WH 4OFIA 3FN0H 4LSTH 4P5KB 3W11D 5IQ9A 2IFGA 1LO0L 3DVGB 2A73B 1HH9B 3RGHA 3PGFL 1MCNA 3BW9B 2F53B 4M7ZC 1MELA 2XQYK 5IF0B 4ZNEA 4ZXBA 1E6JL 1EAJA 4DOHB 1HHGA 2BOBB 3VRLF 1YY9D 4POYA 1U8IB 1C7TA 4U2ZA 1BEYH 4UZGA 4X4YA 2DQEL 3ARDC 4ZPVA 1LEIA 1F4WH 1IL1B 3M45A 4XPGL 2VDQL 4FZ8H 1P2CA 3VFSB 3AXLB 4JG1H 4KAQL 5BRZA 3WN5A 1XGRB 2AJZB 1C16B 3E2HB 3KLAA 2Y36L 4E41D 4LASH 4LCYA 4L4TA 4LSRL 4MVBD 2XTJB 3DXAB 4G8GA 3OKDB 5D7KE 3RDTA 1UYWL 4HKZB 1BVKB 3WNOA 3KLDA 4P57B 3IFNH 1U3JA 2VSCA 1JHLH 4GXUN 4CVUA 4GQPH 1ZVHA 1JPFB 1ZLSH 1AGFB 4M43L 3HE7B 5EULV 3DVIA 5IMOA 4EOWL 1EZVY 3MSPA 2EH8L 3KWWB 3TZVA 4M9OA 4YBQC 2AKRA 2P48B 5C6TL 1YYML 5DK3A 3FB8B 3D9AH 1CU4H 3BPLB 1IGTB 4JQVA 2W60B 1UZ6F 3QI9A 2BNUA 2AXFB 5EO1A 1XF3B 1KTRL 4Z7NE 1S7SA 4HUMB 1DEDA 4JB9L 3ULUF 3MV9B 2YA2A 3SKNB 1CF8H 1X5IA 3IAQA 2UZYB 2ATKB 5GRJH 1K3ZA 4HJ0C 3V6ZA 1BVLB 4LCIH 5AUMB 3ROOA 5E4EC 4ZUUA 5F9OL 4X7DC 3HMWL 4WHTA 3CFCL 1QACA 3GNML 2VN4A 4NQSA 5FUCE 5ETUB 1H9VA 4LNRB 3PWPB 3QFJA 4WJ5B 1K2DB 1WIOA 2G5RA 4HKXA 5BCAA 5FHBL 2WUBL 2KDGA 4N5EC 3C60C 3EYSH 3T0VA 3K8LA 4WO4D 1JHKH 4DZ8B 2AERT 5E9DB 1JZ5A 1FDLL 1AHWA 1QO3B 4U1NA 4Z7WA 4Y5VB 4OI8A 1N64L 1P1ZB 4G6AD 4TQEH 3O45A 4HS3A 5DHVA 1OP5H 1EEZA 4YR6A 4JY6B 1F4YL 2J3SA 5HVFB 4QF1B 3C9NA 3KYMA 3GMRA 3SBWC 4AJ0A 2YZ1A 3MV8B 3STZA 1FYTD 1ORQB 4MQXC 3LD8B 5IWLA 1RK0A 2DQDL 3EIFA 2EE3A 1NCBH 4GAGL 5DJAA 4HXAL 4RFNB 2VLKA 3WEXB 1HSAA 4UI2A 4Y4KA 1IC1A 4WDIA 5IK3A 2A6IB 3KPSB 2B5IC 1QFWH 5DZLA 3LSOB 4PJIA 3GUTA 3IJSB 1CGSH 5GS1B 1E27A 3MBEB 2A83B 2WW8A 4MS8D 3BPOB 2V7HB 5K9KB 4R3SB 3TN0C 1FFRA 3DUUB 3GIZH 3U48A 3HN3A 1MNUL 5BXFB 3ZLQC 1K4CA 1CFNB 3HC3H 4CVXB 4XNYL 3BEWB 1IKNC 3AREA 1FN4B 2NZ9C 4OCXL 1H3XA 3DX9A 4PP2A 4NYLB 2DJUA 4JY4A 2IEPA 1T21A 1LE9B 5ESVA 2JF1A 3ZSSA 3CSBA 2FIKA 1KIUA 1U8OB 1MREH 3RPKA 2BNRE 3MNZA 5DRZA 1VHPA 3S35H 1T5WA 3U30C 2X4OA 4S0SD 4L4VD 1M6OB 4ZD3H 1K4DB 3WNKA 5KVFL 2C5DC 1T3FB 4F8TA 4KKBD 4C4KO 5D93C 3PQYA 2NMSA 2W0FB 4RWYH 1BIIA 2ZUQB 3ARGA 3V8CA 1ZT7A 4LQ1A 3W11C 1JUFB 2HG5A 4KK9D 1FZKA 4QT5B 4JFPA 4OBSA 5DK0B 3D69B 5I73C 4WFHD 3QUXB 1KACB 1YY9C 2EKJA 5IFJB 4QRRD 2B7DT 3QG7L 5FO9B 4NKQB 1AC0A 2RFXA 3PXHA 3RZCD 4WV1A 3OB8A 3VXMD 5E24E 4LSQL 4HV8A 3ILQC 3EGSA 1OAXL 2IFFH 3BIKB 4JO2H 3LV3A 2JK5A 3H7BB 4L3ED 1HDMA 3BWUC 5CCKL 3NABH 2EE9A 4CMHB 1HYSC 1YEDA 2GUOA 5AG9A 1L0XA 4M6MH 3BISA 4MVBC 5CP7A 1RZKL 3CDYA 4XP6L 2WV3A 4A2LA 1NCDL 1PG7L 3QO1B 4JFXA 5IBLD 2HVKA 3WUWA 5HGDB 4XC3H 3U4EB 1UM4L 4CDGC 1IQDB 4K2UH 4WTXA 5DWUL 3FB5B 3F7RA 1J18A 2VYRE 3EW3B 4XVTH 1P4IH 2RCSL 3WFEL 4JLRA 3VFPB 5BRZD 3TYFB 3LRSA 3VXSA 5GRXG 3QDJB 4L4TD 4QHMB 1K9TA 4IRSB 4M6OL 3SCMB 3BGFB 1W72L 4K3JL 3NAAH 3T0ED 5BVJB 3PHOA 2VJXA 3KYOA 4PTTA 1BREA 1Y6NR 1JF6A 4HJGB 1DQMH 4LRNH 3ZKMD 1IT9L 4BQ8A 3DBXB 1YEEL 4RRPG 5IEHA 4CADA 3SE4C 3OHXB 2YPKB 2XV6B 4AQ1B 2BVPB 5INCB 1AGEB 2E3VA 2G5BA 3H9YA 4YUEL 1EFXD 2CRYA 3VDAA 1UQSB 2VAJA 5DRXB 4UV7L 4L3CA 4I3RL 2WANA 1N6VA 1S78D 3HNTL 4DKEL 4IDJL 1KGCD 1J05A 5IROC 3BEVB 3QI9D 3FHQA 4O51A 4MJIE 2GSGB 3VFVB 1MLCA 4UNTA 1ZLUH 5GS2H 5KJRH 1I7RB 1A02N 4ZQKB 3CUPB 3BJLA 4WU7A 1R24B 4WO4C 1FL6A 1OCWH 1QKZH 4P3DB 1JHKL 4KK5D 4DGVL 1TJIH 4I5BB 3UJTH 4WI2A 3P0GB 4TNVK 1RSFA 1IC4H 2OTUB 1Q94A 1V8HA 4G6AC 5IESH 5F7HA 4KROD 4HQQH 2QR0A 2Y7QB 4NBXB 5EU7E 3SY0B 2CRZA 5F7NC 1OGAD 1XFPA 4PJDE 3IETA 3OSKA 4F7TB 3QFJD 2DMBA 4MDJA 4R26H 3VFMA 3C6LC 1A7OL 1U3HB 3UTSB 3LAFA 4N8CL 4LLQB 1JZ7A 4WFGE 3IVKA 2VWEE 1FBIH 1RUPH 4RGND 4HBCL 3KS0J 3KJ6L 3JWDL 1YECH 2ZCHH 3B43A 4LKXB 2ERJB 4R2GD 2K7QA 4MZ2A 1IBGL 5LGJA 3UYRH 4P2YA 2XWTA 3HE6B 4GRLA 4JR9H 4EUPG 4PRPD 1KEGH 1XR8A 4MS8C 2DAVA 4PJFE 1U92B 4GW4A 1BF2A 5D2LB 2X4RB 3VXUD 1AQKH 4KHXL 4Y4KD 1NFIA 1FVCA 1NAMH 3LCYA 3VI4E 1U8JA 3HC3L 4FN0A 4JDTL 3RX8A 3FO1A 4JRYB 4J4PA 4XBEH 5EN2B 1JWMA 3FRPA 4ETQA 1H3PL 2ATPB 3QRGH 4KFZC 1A6ZA 4X6DE 5GSRB 1K8DA 4QLRA 2BNQD 4PRDB 2FL5B 5DJ0A 1MREL 4U7SA 3O3DA 4BZ2L 1FH5L 3FO9B 4OLWL 3BOVA 3QDHA 3FHAA 2O5YL 5EWIH 3C08L 3ARED 4KKBC 1YMMA 2KUTA 4ZD3L 5D2NA 5TE7L 2BC4A 4NZJA 1LD9A 3L3IB 4H26B 5SWSD 4POUB 3O3EA 1JWSB 2AJ3B 3QJFB 5LAXB 4J2XA 1VFBB 1S9VB 4ELME 1UVQB 4BFBD 4ZFFB 3KYAA 3MCKB 4J7RA 5F7FA 1GSMA 4HC1A 1T89C 5D7SH 2F58H 5DFWH 4P2CG 5J9PB 4HJJL 3ETBF 4PUBH 1XZ0A 2ZCLH 3PABB 5FO7A 2BMKB 1YPZF 1MY7A 3VJ6A 5JW3L 1QYGL 4PRIE 4GBXD 1VEOA 1AGCA 2BSRA 1I3VA 3OMZA 3INUH 3PQYD 4H5SA 4IMKC 3FQNA 3RZCC 2N1KA 4P2OD 4LRIC 1D5MB 4MA8L 2BVTA 3RY5A 4Q2ZB 2J8UB 5DI8A 3ARGD 4CU6A 4YEFA 3FONA 3KXFA 1RIUH 5L2KD 1MJJA 1IJ9A 4ZG1A 3IF1A 1QVOB 3ZE0F 1D3CA 4IIQC 2Q8AL 1HYRC 1YMHA 3OB0H 4ONOA 3O6KL 3TH2T 5DC9B 3E3QE 3MRGB 5HHME 3VWJB 5CD5C 4LARL 2APBA 3FQRB 3IDXH 3QR2A 1XF4B 4GRWE 5KS9E 3I75B 1NMCB 4OZGF 2RAMA 4X98B 4QOKD 4ZDHA 4YK4B 1MCJA 2GJ6A 4XC3L 5IHBA 2WSKA 4EUPB 3S37L 1OTTD 4P46B 3KJ4B 1JF1B 5F9DC 4D0BB 5IOPA 3GMMA 3T4YA 3I6KA 2BK8A 3LQAC 1KJ2L 1CR9H 3TBWB 3VW3H 3MRLB 3KDMB 4RISH 4KI5D 3G08B 4HIHA 1R3JB 1TZHB 5C0FA 4KZDL 1KXQE 4FQLL 3LS4L 1P53A 1OAKL 3T0EC 2Y07H 3EDDA 2FGWL 4M7JH 1FE8H 4YBLC 5EOQL 1OSZB 3UYOD 4EN3A 4L5FH 2FJFB 1AE6H 4R4BB 1ES0B 3ZKMC 3EYUL 1N0LA 2HTKD 1IM3B 3ARQA 1TETL 1NC4A 1FFNB 5KW9H 5DUMH 4G9FD 4OUUA 3G5ZB 5LGHL 1YNLH 2HFGL 2C3XA 1LO4H 5MENA 2FEDD 3LQZB 1LP9B 4ZPTB 3VXSD 4PRBB 2W9DH 3LKPA 5F9AC 5HHOA 1KN2L 1S78C 3MLPA 4G8FA 4V2BA 1SM3H 4X7SL 5HYJD 1PG7X 2X1PA 4I9WE 4WCYH 4X6CE 3QA3B 3U0PA 2EDKA 1VEPA 3GK8H 1LK3H 1KNOA 4Z7QE 2C3HA 3GMNA 1UT9A 1B4RA 1PKQE 5TFSH 1DE4A 1UXWB 2BSSA 4K7FB 3RIFK 5ITFB 3EUUA 4EIZC 3QQ3B 5FEBA 4JFEA 2PO6B 4XMLL 5ANMA 2XFXB 5F88A 1X5ZA 2MHAB 3HPLB 2JELL 3U7YL 1T83A 3KPRE 2BY2A 4K7PY 4XNZB 2EYRA 5GS0D 4NO2B 1I8IB 5I74C 2IBGA 4NZUL 4U1HB 3W5NA 1LEGA 4N0FB 2GT9B 1QBLH 4FQCH 4R26L 1TFHA 1MHEB 5JW4Q 2HT2C 1T0NB 1TTFA 4NSKA 5K9JH 2BRRH 3RPIA 4RGNC 1MI5E 4Y16B 5CWSB 2VLRA 3ECBB 4R2GC 1W8NA 1A7RH 5KANI 2BJML 4F37F 1KB5A 1U91B 4PREB 1QLRB 2ZJSH 43C9B 3B2VL 5E6ZA 1DLFL 1WIUA 4JJ5B 2NX5B 1BQHA 1GL4B 3WL9A 2Y6SD 4XCNA 3HI5L 1KV3A 1WCBA 4NN7B 4R0LB 1FNGA 1WGOA 5ILTH 2LQRA 1EO5A 1AQKL 2A74A 5SWZB 1R5VB 4M8VA 1XGYH 3RWEB 2D9QB 4P4RB 2W65B 3G5VA 4DW2H 4AEHH 1WITA 1FZOA 4IM8A 4RMRA 2ZKHH 2ITCB 2QQQA 4U0RC 3MLZL 2PYFB 3PP3K 3UJJL 4NKOA 5L2JB 4XBEL 2ZSVA 1NSNL 2PW1B 3QEQA 1S9WA 3TESA 1J86A 4FQXA 4PD4K 4Z0BL 4ZAKB 4MNQE 4GXVL 4PJ5E 1D5BB 1QUNA 3F58L 3TYGH 3PL6B 1IC7L 1Z9OA 3UC0H 1PZ5B 4OM1H 1JV5B 4QHNB 4KWUA 2I07A 4D0DA 3EYVA 1T03H 3MRNB 4JQXA 2K3TA 4HZLB 4IRJA 5DR5H 5EOCH 5B8CB 4YHKH 5DURB 4BQCA 1Q8MA 3D48R 2D9CA 3VWKA 2NY7L 3DV6A 1F2QA 2CLZA 2IPTH 5FO8A 4PJGF 5HY9A 3MRPB 5HJ3A 3Q5YA 2H32A 4Y2DB 4RZCA 5T1MB 4PJHE 1M7DB 4X0KB 2HRPH 1MRFL 2PYEE 4MA3A 3SKJH 4F7PB 3O8XB 5HGAA 1OD9A 3JWOC 3BKJH 2HH0L 2NYYC 2I60H 2KKQA 1KJVB 4MNHA 1QBAA 4GBXC 4TVPH 1YMMD 3GSNA 3U9UA 4P2OC 4YH6A 2JJVA 3RHWK 5KSVB 2JE8A 4PJDB 3UTOA 2GKIA 3QDMD 2IANE 5CEXB 4O02L 2DDQH 3LKRA 4OF6A 2A77L 1A64A 1H3TA 4DGYH 4KKNA 2VUYA 1FGNL 1KBGL 2OJEA 1MFAL 2YPVH 1MJUH 5F1NA 4X6EA 1KG0A 2MOVA 2OZ4A 3FT3A 2FZ3A 4K94H 4LGSB 5IP4A 3L3HA 3JWNC 4N8VA 4YXHL 2VZSA 1R3KA 3KLSA 1BM3L 3RWIA 1IKFL 4NFBA 1QFWM 4M48L 2OBGA 3LHPL 5FYKD 3KHQA 1I75A 4JFFA 5I76A 4OGAD 1YEFH 1OTTC 4O2EB 4PB0H 3VGGA 5ISZA 1MFCH 1IFHH 3QEHB 1I1YA 1FG2B 2X4NA 3OGCB 2B4CL 4KHTL 4DKFL 5C86A 5TPWH 8FABA 4P48A 4KRMB 4WHCA 3CSYA 1Q1JH 1CS6A 3V5DA 3VXRB 4I0PB 3U36B 1I9RH 1IC5L 4KI5C 2XRAH 4YHLH 1JCKA 2EIZA 4XH2A 3HTLX 4U6XB 4X6DB 3VH8G 4EZMA 1ZA6B 4O5LH 3TIEB 1IILE 5DLMH 2GJ6D 4OLVL 2XZAH 1GZPB 1J5OL 2HTKC 1XH3B 4Z7VE 4Q6IA 4YHIB 4UQ3B 5TDOA 3HCVA 1CFSA 3RWHA 4Y4HB 5D7LD 2OI9C 5DUML 1QFWI 4DEPB 2FEDC 2R29L 4PG2C 5DXWA 1S9YB 1SBBA 4A6YL 4FFWD 1DBML 3FN9A 3HI6H 5DD0L 1N59A 1F02I 5KSAC 4ZSOE 5EUKA 3TBVB 1U95B 4C83B 4PYGA 4NRZB 1G6RL 4CJ0A 3K7UA 1S7XB 5IR1A 5DMKB 5EA0H 4WCYL 5DJ2B 1SYSB 4GXUM 4QGYA 3V0VB 1UCTA 4R4NC 3QFDB 3S37X 3BRFA 1KPUA 4PG9A 2NQCA 1U8NB 1INQB 5I16A 5B4MD 2ORBH 3TFKD 4LSDA 4IOIB 5C0JB 4OB5L 3JTSB 1CIDA 3P11H 4IOSD 3V9FA 5E8DH 2R1XA 5HHOD 1CDHA 3LKSA 1ZGLB 4GAYA 3DROA 4NNXA 3ARFC 2BY3A 1GGCH 3G5YA 1UG9A 5CEZD 1C1EL 3NIDF 2N7BA 3C2AH 5FB8A 4ALAH 3NBNA 3DYOA 4OV5B 4EI6A 1N4XL 2NW3B 1X5HA 2DI8A 3DVNB 2H9GA 1A4KB 2DKMA 1A1OB 1CGXA 4QTIH 4WFFD 1LEKB 5T5FH 2YD8A 1EJOH 4HCRH 4P23D 2Z9TA 3MACL 1UA6H 5HHMB 4M1DH 1FJ1B 2KZWA 1MCDA 5EU6B 3ULUD 4FOMA 3QXWA 5FUZH 1ZTXL 4MJ6B 5EZLA 5CD3B 3MFFA 3HI1B 3SDDB 3OG4B 4QXGL 3N9GH 4S1QL 3VXPB 3KPQA 4NDMB 1FFPA 1SBSH 4IRZL 3TA3A 1NBZB 3P4NB 2Y6SC 3GBLA 5IB1A 5IB3B 1A5FH 3MJ9H 2XICA 3PNWB 1XCQB 1BAFL 4LVOC 2DYPB 4WUKH 5GGSY 4OKVB 3VG9B 2DL2A 3F8UB 1VADA 4R9HA 4LVEA 5EBLA 4C59B 1IGJB 4F8QA 3VFOB 1A6PA 2DWDB 4MLIA 1EMTH 2PKDA 3WHXA 1CT8A 2LTQC 4JM2B 5FUOH 4XI5D 4WTZG 5H35B 5C2UB 4X99A 4Z7OF 4L1DA 1EIBA 1L0QA 1RK1B 5IB2A 2ADJB 1A2YA 4PLNC 5LVEA 1BQSA 3MLTB 4U0QB 1DBJL 1CVSC 5BVPH 1JZ6A 2GAZA 2XG5A 3VH8B 4WUUA 2X70B 1FVEA 3AS3A 2X7LA 4Q9RH 1N6UA 1DVFD 3Q2CA 4GRMA 1VGKA 3ZKND 5HDLA 5GJSL 4N1EA 4NO3B 1WZ1L 3T2NH 5GRVK 3BX7C 1UEMA 4NM8H 4ZS7H 1MFEH 5IMKA 4U1IA 3U4BL 2AV1A 2AK4E 1CICC 4JFOA 3QEQD 1R0AL 3S9DB 4EI5A 4FQXD 4F7CB 2CO6B 1KELL 1NGPL 2HJLB 3L6FB 5MI0B 3SGKC 1W0WB 1AJ7L 4O58L 3T3MF 4PJXA 5F6IC 1RUQH 3HC4L 4CJ1A 5IMLB 1IAOB 2JCCE 1QP1A 5HDQL 3GJFA 5ALBH 5IG7B 3MLSH 5HYSA 4FTVA 2FLRT 3W2DL 4UT6H 4GKNA 1VSCA 2PR4H 1KLUB 3DI2B 2Z31A 3S5LB 3LY6A 3ILPA 2ITDA 1ZT4A 1NCCL 1QSEE 4G6KH 4LU5L 4G8IA 5CJ5A 3MLVH 1MI5B 2OLDA 5F71A 3H9SA 3SDAB 3SGJC 5I17A 1NDGB 5KG9A 1DQJA 4MAYB 2YRPA 5K59F 1P4LB 2NTFA 1LO5A 1ZE3C 3MLRL 3VG0H 5BS0E 5E8OB 2RBLA 1YNKL 2B1AH 1VFAB 1GGIH 4WW2B 2VXVH 2UYLB 4OGAC 2VB5A 3VGAB 4BK5A 3I6LD 1DUZB 2FECL 4N9OB 3B9VA 1YPZA 3ESUF 2PW2A 3ZKXC 3EOAA 2ZCKL 1P6FA 4ZUSA 4PJAE 4R8WH 5BMFH 3B9AA 3GSXA 2MJWA 2VISA 4ISVB 1TZIA 4G42B 4UINL 1S7RB 3FFCA 3DMMB 4HXBH 5H94B 5TPWL 2QADC 4HWZA 5FA4B 3O81A 4G6FB 1S7WB 4MX7A 1WBYA 3X11A 3RVWD 1XGQA 3SGEH 4OLUH 2I9TA 4D9LL 1AGBB 1NFDE 5DRWA 2XYCA 5J6GB 1S7TA 4XB7A 1A9EA 3O3AA 4G80A 4G6MH 2D7OA 3DX7A 4PJ5B 1A0QH 4FQQB 4ODXA 4X4XA 5KVEL 3BKYL 4NM4H 1BFVH 3W0WD 2P5EB 2PTUA 3MODL 3C5ZB 3Q6GH 5IHZB 1H8SA 1H15B 4M1GL 4OZGA 3UTTE 5E95B 5BQ7A 1QG3A 4KKCC 5FYJL 5H2BB 2H2PD 2LABA 4FFWC 5EO9A 1E4KC 3GSVA 3BGAA 1MIEL 1I3RB 3T3PE 2DLTA 4EJ1C 3EHBD 5EDXA 4PJHB 5ABDE 4YPJA 5HTSA 4JGJA 2JIXB 35C8L 2GSIB 5CP3A 4RGOL 1LO2L 3WHE0 3CMOH 5EA0L 3O4LA 1CN4A 5TE4H 2ZPKL 1SYVA 5B4MC 3QWQB 3NCYP 4Y5YB 4C56A 1U8PA 4YE4L 1JN6A 3LIZL 1KB9J 4PJEE 5C0RH 2DM2A 4OCYL 2IANB 4JDVB 4P5TB 2AEPL 1MCEA 3ZHDA 4PIRF 2UZIL 1U93B 2ADGA 2XWBB 3SE8H 1FPTL 1H5BC 1RQ5A 2CKBB 2X4QA 4P23C 1EXUB 4UIKL 4I3SH 1ULVA 5DA4A 5T1KB 2R4SL 5I19L 2C1PB 5FA3B 5L88H 1ZV5A 1N0XH 3WLWD 3FQTB 4KTDH 5A2FA 1JPST 2DJ4A 1P7QA 2YMXL 4X9BA 5TQ0L 3OR7A 3LS5H 2N56A 3VDCA 3OX8B 3HZVB 3LKNA 4HWUA 2DKSA 5FYLH 3K2MC 4N9GA 4QYOA 2R2BB 2XN9A 5CGYD 5L8JB 1ORSA 5DT1L 4M7ZB 3DUSB 4XI5C 2YD5A 4KV5F 1A7PH 5CSGA 4N1CA 4JGMA 4OCSL 3IDGA 5FECB 2OL3H 3FMGH 3V4VL 2X09A 1QBMH 4L3AA 3OKNA 5IM7A 3MJ8B 3JVGA 4MD5B 3IAGC 1HSBA 2H3NB 2WNGA 2YEZA 4EXKA 4M62H 3WO4C 3IYLW 2P8MB 3MUGB 3ARDB 3KPOB 5BVPL 4Z7VB 1QSVA 3BXNB 1AIFA 1FYTE 1RIHL 4OLZH 1DVFC 2YKLL 4I77H 3WFHB 2BVOA 5I1LA 2V2XA 1NCUA 3L3GB 3VGHA 2YD1A 5DQ9A 5DO2D 4PRHA 1OTSC 4JKKA 4HT1L 3QQ4A 5EFIA 3L3DA 4PR5A 4LGRB 5D6CB 2BVYA 2DM3A 1F90L 3DURB 3QIUD 1INDH 5I1EL 1P6AB 2BSTA 4LIQL 5DJZB 1JI1A 3PGCB 3U9PH 4NHUB 1P69B 1I7TA 2VL5A 1HEZB 5CIPB 1QSZA 1EHLL 1MQKL 2WBJD 4JQXC 2DJSA 4BSWA 4K07A 1QFUL 1LO3H 5MEPB 1FO0B 1M4KA 2P4AB 1MUJB 3K3QA 4JFZH 1W72A 4ZS6D 5KVDH 5IHUH 1UWGL 3O11A 4BM7A 3G5XA 4U1MB 5J6HB 3PP3H 5AYUH 1NDMB 4BJLA 4HLJA 2HLAA 4EI5D 3MR9A 1TMCB 4XCEB 1TENA 3PJSA 1BECA 5DUBA 3H3PL 2FR4A 4PJGA 2ESVB 4X4ZA 4L4VE 3CZFB 4XNXH 3KYKL 5E4EB 4LPCA 4KVNH 4JKPH 4MXQD 3CVHB 3QXDB 1W0YT 5ADPH 2ZG3A 3DARA 4FTVD 5E5RB 3OKOA 5CJQL 1CDGA 2C3VA 1BIHA 2Q76B 4OJFL 1NGXB 2Z31D 3JTTA 3C60B 3DO7B 5TH2A 1XEDA 4HS8L 3RWJB 4LLVB 2GITA 1CK0H 1DUYA 4YWGH 4B0MM 6FABL 1DL7H 3OKLB 5C8JA 2Y4SA 2AK1L 5ADOH 4BFIB 5I75C 4WFHE 4G9DA 1S8DA 2H8PA 3RVWC 2DQFA 4R6UA 5CJOL 4XRCB 3ARXA 3SDXA 3V6FA 3VXME 5IT2L 1WEJH 1KPRB 2G2RA 3IT8D 1UKTA 5ENWB 4JANB 3BUYA 4X8XA 4WWKD 5GRWA 1A0QL 4YDIL 1ZHKA 4RFEB 2FO4B 3ULVE 5CUSH 4PJ8A 4KPHL 1UJ3A 3GKWL 5K9QG 1DEEA 2B5IB 1U41A 4FFYL 4QRSA 4Z5RB 1C5CH 3HMXL 1HH6A 4HEME 4ELKB 4AIZA 2AK4B 2EDDA 4CNIA 3EHBC 4XP5H 4YC2C 1SJHA 4GG6F 1B4JL 1X5KA 3GIVA 3AAZB 4R97C 1F4HA 3TN0B 5F1IB 1SJEB 4YAQB 5JQ6L 4I4WB 3DYPA 4JZNB 1BLNA 5ESQA 4DZBB 5BRZE 2CJUH 3TV3H 2YWZA 4HGKC 2JCCB 4L4TE 2F8VA 1J0IA 4OLXH 5K9OA 4G8GE 4OF8A 1P9MC 1N5AA 3TNNB 4KTEL 4RA0C 5IFAH 4Z77A 4QRUB 2EO1A 3ESVF 2VE6B 1RJLA 3T0EE 5I0DA 5GZND 1S9KC 4H1LH 4X7FC 1TJGH 1KPVB 4OD3H 3PDDA 3SN6N 1G9MC 4UU9B 4K94C 2LFGA 1HXYB 2VQ1A 3RIAK 1QSEB 3IDMB 4LPVA 2YPLA 3D3VD 3U30B 5BZDA 3F7YB 4OD1L 3WFZA 1T66D 5DJCB 5JXEC 1Z3GH 2VDMH 4YXKH 4C56D 5D93B 3BP5B 2DKUA 4IS6B 2R2CA 1KGCE 3LRGA 3U0TA 1XIWC 1VKXA 4NWTL 3Q0HA 1V7NL 5F9JB 3H0TA 5DYOA 1TTUA 3ULSB 2PXYA 4JZOA 4PJAB 2X9WA 2YXFA 4U49A 3SE9H 3L95A 4NQDA 2J88L 4C54A 1E6OL 5CGYC 1DBKH 4TN9A 1ACYH 1NC2A 3GSWB 4YO0A 5I73B 3R1GH 3MQIA 5DJ6B 4HHAA 4JANA 3DPBA 1Q72L 4OAWA 3OTTA 2HKFL 1QLFA 3D0LB 1I7UA 1I4FA 5CILH 3WFBL 3QFJE 5E4IA 1P7QD 1BFTA 4CN4A 1RUMH 3PGDB 5TDNB 4MLSA 3LN5B 2WIMA 5DFVC 4NQVA 4ZUWB 3FZUD 3BO8B 2G9HA 2H26A 3BP6A 1KF9B 4HMEA 5DSCB 1EGJL 1UXSB 1A3LH 3UAJC 5DO2C 4E41B 4Z7WE 5C0BA 5I66B 1O0VA 3NGBC 1EAPA 3EJYD 1MHHA 2DLFH 2FECI 2QTEA 3OXRA 3QWRD 5DJYA 4ORGA 5C0ND 4P3CL 3QIUC 4AZ8A 4PRPE 5FDYA 4KH2A 4KKAD 4RWHA 4OIAA 2E9JA 4OGXL 4PV9A 3FQXA 4DTGH 1MF2H 3G6JE 1PQZB 1NJ9A 12E8H 2EH7L 1CLOH 2IALA 3ZT5A 1I8MA 4MMXC 2AJXH 1KJ2A 4Z0XB 2VLKE 2WBJC 4HW6A 3SQOH 3S88L 3WXVH 4PRAB 4PRHD 1QNZL 4TNWK 3K2UH 1VDGA 5AZ2H 4U1LB 4NP4H 3V6BR 3W9EB 4G7YL 3GJEB 3D25B 1BJMA 1T7YA 1LO3L 1NGWA 2VDPL 3FO2A 3TO4A 3NZ8B 1R3LB 5DVKA 2IPUG 4YFEA 4G8EB 4UT7H 3OKEB 2F5AH 5TE6L 3G6AA 1P7KA 3BAEL 4RCAA 1SEQH 4M61A 2Q8BH 1B6UA 3L3JB 3HZYB 4YFLF 5GGVL 1A6UH 2DQJL 4PJBF 4E5XA 5GIRA 1QQDA 3G6DH 2XACC 1NKRA 2F19H 5F8QC 4OZIB 5FYLD 2AJVL 4MCYB 4D94A 2LAGB 2CIKB 3MGAA 1ZK9A 5CHNA 1DBBL 2E6JA 3QEUA 1AXTH 1YN6B 1RVFH 4DFIA 5IVXF 3KAAA 4L8DA 1BD2A 4WO4B 2Y1VA 4XNUH 3QQ9C 3QB7C 1OM3L 3QWOA 1CCZA 1F58H 2XY2A 3WLBB 1QSFA 4XTRC 4YPGB 4QTHB 3ZE1E 3PQYE 3B4NA 4Z7UE 4YFLI 1YN7A 3CSPA 3O2VH 3IDNB 4OTXH 1U0QA 4AM0B 3C6LB 2FYYB 1FYTB 4WWKC 5L2KE 3QIBA 4ONFH 4DGIH 5IBTH 1F13A 4EDWH 3F7QA 3M17A 4OZ4A 3PWJA 4YX2H 5C08A 3Q1SH 3I3EA 3RWFA 3EOBA 5EOTB 1PYWA 1UGNA 3ZYOA 4QOKE 3CVIL 1NGZB 3MPCA 1HHJA 5E6IC 4GG8A 4F33B 3VD4A 1KLGA 1FZJB 4G6JH 3QUKB 1RZ7L 1UB5A 3QT2A 4HX1B 3L7FA 3K0WA 2WLYA 3MGOA 2CJUL 3I9GL 1NAMA 3WDJA 2ZWLT 2R2EA 4KI5E 4O2CB 4WI7A 1ZHNB 2R1WA 3UZVB 4K3EL 5IFAL 5I30H 3VXTA 3WV0A 5HYFA 4RIRA 3WBDA 3PHQB 2ENYA 5HHVL 4TUOB 1ZLWH 1GH7A 1P4BH 3PXJA 4OD3L 1WFTA 3HUJB 3P9LB 5C0CB 1OB1A 2GK2A 5E56A 4H88H 3TC9A 4L4VB 4U1JB 3RTQC 1T66C 3CXDH 5ACZA 3BP7A 3VXSE 2GIYA 4RSVA 2ZG2A 1GGBH 2FSEB 3MLUH 1YEHL 5ERWA 3WNMA 1CFTA 4CL7A 3HNSH 3TVMA 2DICA 5LXGH 3EO9H 3K80A 3BSZH 3IGAB 1YEGH 4P4KA 5HYJE 1Q9KA 1RULH 4YGAB 3AY4A 4ZTOL 1WC7B 4WY7H 2Y06L 2CMRL 3CFIC 1KENH 1NMBL 4ZTPL 5IKCB 1I1RA 5T3XL 1A3QA 2YPLD 2EEAA 4R90L 4M5YL 2Z93B 4ZOBA 3FOMA 4HK0B 1ACYL 1T2JA 1EBAA 4QRRB 5FKPA 4KVCH 4W68A 1JRHH 4KJWD 2BX5A 3VI3E 3RZCB 1YQVL 3BKCH 4NN6C 3VXMB 2HJKB 1OW0C 2IWGA 5EBMB 2JJUA 2YC1B 3PDOB 2DTMH 1G7IA 1C8PA 5CILL 3FQUB 4LCCC 3KPNB 1WF5A 3MO1A 4L3EB 4OZHE 4M5ZL 1J1OL 3F5WA 3FZUC 3S3SA 4EDXB 1HILB 3VGBA 3ZYJA 1FHGA 1J0JA 4IIQB 2BY0A 1HI6A 5HGGS 3QIWA 1KT2B 3OJDA 5DEGB 1CDUA 1NC2D 5SX5K 1B0GB 5IW3A 3NFPA 5L7XL 4MHHI 5HSFA 4GQ9H 4YDJB 3QUMH 2Q7NA 3RVTD 1GIGH 4KKAC 4ENED 2V9TA 1M7XA 1MFDL 2X4TB 3PP4H 1F45A 1A22B 3UO1L 3WSQH 5D1QA 1N3NA 3SOBH 5I15L 4DWHA 2XKUA 1AD0B 4HG4K 2E9IA 3T08A 3CH1A 4MMZC 12E8L 3V4PL 2P5WD 3UDWC 3S3PA 3A0OA 4O9HL 3EO0B 2IADB 3O0RH 4MSWB 3HHRB 3SGEI 2HN7B 3O2WH 4EBQH 2D7TH 3UTQB 3TLRA 4LSUL 5IV2A 1CFVH 4GW5B 1FIGL 1ZA3A 5KSUB 5JW5B 3T0EB 3CH8A 5KTEL 5C09B 1BJ8A 4YBLB 2FJHB 4JVWA 4JFDA 1RZJH 2DQTH 3GMPB 2XY1A 4Z78B 3S4SG 4S10A 3BH9B 1IGYB 3FFDA 2C26A 3VFUA 2I5YL 1F6AB 1C12A 5MP6H 5KSBA 1SJVA 1G7PA 2XWJB 3BZ4A 3P9MB 4E42B 1U58B 1T22B 1EFXB 3PWNB 4A6YA 2WINB 2V9RA 5LBSL 4PBWD 4MXWH 1HKLL 4HPOL 5B3JF 4XGZA 1SMOA 2NW2B 2QKIB 4MA7H 1G9EA 4ZFZA 1G6RA 1BBJB 2EE2A 1G6VK 1X5YA 4UILH 3TO4D 5D7JA 1NUNB 4K23L 3QNYB 1AXTL 2XQBL 4XXCA 5D7KD 1Y18B 2XTLA 3CDGB 2AV7B 1VB9A 3AGVA 3C5SB 5FF6A 1JGUH 1S5HB 1UJTA 1YMME 2DLHA 1HXMB 3QUYD 4JM4H 5D2NE 1OGAB 2YBRA 4F2MB 2C4FT 2VLJA 3FT2A 3EFDL 3QDME 5I74B 1FNAA 1G7LA 2HT4D 1PAMA 4E0RA 2PTTB 4LDLB 5E2TL 3GHBH 4OTXL 4UUJB 4J3VA 4K8RL 3ARBC 3EBAA 1PVHA 4V1DB 4WHYH 3ARRA 3MXWL 3NTCH 1SHMA 5D7IE 3D2UA 5KZCD 5F3HA 3WJLA 3RGVD 4RGNB 1AGDA 4PV8B 4ZFOB 3A6CL 2R69L 3O6FA 1VPOL 4R2GB 2B2XL 1L9NA 3TNMA 3N1PC 3TPUB 1ZEAL 2YD9A 4UBDD 4GAJL 4PRPB 5FYKE 3WKMH 4MWFB 1U42A 1D5IL 5C07D 4MQ7A 4FQ1L 3V52H 2BP3A 3G6JB 3VXUB 3ARZA 3N0PB 3LEVH 4X8JB 4FA8A 5F89B 2OK0L 3X3FL 4PRNB 2WLZA 3OV6A 3QIBD 5DMJB 1A9BA 5GSVB 5D9SB 4CMMA 4HFWA 4K3DH 1CZ8L 3NIGE 2JB6B 4M4RA 4FXKA 5E99H 2VXQH 4EKXA 3HZKA 3KYNB 4HPYH 3GSOB 1ZT1B 1RJZB 1NLDH 4IOFD 1BX2A 5C92A 2V2WA 4OZFA 3KR3L 4U0RB 1JYNA 2X10A 3NN8A 4GSDH 5A2JH 4JRXD 1JVKA 4KUZH 1Q0YH 3LEYH 4UNUA 3I85A 4XC1H 4ZFGL 1AC6A 4ODVL 3WJJA 2EXWD 2E9WA 4Y4FA 4P9HH 2GJ6E 2BNQB 5FGBC 3MROA 4X5WB 1YZZA 2D3VA 3CFDB 4XX1E 3SKOA 3WXWL 1IRAY 3S4SB 4I18C 3SKMA 4F9LC 3MV01 3ZDYF 1J12A 2R9HC 1HOCB 1J1XH 3QUZA 5FCSH 3N06B 4GG6A 4YHMH 3HFML 2CR3A 2PF6A 1UH4A 2APVA 3KNBB 1DQLH 5SWSB 1S7VB 1OGTB 1F4AA 1TZGL 2BFVL 3GHEH 3N85L 1FCCA 3GO1L 5JORB 5B38A 1K6QL 1RULL 3O9WA 3C8HA 1PLGL 2EDJA 1Q0XL 2GJZB 1PD6A 4HKJB 3RVXC 3T65A 4G3YL 1EBPA 3MRBB 2FBOJ 1JPSL 4R4FH 5SX4H 2E27L 5I1CH 1HHIA 4W4NA 1N8ZA 4GBXB 4WU5A 5EZJA 4KJWC 2A1WL 4PJ9A 5MHSD 4JHWL 5HHOE 3EFFB 4P2OB 2XA8H 4OT1H 4Z7UB 4GRWH 4HMDA 4KVCL 1CXHA 2Y5EA 3BI9X 5CEZE 7FABH 1WT5A 2CDFA 2ED7A 2BCKA 3U1SL 5L2KB 3D18B 5D1XA 3BRGC 4LPUA 3RUGB 4R7NA 2A9NL 5GJTL 4WFFE 5GRZA 5TGBB 4WEMB 1IGIL 1UZ6E 5JPMA 5DHYA 4NQED 4Y5XA 1DSFL 1DN2A 4KJPC 3X3GL 3RHWF 1KFAL 5AD0B 1XGTB 4JFEE 4OM0H 5ANME 3V5KB 4XZUB 2VH5L 3ULUE 4IHOA 3TO2A 1IQWL 3VCLA 2FATL 4LF3B 1RAMA 3BPCA 3RVTC 4QOKB 4XHJD 4QRTB 4ENEC 1ZOXA 4M03A 1AFVH 4Q9QL 5IEKA 3HC0A 4QXUL 5T3ZD 5F9WB 5I71C 4MDIA 3U2SA 5E2VL 2IQ9H 5DS8B 1G7HA 4XWGH 3GSRB 3HRZB 1RJYA 3ZTNH 1JNNH 2VDRL 3M8OL 5EBGA 8CGTA 5E94B 4HIEB 2VLRE 3IJYB 3S96A 1FORH 5BO1H 4ZYKB 2EKSB 1BBDH 5KOVC 1IEHA 1A8JH 2O61B 1CFVL 1H0DB 3OG6B 4X9FA 2DBLH 5CBAA 3RAJL 3QEGL 4O2FB 4JHZA 4YHNA 15C8L 2FGZA 2VR9A 4CVZB 2YK1L 4S1DD 1J8HB 2MWCA 1MVUB 4G9FB 4NPYA 5J1AA 2Z4QB 2HKHH 4XBPB 4M3JA 4NT6B 2OI9B 1MFNA 3S34L 3RX7A 2P8PB 2DQHL 4ZO7A 1CGUA 2EYSA 3P4OB 5F97E 3TWCH 4QRPA 43CAB 3OWEA 3TT3L 2DLEA 4HFUH 5KSAB 5FHAH 5C0IB 4NO0D 5HYJB 2P8LB 1RIVH 3FRUA 5HHXL 3QEQE 3TCLA 4NZDA 5E8NB 2MPAL 4JFDD 1GXEA 4I2XA 2FX7H 1J0KA 3QQNA 2EDRA 3D39B 2A6DB 3DGGB 4KK6C 5L0QC 1FAIH 4JPKL 4AK1A 4JFHD 3GM8A 3DVFA 4FQ2L 3F6LA 3T0XA 1JNHB 3RWDB 3TH4T 2ADIB 1DFBH 2FEEL 4LCWA 3FB7A 4DQOL 1MCOH 1BQLL 3QUYC 4M6AA 1P5UA 3BMWA 4G7VH 3ARFB 5LG1A 4JM4L 1D6EA 2DQIL 4NNYB 5FGCE 2HT4C 5CMAB 5I1DB 4LDOB 4OZHB 4P2RA 1Y0LA 1B0WA 5D7JD 4JQIH 4PJBA 1T1ZB 5T1LB 2DN7A 3TBYA 1G7QB 2IMNA 4HWEL 3RGVC 2IAMD 4YEEA 1KEML 5HVWA 1YY8A 2V17H 2MKWA 3VFGH 5IVXA 2IG2H 2EDFA 3LPWA 1MRCL 4UBDC 4JCMA 3LPFA 1L7IL 5D2LF 3U79A 5A16B 4GO6B 2VLJD 3I6LE 2MQ0A 4X9HA 5IW6A 4ERSL 1AI1H 3X14B 3CDFA 2D03H 1AR2A 2IPUK 4P2QA 2FX8H 1FNHA 3JV0A 3NCJL 4LVOB 2ZOLA 1ED3B 2IH3A 3D2UD 4MAUH 4MJID 4NRXB 1RD6A 2F54A 2FH8A 4GT7A 4Z7NF 2H6PA 1D9KA 2GTWA 3LKOB 3WIHL 5IHLB 4HUUA 3GMQA 5ITBH 1T6VN 3SPVB 3TH3T 4XX1G 2QQNL 1KB9K 3DSFH 2EXWC 4UOW0 5I9QC 3GSUA 2MFNA 5ISZE 3W0WE 5DDHB 3QXAB 1IAIH 3BQUA 2VLLB 3X13B 2YN3A 5DGQA 2PCPB 5IMMA 1Y6MR 1UACH 5I1AB 1M7IB 3HB3D 2EZ0D 2F8OA 4ODSL 1L9MA 2AJUL 3AM8A 3MLWL 1T20B 2OTWB 1J1XL 1FFOA 1T2QL 2GCYB 3V8OA 2VABB 3L5WA 5F3BB 1JE6A 2AEWA 1JP5A 5E5UB 2FHCA 5INDB 1CICB 4HDIA 2Q3ZA 1NL0H 1DQLL 1HWGB 4XPTL 1OPGH 5I1KH 5CLWA 1OSPH 1HHHB 2AI0H 5I1IL 4NQCA 5HHNB 2D31B 4Y1AD 4GKZA 3O3BA 4J8RB 5JHLH 5C0DB 5F6IB 2QLVB 3MV7A 3NIFF 4O00A 1HHKB 1QLEH 1A7NH 3VFNB 5J3HD 2NLJB 1HN1A 1DDHA 4UTAL 5I1CL 2J8UF 1EVTC 4L8SA 4QY8A 2P47B 3NVQA 3QDMB 2XA8L 2X89A 1DN0A 3GI9L 3E6HA 4B5EA 5HHQB 1VEMA 3G04B 1DCLA 2UZXB 5F7MC 4XP1L 3O9WD 4M93C 5D7IB 5JHDB 2M1KA 1MHPH 4P5KA 5IB4B 1WJ3A 3DVGA 2A73A 2FD6H 5EC1B 1HH9A 4XB8A 3BW9A 4Q97A 2F53A 5KOMC 1WWBX 1I3UA 5IF0A 4PJ9D 2NY0D 3WD5H 5CS7A 1YDPB 4X80L 4XHJC 2BOBA 5M94B 3ZKQD 5L8KB 1U8IA 1H3GA 5J7CC 3HAEH 1IGCH 4WHDA 3ZKXB 3JV4B 2X5PA 3W81A 4QHUB 5D1XD 1IL1A 5I8EB 1RUKL 3VFSA 1F6FB 3AXLA 2QADB 4NHCL 1DZBA 1JNNL 1ZSDB 1XGRA 2AJZA 1C16A 3SO3C 4FFVD 4LHJB 3DXAA 4XBGB 2RGSA 4ZO9A 3OKDA 2WIIB 1KUMA 4HKZA 1BVKA 5TQ2H 3W39B 3BVNB 1EV2E 5D4QA 5DD1H 5EUOB 4P57A 5J12C 3ZYZA 1U8QB 4TSCL 4ZOCA 2WM0A 4PRID 5C9KA 4N0CD 1JPFA 1AGFA 1LP9F 3HE7A 5D7LB 1LMKA 1FNEB 4RMTA 4KRNA 4HIIB 4FZEL 4YGVB 3SE3A 3HMXA 1S7QB 3GFUA 3KWWA 2C3GA 3MNVB 3FJTA 4CN1A 4FFZL 1EHXA 2APFA 1NQBA 1KSRA 2XIDA 5SX5H 2DD8L 1FO0H 3FB8A 4OFPA 2Y5TB 5FGRA 2LU3A 1IGTA 5L6YH 1YEIL 4JG0L 2W60A 2XKNB 4S11A 2AXFA 5MERB 1R5IB 3SDYH 1XF3A 1BWMA 2OR7A 3TBSB 5IQ7H 2NY2D 2ZOKB 2FX7L 4WUUE 2HVJB 3MV9A 3MUY1 1FAIL 3SKNA 3U0WH 3KVQA 5FYJD 1UH2A 3HPJB 2ATKA 2M26A 1BVLA 4QRPD 1HZHH 5E1HB 5AUMA 4DAGH 4PS4H 4RFOL 4EIGB 4AL8L 5ETUA 1VA9A 4LNRA 2X6MA 1HE7A 3IU4L 3PWPA 4WJ5A 2FJGB 1K2DA 3L5JA 2FWOB 1H5BB 4OD2B 2IAMC 4P23B 3T0BA 2X4SB 5I2IB 4PJXE 4DZ8A 1TJHL 4NZRH 5E9DA 2HMID 3U46B 4JRWA 5EZIL 3V79C 1QO3A 5IB5B 3TF7C 4FRWA 1AKJD 2HT3D 2P24B 4Y5VA 3K1DA 4FTVE 1P1ZA 4KDTA 3IS1X 4GMTL 4JY6A 1QA9B 4OCWL 4YHZH 4P2RD 4QF1A 1NGQL 3MV8A 3RPIB 1ORQA 2MCPH 4N8VG 1RZJC 1RZFL 2AXHA 2GTZB 3H9SE 4I9WD 2AGJH 3WEXA 1JRHI 1CBVH 1F11B 5I8OH 2A6IA 1JGVL 1NH6A 3KPSA 1E4XL 3SDCC 2CH8A 3LSOA 4J3SA 3O2DH 3WO4B 4A2MA 1A1NB 3QXTA 5DVOA 3IJSA 5GS1A 1YPZE 1OLLA 3GBML 3MBEA 2B8OT 1EO7A 2A83A 2R0WL 3JXAA 5I1HL 1DVFB 1I1CA 2V7HA 5K9KA 4K7PH 4R3SA 3HB3C 2EZ0C 3KHOA 4P3WA 1BFOB 1EGJA 3DUUA 1NBQA 2W92A 5BXFA 3FFCE 4OFDA 3RL1B 2F54D 3DNKA 1CFNA 4CVXA 3WNNA 3BEWA 1H3VA 5JUEL 1E4WL 4JO1L 1FN4A 2VWEC 3DTXB 4RMWA 4NYLA 3E8UL 1LK2B 1C5BL 3W9DB 1LE9A 2OR9L 2VXUL 1CI5A 1G7MB 5EORH 4RQQB 1ETZB 1U8OA 3NACL 1G9NL 4P99A 5GS3A 4OZGE 3CFKB 4OSUH 5J3HC 4PJDF 3ARVA 4F58L 2Z35B 4D3CH 2CKBL 5SWQB 1FFQA 2H1PL 4UV4H 1CGTA 1M6OA 1K4DA 1NGYB 2CUMA 5GPRA 3TPKA 1T3FA 3GBNL 3ZE2E 2R1YB 3N1FC 4K55A 4XVSH 1EO8L 2W0FA 3O4OC 2ZSWB 1I8KB 3MRQB 4KZEL 4NQCD 1A1MB 4KJQC 4MJ4A 1GAFL 3T0DA 1KTDB 1U8MB 3OF6A 3D3VE 4NKIH 1JUFA 2JB5H 1HKFA 4MNHB 3MOBH 4QT5A 4M8QB 4MNQD 5DK0A 2CGRH 1LQSR 1G84A 4C56E 4TOYL 2ICEB 3MMEB 3V7AE 4ZUVB 3D69A 4QCIB 2R0KH 5DMIH 3QUXA 5IFJA 4IJ3C 2YUXA 5FO9A 2X2YA 2HJFB 3CK0L 2EC9T 4M7KL 4YXLL 5JA8B 3BRDA 4DN4L 3VI4F 4S0TD 3BIKA 2L4OA 1WBZB 4M7LH 4OIIH 3H7BA 5JR1H 1GGYA 5BOPA 2B0SL 5I75B 4NGHH 4P9HC 3BDBA 4ODHH 4X6DF 1C5DB 1ZAGA 5ID1B 4FFVC 2F53D 4J23A 2IPKB 1AO7D 2PYED 3HR5B 3M1BB 3WFCL 3QO1A 1DP0A 2OTPA 1F6LL 2D4DA 5HGDA 3ARWA 3EOTL 3EYOB 3U4EA 4HK3J 3W0WB 1IQDA 1GPOL 1NCTA 4N0CC 3U7WH 3UJIH 1MOEA 1CE6B 3FB5A 4LOUC 3E6FB 4PD4J 3T77B 4LQFL 2VDNL 4WGVB 5GGTH 2VZUA 4HGMA 3FO0L 1MJ8L 3IFPB 2JTDA 4U05A 1CDCA 5AWNL 3VFPA 5A2KH 2R39A 2X41A 3T1FB 5GHWH 3BT2L 3TYFA 4PGJA 5E2UH 3V6OA 4K71C 3OQ3B 3QDJA 2ZUWA 4QHMA 1IGFL 1WBXB 4IRSA 4XVJH 1LGVA 4LEXH 4YC2B 3SCMA 1FO0L 1SEBB 4XNMB 3E3QC 2UVFA 2NY2C 1ZXQA 2OQJB 4R97B 5D5MB 1ZGLM 5BVJA 3IKKA 1R6VA 2EDQA 1RMFH 3IXAB 4HJGA 1OAQH 3RJQB 4JN1L 3DBXA 3RNKB 2A0LD 3UBXI 3OHXA 4PRHE 1IEAB 3IJHB 5I8KL 2YPKA 2BVPA 5INCA 4JVPA 1AGEA 3T09A 3RY6A 3MLYH 1UQSA 5DRXA 2EEDA 4FXGB 4AY0A 3CVHL 3S98A 3BEVA 1MWAH 2XXMB 1N7MH 2GSGA 3VFVA 4TUJB 3ZHLA 4YHOL 3BD5A 1F4XH 3B9EA 1I7RA 2BVQB 4ZQKA 2X4PB 1XCTB 3CUPA 2V7NB 4AMKH 1C7SA 1F8TH 1R24A 3MV9D 1VGEH 2OM5A 3A67H 3FB6B 2DQCH 5DMYA 2HMIC 5HI5D 1IMHC 4KJYB 4P3DA 3GKZA 1WAAA 3RX5A 4I5BA 2HT3C 2QSCH 4MB5A 3STLB 4QNPE 4XCYB 2OTUA 1HWHB 4OQTL 5EO0B 32C2B 2AXGB 1XIWB 1EX0A 2Y7QA 2NZIA 4UAOC 3SY0A 1KIRB 2ICWI 3LN9A 1PJ9A 3MRIB 4OLYH 1MCLA 1FVDB 5FAAA 4F7TA 4LHUB 1FL5B 4JM2F 4PLKD 4HIXH 5GGQH 5SX4I 1U3HA 3UTSA 1ZLUK 3C5JB 4LLQA 1WWAX 3P30H 4PJGE 5B39G 3RKDD 2CUHA 3AU1B 25C8L 1OTUD 1ZHLB 3C2SA 4CW1B 2FBJH 1ZWIB 2KL6A 2NY6D 1CBVL 2HWZL 4Y8DC 1IEBB 4KQ4L 4GW1B 5I8OL 1CTNA 4LKXA 2DQGL 2Z91B 1CDBA 2NY5H 5JTWA 3HE6A 5C71A 1INEH 4Z8FH 4XWOC 3I02B 3MOAH 1V3JA 3I2CH 1U92A 2AEQL 3EDFA 4N0YH 4F57L 5DUPH 5D2LA 2X4RA 1JPTH 2M2DA 5E5MB 1W0VB 3T0WA 3NGBB 3LZFH 3NPSC 1TITA 4N0UE 4JO4L 1CVRA 3GRWH 1I3GL 1CQYA 4Z7QF 3MGTB 3KPSD 4OIBA 3QIUB 4JRYA 3SDXE 4S1SL 2BHZA 1WVZA 5GGUB 3P0VH 1ZKAA 5EN2A 1MQ8A 2ATPA 4APQD 5JDSB 3HRPA 4RX4D 4C58B 4OF3A 5GSRA 2AJYL 3MBED 4PP1D 5AZEH 3OJMB 4PRDA 2WBJB 2FL5A 1V3MA 2R56H 4XP4L 1GC1L 1IM9D 1AY1L 2NXZC 3FO9A 3QCVL 3PV7A 3THML 3QDGD 2J6EH 4RRPA 1MCCA 4D3CL 1PW3A 1K5NB 1YC7A 3I6GB 4RAUB 4W4OA 2AXJA 3L3IA 5DD5H 4H26A 1RURH 5EIIB 3HG1D 4OCRL 3T2QA 5JPNB 1WISA 1JWSA 2AJ3A 1IAKB 3QJFA 5LAXA 5HPMB 1VFBA 1S9VA 4U3CA 5BV7H 1UVQA 4ZFFA 3C6SB 4JY5L 5B22A 3MCKA 3V7AG 1YJDH 2ADFH 1CLZL 1I1FB 1OARL 5BW7C 4WW2F 4PGBB 5J9PA 4NIKB 3CFBB 4TSBH 1ADQL 2EDOA 3PABA 3QISA 5E8PB 2CGRL 2BMKA 1X5GA 1CGWA 5IVZB 3V5HB 4M6NL 3MC0A 4WRLA 1R3IL 1S3KH 4BZYA 1D5MA 3PWUB 5LGKA 3GM0A 4Q2ZA 2J8UA 5FCUL 4OUOA 4U1GC 1IGMH 4P5MB 3WFDH 2YPLE 1X5AA 1MLBB 3ULVH 5IIEB 5JR1L 4NO5B 1QVOA 1RFDL 2YZ8A 1DANT 5B39B 3CX5K 3LMJH 4AH2B 1NCWL 3MRGA 3VWJA 2R4RH 1CD8A 3HLAB 3FQRA 1XF4A 1GZQB 3QCTH 4WI4A 3I75A 2VDLL 4WWKB 4X98A 1Z0NA 3ZTJH 4JVUA 3BZFB 1A14H 2R0ZH 4EUPA 4P46A 5E70A 1IAIM 3L1OL 2R15A 1JF1A 4NOFA 4D0BA 4J6RH 4LSVL 5TF1H 2WUCH 5ICYB 1KCVH 1RZIB 3TBWA 1KJ3L 4PJHF 4Z76B 3MRLA 5CZVL 3KDMA 3G08A 1R3JA 1TZHA 3ORJA 4KK8C 2N7AA 5E6IB 3MRJB 1U8LB 3NFNB 1TVBB 1U6AL 2RB8A 1CL7H 1A7QH 2CSPA 3T0AA 4ODUB 2I26N 1OSZA 2FJFA 4JO3H 3ZZ1A 4R4BA 1ES0A 1D5XB 1ZMYA 4NCC2 1IM3A 2W91A 1FFNA 1E4XI 4X83A 3G5ZA 2JJSC 3H9HB 4JPVL 1XF1A 2Q3AA 3RVUC 3PV6B 4LL9A 1CFQB 3LQZA 1LP9A 4ZPTA 4HWBL 4PRBA 4NNPH 3QDJD 2FX9L 3MRKB 1N2RB 4YQXL 3CLFL 1IAII 2XPGB 2IF7A 3QA3A 5IVOA 3D3VB 1KCKA 2OCFD 3RTQB 1OAZH 2C7UB 4I8DA 2G60L 2A2QT 1JNLH 5HI5C 1F8TL 3SJVD 1WIPA 2DQCL 5DQDH 1UXWA 4K7FA 1ONQB 5ITFA 1WZKA 3QQ3A 2PO6A 3QPXH 2XFXA 4JZJC 4U6HB 2MHAA 3HPLA 5C0AB 1VFUA 3IFLH 2KQMA 3UTTD 4FQIH 1XGPB 2B1HL 4LSSH 4PLJC 4NO2A 1I8IA 3MX0A 4MQSB 4U1HA 4PLKC 1UCBH 4N0FA 1MCFA 2GT9A 3MYJB 4H0IA 4BKLB 5FYKU 4TSAL 2DS4A 3RKDC 5DJXB 1MHEA 3ALPA 3ALWA 1OTUC 1T0NA 1AQDB 5EU5B 2NY6C 4NUJB 1MIML 5GRUL 3TCXA 4Y16A 5CWSA 5CJXC 3ECBA 4NN6B 4Z7VF 5DHVH 3FAWA 5KAQG 1U91A 2GFBB 4PREA 1QLRA 3MA9H 43C9A 4LCCB 3OZ9H 5IJKA 4JJ5A 5DQJB 2NX5A 5FDWB 4ODWB 5C7XH 4OFYA 4XPAH 2J7LA 1ZVSB 1UWEL 4R0LA 1U3HD 4HH9B 1SVCP 3UTSD 4MA1C 2C3WA 5SWZA 1R5VA 1QSFE 3RWEA 4U1KB 4P4RA 2W65A 4Y19B 3QO0B 2ITCA 2E6PA 3BH8B 4JPWL 4YDKH 4YNYB 2PYFA 5C07E 5L2JA 3HE6D 4APQC 4PBXA 2PW1A 4BELD 3HZMB 2Z8VC 3MBEC 4PP1C 4ZAKA 1D5BA 2DWEB 2YRLA 4X4ME 5D1ZD 1CLCA 4PB9H 1KTLB 3PL6A 3TJEL 1NBYB 2JKXA 3QNXB 1PZ5A 3AB0C 1JV5A 1NBVH 4QHNA 4UB0H 1UKQA 1X4XA 2YS4A 5JXAH 3MRNA 4HZLA 5B8CA 1EUTA 3PWLB 4JRXE 1XR9B 1EDQA 3I50H 3B3IB 4WVRA 1T1YB 3GGWB 4UTBH 3S6CA 3MRPA 1MRDL 1I9IL 2W0PA 3MNWB 3CSGA 4Y2DA 1V7ML 1JNJA 4LBEB 1I85C 1DBAL 5T1MA 1DLHB 1M7DA 4O4YH 4U6VL 4X0KA 2XZCH 3JWOH 4G5ZL 2W9EH 1KCSH 3BE1H 4F7PA 3O8XA 3D5OF 2ADFL 1Z5LB 2IGFL 5E1AB 4YZFF 1KJVA 3AS2A 4S1RL 3EZJB 4UIMB 5GGRB 4KQ3H 3H42H 1MJ7H 2OP4H 1G1YA 5KSVA 5C0EB 4PJDA 4U1SB 1QPXA 2OL3B 3MA7B 2CLRB 3UROR 3QPQD 5CEXA 5D96C 4PFEA 3F12B 4R96B 2FLBT 1KN4H 4MZ3A 3BP4B 3PHSA 5DJ8B 3S3JA 5MHSE 2F5BH 5GXBB 1I1AD 4F7EB 4P9ML 4NJ9H 5ECJE 4XMKL 1FL3B 1OQOA 3ARBB 4O2EA 3WIIH 3G9VA 3B9KD 5DZOA 3QEHA 2I9LB 4NQEE 4XMPH 4F9PA 1FG2A 4FNLL 3OGCA 3BGMB 3LQAL 4N0UB 4RNRB 2E6QA 2V5RA 1G0DA 3QH3B 3VXRA 4I0PA 3U36A 5D72L 3VWJD 4NZTH 3ZL4L 3FT4B 1N6QH 3P73B 4U6XA 4X6DA 2EDYA 2NPLX 5IGXH 4K8RD 5T3ZE 4I48B 3CLEH 4H1LG 1AXSB 1II4E 1ZA6A 3TIEA 5T33H 2JCCF 2BDNL 3QCUH 1GZPA 1XH3A 1SY6H 1NLBH 4P46D 5HGBB 4YHIA 4UQ3A 2A6KB 4QO1A 3RA7H 4Z95H 3FOLB 4HF5H 2IJ0C 3WIHA 4Y4HA 1KCUH 1A6WL 3GB7B 3O41B 3ZDZF 2JJTA 3FN0L 4RAVB 1S9YA 3U7AA 4LSTL 4TYUA 1OP9A 3KLHD 1X7QB 4WIQA 3CC5B 3CXHK 3TBVA 1U95A 4C83A 4CUCA 4NRZA 1KIQB 4WI8A 2R2HB 3BHBB 2HFTA 1S7XA 2CKNA 5DMKA 3L3OB 5DJ2A 1SYSA 4I18B 3V0VA 1MCKA 3QFDA 2VERN 1RU9H 1U8NA 1INQA 1BEYL 1OVZA 5LCVH 4IOIA 5C0JA 1F4WL 1UM5H 3MRCB 2LU7A 3JTSA 4PJAF 4FZ8L 3CU1A 1FG9C 3ULVD 5GS0H 2YHGA 4JG1L 1ZGLA 3QP3A 4JFDE 1I8LC 3BN9D 1CDYA 2MSPA 4ZXBD 4LASL 4OV5A 1UWXH 5GISH 4MJ5B 2NW3A 5C9JB 4D0CB 3RBGA 4JFHE 3NCEB 4FMFA 3DVNA 5E7FA 4XPHH 1YNTB 5KSBE 4U6YB 1A4KA 2HP4A 1MCIA 1A1OA 4ZUTB 2R0LH 1LEKA 3IFNL 1JHLL 4ZFOL 1ZLSL 1FJ1A 2V9QA 1HIMH 5EU6A 3DSNA 3QHFH 3RL2B 4MJ6A 5CD3A 4JCLA 3HI1A 3SDDA 5L9DH 1MPAH 3MA9L 3VXPA 1NEZG 4G8GD 4NDMA 3UPCA 4L9LC 1NBZA 3P4NA 3RDTD 4TRPH 3D9AL 2W38A 1CU4L 3UZQA 4B41A 5IB3A 4J3OC 5C7XL 1CE1H 3PNWA 1XCQA 1T04B 2DYPA 4OKVA 1QRNB 5C1MB 1IGJA 5IJVB 3VFOA 2DWDA 3JV5A 3WO3B 4JM2A 3VXQB 2PETA 3PF2A 5H35A 4TTDD 1CF8L 2VLJE 1RK1A 3TZVD 2ADJA 5GRJL 3CGTA 3UMTA 1HINH 4RDQG 3MLTA 4LCIL 5I71B 5MEQB 4LP4A 2VDOH 3TJHD 2NX5D 5D1ZC 2P5WB 2ICWJ 3C8KB 3T8XB 3V4UH 3VH8A 4OFYD 4PPTA 3RWGB 4H1LB 2X70A 4MNGE 5SWZD 3SO5A 5K9QI 4NJAH 2V2TB 4YDVB 1CD1B 4NO3A 1CLYH 3EYSL 1BGXH 3NZHH 4AT6B 3WS6A 3NFSH 5D6DA 4DVRH 1T1XB 3U6RB 5FKAB 4GUPB 4F7CA 1Z9SA 5ALCH 2HJLA 3L6FA 4OZIF 4TQEL 1W0WA 2E7LC 3JWOL 5F96H 2YD3A 3O3UN 1NAKH 4PYHA 3OKKB 3MCLH 5IMLA 4X7EC 1IAOA 1UADC 1WICA 4XXDB 5IG7A 1NCBL 4KQ3L 2M8XA 3QPQC 1KLUA 4Y1AE 3FAXA 5L0QB 3S5LA 1QFWL 4KDWA 4W81A 4HC1H 1RUAH 2NY5C 4KRPD 3ABZA 2SEBB 1U8HB 1CGSL 4XPFH 4AG4H 4GG6E 5IFHH 1MI5A 1EJ6A 3QUYB 3SDAA 1NDGA 5DD3H 1I1AC 1U2HA 2QHRH 4MAYA 1P4LA 2G75B 5FYKH 1DJSA 1IE5A 5E8OA 3GIZL 2VLKD 3NH7H 1VFAA 4WW2A 3S8WA 3BYYA 2UYLA 4NJ9L 3S7GA 2VXSH 1DUZA 1L7TH 4ODTH 5KZCB 3B9KC 4OI9A 3RGVB 5HYQB 1NEZB 4BZ1H 5CBEB 3DV4B 3WIIL 5EBWB 4ISVA 1MEXH 4JKMA 4G42A 4I13B 1S7RA 3UXFA 3DMMA 5H94A 4ONGH 5FA4A 1S7WA 1A4JB 1T0PB 1AGBA 5C07B 5J6GA 3S35L 4D2NA 4Q74A 4WTZA 3F7VB 4PJ5A 3CFJB 4FQQA 1FSKC 2P5EA 3P3YA 3C5ZA 1YEKH 4LLDB 4RWYL 5IHZA 2AABH 4CAGA 1NLBL 2HAZA 1H15A 5EC2B 1MFBH 3MLXH 5BV7C 2F8XC 1UB6B 5H2BA 4JRXB 3MRDB 4K9EH 3VXRD 4KK9C 3KLHC 2Q7YB 3HUJF 1YJDC 1FRGH 4GH7B 2YD6A 5D8JH 5I9QB 1I3RA 4UOW1 4ETYA 4H25B 2DQUH 4PJHA 1BOGB 2O5XH 5BZWB 2JIXA 2Y23A 2GSIA 2OSLB 5E00B 2FB4H 5A2LH 1OAYH 3P0YH 4BUHA 3IKCB 1M05B 5CINH 2IFFL 4X5XB 4JO2L 4S2SB 4Y5YA 3EDJA 2DIJA 4XP9H 3OGOE 3ULVC 3OPZH 3ZDXE 3CX2A 1UM5L 3NABL 5CEZH 2GK0B 3BN9C 5KVGH 2IANA 4JDVA 4ZXBC 4M6ML 4P5TA 3B6SB 1DQDH 1U93A 5I1JH 5IBLC 4Q58C 2XWBA 1B0RB 3A6BH 3LB6D 5FYJE 4P59H 1FGVH 4I3GA 2CKBA 1K8IB 1EXUA 4K2UL 1I9EA 3ULUH 5T1KA 3JBG7 4QRPE 2C1PA 1CXFA 2Z8RA 4YHPB 4DN3H 5HBBA 2EIEA 3RBSA 5FA3A 4PGDB 1UM6H 3F7PC 4XVTL 5I18H 1P4IL 5HXMA 3WN5C 2D4FA 3FQTA 3L9RB 3NCMA 3QHFL 3GSQB 3DWTA 2CRMA 4I2XE 3O6MH 4F37K 1CXKA 4M93B 3RDTC 5T1DH 3VA6A 5HHPB 3OX8A 1F3RB 3HZVA 1RZGB 4NQEB 7CGTA 3QZWG 3MXVH 2JJWA 2QQLH 2R2BA 3ZHKA 3NAAL 3ET9F 3DUSA 1C08B 2BNRB 1HCVA 1DQML 4LRNL 3VE0B 1KB5H 5FM5O 5FECA 5DJDB 1QD0A 3TZVC 3MJ8A 4MD5A 2H3NA 4PJCE 3BDYH 2P8MA 4P2RE 3TJHC 4PJBE 3IU3B 3MUGA 3ARDA 1OD7A 1QEWB 3KPOA 1KC5H 1ZANH 4Z7VA 3BXNA 4JQVC 5DK2B 3QI9C 5E2WH 4R0LC 5E03A 2CR6A 3Q3GB 3WFHA 3X17A 2VSDA 1J1PH 3PWVB 4LSPH 5IVXE 3SO3B 3L3GA 5I8CB 5KJRL 1PG7W 4NN5C 4FP8H 4KK5C 2D7QA 5D6CA 1OCWL 1QKZL 2EIBA 3P77B 5J12B 3DURA 1TJIL 1G7JB 2O5ZH 5GGVY 3UJTL 2OJZH 4KROC 4HIJB 1P7HL 4QRQB 3DX8B 4P2QE 4X6BB 1IC4L 5DJZA 1XGUB 4GMSH 2J4WH 4WI5A 5IESL 3PGCA 4HQQL 2MKLC 3DYMA 4NHUA 1HEZA 5CIPA 5CSZB 2F54E 1MCRA 1FLRH 4XCFH 2FH6A 4HUKB 4AEIH 5J1SC 1Q9OB 3MRMB 4NO0B 2OS7A 4BH8B 1GGUA 5MEPA 1FO0A 2J5LC 1AHWC 3ARUA 4JPIB 1MUJA 3QAZC 4F15C 1CL7I 4HH8A 3O6LH 1CTOA 2H32H 1UH3A 2ZUUA 1FBIL 1RUPL 1SQ2N 3TBTB 4U1MA 5J6HA 1NDMA 1NMAH 1WZLA 3MBXH 3MTRA 5IW1B 1YECL 2ZCHL 4LFHG 4KRPC 4XCEA 3UYRL 5C2BH 4UQ2B 4WHYG 2VUOA 4JR9L 5F1SA 4X6FB 1KEGL 5SV3A 2ESVA 4MCZB 5F72S 5DHXB 3CZFA 3D6GA 4C55A 4XPFL 3F65A 3QNZB 2FNBA 5IWLC 1UZ8B 3GSNH 3H7LA 3EYFB 3CVHA 2QHRL 3QXDA 4Y4KC 1TCRB 4LIQE 1FIEA 4Q6YA 3SKUD 4Z7WF 2UWEE 2AW2A 3AMKA 1BZ9B 1LWRA 4NQCE 4GOSA 1NAML 2HFEB 3QUMB 2Q76A 4MYWB 1NGXA 4KKLD 2IAMB 3C60A 3VGFA 3DO7A 4NQXB 1VACB 5LQBH 5JIKA 4GRLD 3RWJA 4LLVA 5DC4B 2VXTH 4FG6D 1ZHBB 4BZ1L 3QRGL 3QZWB 2Q86B 3OKLA 4BFIA 4L8CB 4UT9H 3SDAD 3G6JF 4OQTA 3E1F1 3UBXG 4MAYD 3TT1H 4XRCA 4LVHB 2DIBA 3AREC 5EWIL 1KPRA 1OT2A 5ENWA 3SBWA 4J4PD 2VZVA 3T04D 4Q0XH 4MJIB 4MNGB 3WDHA 1YA5A 4RFEA 1NKOA 1JPGB 4OFVA 2AJSH 3IS0X 3N1QC 2FO4A 4HG4J 1I9JH 2F53E 5EZOH 5D71H 1AO7E 2VZOA 3DMMD 1A3RH 3SDCB 1MFBL 4Z5RA 2CIIB 3GMLB 1CD9B 3RNQB 4ELKA 5LWYH 5D7SL 2F58L 1MVFA 1FRGL 2AK4A 3WE6B 4PUBL 2ZCLL 1E0OB 1S9XB 5DF0A 3IDJB 2DQUL 4Q7DA 1T4KB 3AAZA 3TN0A 5F1IA 2P5ED 3INUL 1SJEA 4YAQA 5JOPE 3OAUH 4I4WA 4JZNA 3ARGC 4DZBA 1JK8B 2EXYD 3P0YL 4ZO6A 1IKNA 1AD9B 5F7EH 1MAMH 1F97A 1RIUL 3TNNA 2HYMA 3OKMB 4QRUA 2VE6A 3B9DA 3T4AB 1G9MH 5CEZL 2BERA 3R06A 1J0ZA 4PY7B 4Y1AB 1KPVA 1TQCC 4UU9A 1MCBA 3S35X 4K3GA 3IDXL 3ZE1F 1HXYA 4WV1C 3LB6C 4J1UB 1QSEA 4Z7UF 3IDMA 5DFTA 1A6VH 3EKCA 4PJFB 2EE6A 3F7YA 1BQUA 5DJCA