3VI3E

Crystal structure of alpha5beta1 integrin headpiece (ligand-free form)
Total Genus 47
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
47
sequence length
219
structure length
219
Chain Sequence
DIVMTQATPSIPVTPGESVSISCRSNKSLLHSNGNTYLYWFLQRPGQSPRLLIFRMSNLASGVPDRFSGSGSGTAFTLRISRVEAADVGIYFCLQHLEYPFTFGAGTKLELKRADAAPTVSIFPPSSEQLTSGGASVVCFLNNFYPKDINVKWKIDGSERQNGVLNSWTDQDSKDSTYSMSSTLTLTKDEYERHNSYTCEATHKTSTSPIVKSFNRNEC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Cell adhesion/immune system
molecule keywords Integrin alpha-5
publication title Crystal structure of alpha5beta1 integrin ectodomain: Atomic details of the fibronectin receptor
pubmed doi rcsb
source organism Homo sapiens
total genus 47
structure length 219
sequence length 219
chains with identical sequence L
ec nomenclature
pdb deposition date 2011-09-21
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3vi3E02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3vi3E01
3HNVL 1V05A 4NN7B 1NKRA 3WS6C 5CSGA 3U7WH 3TPKA 5JMOC 2HTLC 5LQBH 4YFLF 5KVGL 3GMRB 3X14A 4DAGL 4OIAA 3SN6N 3P0YL 1RIUL 5JUEL 5SWZB 3R8QA 2VXSL 1ZS8A 1ZT7A 3VWKA 5EIIA 3BHBA 3VXUA 2FR4A 4FMKA 4EQ3A 1AGFA 2J8OA 5I8CA 4P46B 5IROC 4M03A 1CK0H 4JFFE 4S0SD 1BZQK 3LQAC 1INQB 2KPNA 3T65A 3LQAH 2UZIL 5K9QI 4E41E 1I7RA 2WBKA 1L9MA 2OK0H 1T2QH 4WHYG 3GMMA 1F90H 4YXHH 5L88H 2CXKA 4LEXH 4HUVA 3ZKQD 1C08A 2HT2D 2OTWA 1T1WA 1FDLL 4KTDL 4K7FB 3TNMA 3O2VH 4RNRA 1PKQB 4LLUA 1JGLL 3L7EA 4O02H 5EUOE 1RZFH 1MHCA 4FG6C 1HZHL 1FVCA 4IDJH 5D7LB 1MQKH 3VFNA 5ELIA 2P5ED 1QLEL 5E00A 2ICEB 5T1DH 5MERB 3SE9H 3LMJH 2FRGP 4PS4L 1I3GH 4ZUUB 1A4JB 1YEGL 4UB0H 2AXGB 5HPMA 3ZSTA 1L0XA 2R0LL 1WZ1L 2WBWB 3EFDL 1F4WH 5IHUL 5C0RH 1JWUA 5IB2B 1DVFA 5EOCH 3MLSH 4O9HL 1ZGLM 1AGEA 4QRRD 1XCQB 4IDLA 5HY9B 2YPVH 4DUVA 4FQXC 1T0MB 3OGOE 3SQOH 5BZDB 4GKNA 1G9NL 1ND0A 3RWEA 5T1LA 5DZOA 4JRXB 3SDDD 1U58A 4YHZL 1JGUH 1JI2A 4QHUB 5T33H 1NGYB 5E8DL 5DURB 4HWUA 4WCYL 5E8PA 5D1XB 5K9JL 4L8SA 3KPOB 3V52L 5HD8D 3MLVL 1FGVH 3OAYH 1QFUH 3PWPA 4MA7L 4DVBA 1W0YT 1XGPA 2DQGH 2GSIA 3K7UA 4KUZL 3ULUH 4W4OA 1GC1L 2R9HD 4KKCD 1NC2A 4GKZA 3MOAH 4PR5A 4FMFA 4K2UL 4JY5H 5DHVB 1MHPH 4MJID 4WNQB 1S5IH 4X7EC 4LIQH 1OAXL 3W0WA 2A9NL 3CUPB 4K3DL 1V5JA 4M6OL 4DZBB 4L4TA 2GSGA 3QUXA 5DEGA 1TZGH 3LEXB 4OLYH 2E9WA 5FM4A 3BZ4A 3C60A 1E4WL 5D6CB 1CDIA 1K9TA 4ODVL 2HT4D 3SDXE 5IG7B 2MPAH 4PTUB 1MCOH 2E6PA 3BT2H 1JZ3A 1Q94B 1NQBA 3UZQA 2Q76B 3SE8H 1A4KA 2EC9T 4OFKA 4KAQH 1T20A 4UU9B 1BFSA 5DSCB 1C5DA 1QA9B 3I75B 2Z35A 3SDYH 1AO7D 2YBRB 1T03H 3LQZB 4XNXL 1CXIA 3EYQC 4QRUA 3VWJA 2AK1H 3HAEB 4U1JB 3OQ3B 3SGKC 3SOBL 1PZ5B 2EDDA 3F12B 4X6CE 5TF1L 4M9PA 1CQYA 4KZEL 4KKBC 3QG7L 4G5ZH 4JN2A 2DQIH 4XPBL 3GUTA 1R5VA 3HPJA 4M6ML 1EVUA 2EDRA 1JHTA 4UDUA 5EBWB 4ZOBA 1NBVL 15C8L 1BD2E 1Q9WB 4Y5XC 4NC2B 3FMGL 4L3CA 3WFBH 1CD1A 2YOCA 4JQIH 3AU1B 3BIKB 3Q6FB 5HYQA 4FZ8L 4P59L 3JTSB 4MS8D 2IPUG 5GS0D 1NUGA 5DVOA 4L9LA 3NGBC 2VDML 4M7LL 2V5YA 5JTWA 2W0LA 1EERB 4JY6B 2QSQA 4WO4B 4P5TB 1IGFH 1F6LL 2DI9A 1X5XA 4OCSH 2DI7A 2W0PA 1BAFL 1MIEL 5ALBL 2RCSL 3L5WA 1S9WA 1GOGA 1EEYB 2R23A 4MX7A 3QISA 1NCWH 1DSFL 4EXKA 4LCCB 4HUUA 2PCPA 3BP4B 1N4XL 3FT3A 4U6VH 1F4XH 4IRJD 4FFYH 2P24A 4N0YL 4Q0XH 2EIZA 4GSDL 4R90H 1MWAH 2XN9D 3OX8B 2HFFA 1JZ7A 2R1XA 5TE6H 1FL6A 2FJHB 4K7PH 2ZSVB 5DRXB 2IPTH 5FK9A 3O81A 5T3ZH 2UVEA 4GMTH 3KLAB 1YEIH 5EU5B 5CFHA 1YEJH 4P23B 1EMTL 1E6JL 5GGQH 4MJ6B 4GO6B 2HN7B 3BE1H 4LF3B 4OLVL 5A3IC 5FDWA 3BW9B 3MBED 2DQUL 2V2WB 5JW4Q 1NC4A 1NCTA 2E7HA 4ZO8A 3DVGB 2EH7L 3C6LD 1PG7L 5DK0A 4ZQKB 1PDKA 2WIIA 1WFOA 4U1NA 1N59A 3GKZA 3HE6C 4TVPE 3JWOC 4GKOA 3JWOH 1T0NA 3MJ8B 5CKGA 5HHXH 1WV7T 1KN4L 3T8XA 1UYWH 2IFGA 1DCLA 3MO1A 3BISA 2G60L 4MQSB 2JIXB 1X5GA 4QO1A 2BVOB 2YD9A 1U95B 1HHGB 5JW5B 5CJQH 3RX5A 3ARWA 4A2LA 1UZ8B 5D7JA 2XWBB 4TULL 5E8NA 4JFHD 5DD6A 1AD0A 3IFPB 2VABB 3RDTA 4WWKB 1SEBB 4OKVA 1NLBH 1FNEB 2HTLD 3UTZA 1YY8B 3ULSB 3U4BH 3HB3C 1WBYA 4OFIA 1D5MB 2JCCA 4PJEF 2VISB 5I73C 2V9QA 1X7QA 2OZ4L 4I3SH 4PGZA 3RX8A 3T3MF 2VLLA 3WNNA 4C58B 2X4QB 3BQUB 2GTWA 1R3IH 4YNYA 1KB9K 5HJ3B 2AV7A 4I3RL 4JANA 4HIXH 1NDMB 3RJQB 2QLVB 2EO1A 3BFOA 2GAZA 4JG1H 4HMEA 1JNHA 1KTLA 4QOKB 4OB5H 3PWPE 2CIKA 3VGGA 5AWNL 4JFDB 5EA0L 2ZUQB 4ACPA 3ZTNH 1G7PB 2DLEA 4YPGB 4FG6D 1MQ8A 1S5HA 4AL8L 5IVXA 3OKEA 5D96B 3RI5F 4NNXB 5E08H 4WI3A 2H32H 4P9HC 1JBJA 2I07B 3W0WE 4P9HH 5ESVA 5T5NG 1UGNA 1FYTD 2B1HH 2P4AB 4L4TE 1X6LA 2GK0A 2YRLA 3I6LD 3TH4T 4N0FA 5F9WB 3KPPB 3HC0A 1FAIL 3V4UH 5E4EB 4KK6C 1MJ7H 2G5RA 3TYFA 7FABH 2UY6A 1Z9SA 3MROB 3KDMB 4HSQA 5I19L 5E6IA 4GAGL 3SGJC 2BP3A 2PYFB 2VLRB 2YUVA 3S96A 5BRZB 2DAVA 5DI8B 4NQVA 5DQJB 3VFMA 2Q3ZA 5HDOA 2EYSB 4ZUVB 2Z4QB 3ARFC 5HPOA 4FQXD 5CJ5A 4MD4A 3O6KH 2R8SH 3MA7A 3V5HA 5E1HB 4PGEB 2XG5A 4UTBL 3O2DL 4OCXH 5DD1L 4G8GB 1A7BA 2PW2B 2JE8A 3LN9A 3AUVA 4MA1B 4P2RD 4F8TA 3MC0A 1BP3B 4I5BB 1MOEA 1VFAB 5DO2C 3UTSB 1D7FA 1MCPH 1AGDB 3L3DB 4YDLB 2KDGA 4RGND 3WXVH 4LL9A 1FG2A 2W9DH 1CFNA 3ULUD 1R3JB 3V7MA 5J11B 2ZUSA 4YDVA 2HG5B 4XNZB 1KIPB 1KB5A 5D7SL 1FFQA 1BEYH 1NCCH 2HKHH 1P1ZA 5LXGL 3VFRA 4HJJH 2UWEA 1NSNL 3IXAB 3VDBA 1TVHA 2A2QT 3MNWA 4BH8B 2ZSWA 4PJ9B 2J5LC 4NKDA 3UYRH 1XIWC 1UCBL 4YPJA 1JGEB 5F7HA 4GBXC 5IB3B 1R3LA 3DV6A 2IH1A 2D4DA 3EO1B 3WO4B 3BXNB 2G75B 1EZVX 3ULVC 1LE5A 3ULVH 3IETA 5D2NA 4LCWA 2V2XA 1SJEA 1A1OA 1UWEL 1DBJH 2DBLH 4LKCB 5IHZA 3BPOC 2ZNWA 5IEHB 1U91A 3QH3A 5F1KC 4ZD3L 4HUWB 2VERN 1J05B 2GKIA 4QYOA 3O6LH 3EYQD 1ZXQA 1XF5A 3MX0A 3IDGB 1JNLL 2YKLH 1R3KA 1P84K 5I2IB 1QLRB 2DQCL 4UV4L 2HH0L 1DQTA 2DQJH 2HFEA 2VXQL 4MWFA 3VXSB 1OM3H 4EOWH 4DZ8A 2GJJA 3FFDB 4MJ4A 2VC2H 4KKBD 4WFGE 2GJZB 3BRGC 2HRPH 1CFVL 4MQTB 4NKMB 3QO1A 4M6NL 3MACL 2OP4L 5GRUL 1WWBX 5ESQB 3EYFA 5GGRY 2OR9L 4D9RE 1SEQL 2NY6C 1QSEB 2NY3B 4LP5A 5EO9B 2CGRL 3B3IB 3WXWH 3FOMB 4UTAH 2HA1A 1HH9A 4U6HB 1P4IL 2EE6A 3SGEI 4RWYH 4JKWA 3DSNA 5C0BB 2IGFL 1CE6A 1CIUA 5DJZA 1B2WL 5FYLL 3I2CH 1X5JA 4EBQH 2WSKA 1J1PH 3QJHA 2NY1C 4RBPK 3O6ML 2XA3A 5ESAA 3BIBX 1FZJB 4F9PC 3G5YA 1KPVA 3EOBA 1ES0B 4JZJB 2CK0L 3KS0J 4X8XA 3BKYH 4M48L 4ODWB 3GMQB 1WBXA 1ORSA 4X8JB 5IV2A 3V5DB 1T4KA 1N8ZA 2BK8A 4EI5D 1HIML 2VQUA 4I0KA 1E4KA 4WV1A 3JV6A 3BP5B 1UH4A 3OG6B 4Y5VB 2EIDA 5HHME 2JCCE 3L5XH 5T3ZD 2PW1B 1RZIA 2V2TB 4NQEB 1FL3B 4I48A 5CIPB 1ZLUK 1X4ZA 1A0QH 4NN5B 1A6TB 4XTRC 5A3ID 3IJHB 5TE7L 2LVCA 3A6CL 3AREC 1INDL 1Q0XL 4N1HB 5GJTH 4JR9L 1CGVA 5D72L 4KTEL 3CFJB 1A5FL 1EA9C 1IGML 4F7MB 2YPKA 3MA9H 4J23A 1MCQA 5IB5B 1ZA3B 2DI8A 2YD2A 4HFWA 3HE6D 1GJIA 4L5FH 1MJ8L 2VITB 2X5PA 1HOCA 5DVLA 5HHVH 1E6OH 2NY0B 1FH5L 3GK8H 3PDDA 5J6GA 3LDBC 1U8HB 2Z8RA 4F15B 5EBMA 2DOCA 5C8JA 1KENL 3SBWC 2F8XC 5HHOE 4HXBH 4I77H 3SJVA 1IAKA 4I2XA 4ZFFA 3THML 4M7ZB 1CFBA 5DC9B 3PWNB 4OCNC 5E99H 2JTDA 3LAFA 4X5WB 1FJ1A 4OSUL 1UH3A 4I3GA 4ZSOA 4GAFB 1JCKA 3CSBA 4S1DD 3SPVB 3H7BA 2A73A 4YHPB 43CAB 2AEPL 1WITA 3HB3D 3KPQA 4TSCH 2QQNH 2A6KA 2R29H 1W0WB 1EJOH 3CLFL 3ZSSA 3ME0A 3WLWC 5CJOL 2GEEA 4M7LT 5HGBA 3X11B 4KQ3L 5E9DA 5AAWA 1J10A 3DTXB 3ELAT 4HLZG 4R2GC 4HWZB 1YDPA 5DRWA 5LGHH 4YC2B 1QKZL 1GGYA 1QFWL 3CZFB 5IQ7L 1ERNA 5BS0E 4OZIF 4JFQB 5CLTA 4QRRB 1FZOB 4R6UA 2PXYA 3VD5A 4L4VA 1YJDC 3LN4B 1YJDH 4KI5F 4XRCB 5I66B 4B7LA 4BH7A 3VGEA 1OCWL 3RX7A 5TFSL 3GGWB 4X6BA 3SDDB 2V17H 1RHFA 1DLFL 2O5XH 2FYYA 3R8BB 1OSPL 1YEDA 3GI9L 2UWEE 4IIQA 2X4SA 5DD5L 4G9DA 5CCKH 3MRBA 1K8DB 4NPYA 2VUYA 4BFBD 3TWCL 4XVJL 4YHML 4KK6D 4JKKA 3U9PL 5KSBF 1XCTA 3Q1SH 5TH2B 5JLZA 2E27L 2DQDL 5DQDH 1KJMB 4Q97A 2R2EA 5HBBA 3BZFA 4PRAB 1QFHA 5D2NE 4LCWE 3N1MC 3MODH 3U9UB 1PX4A 3V9FA 1LDSA 3QUYB 4CU6A 1WTGT 2UUDH 3RY6A 4U1SB 1EAPB 4OZIB 3ZDZF 3D25A 3ARFD 1JUFA 1TQCC 3HI5H 4ZG1A 5GGUB 5FB8B 1TPXC 4ONFL 3TBTA 3PXHA 3K8LA 4MXQC 1KTDB 4UDTA 4CVXB 8CGTA 5CLWA 4PJIF 1BJ1J 3JXAA 1DUZA 1HQRB 3RL2B 4ODUA 2WBJD 1YZZA 4L4JA 5DO2D 4LVNC 4LLQA 2H9GB 1TFHA 1WFNA 2N1KA 1R24B 2FJGB 3MLTA 2OL3A 4I9WE 1OP5H 2NY7L 1Z0NA 5KSBB 3MNVA 3ESUF 1S9XB 1V3LA 5I1HH 3IFLH 4F7CA 3RTQC 2V5MA 3HZVA 4NNPL 1TVDA 4K94C 4BQ8A 3TV3H 3GBNH 4QCIA 4BSVA 4CNIB 4K94H 2A0LC 2FZ3A 2RGSA 2BMKA 4J3UA 4MHHG 2JJWA 2LFGA 1D9KC 1QPPA 3PHOA 1HEZA 2Y07H 3FTGA 1KTKE 3SGKA 4JB9L 2QSCL 1G0DA 4O5LL 3D48R 2BVUA 2OXGA 5LGJA 3MRDA 1LK3L 1H3PH 1AFVL 3BUYA 1T04B 1A2YB 3CU1A 4GBXD 4M61A 4XHQA 3QEGH 2DLIA 1E28B 4Y5XA 2ITCB 2AV1A 3MXVH 2MJWA 2NR6C 3GRWL 3ULVD 4PJIB 3EYOA 1I9JH 2YD5A 5ADOL 4ZFGL 3EDDA 3IFOA 3KNBB 2WUCL 4B50A 3BEVA 1MHHA 3PJSA 4X9IA 3RAJL 5GQBA 5IMMA 1VERA 3VRIB 2XG4A 4RMVA 5IB1A 2FO4B 3CMGA 2FNBA 4LGRB 5IMLA 1T1ZA 2ICCA 3O0RH 4NHCL 5CHNB 3QDJA 5F6IB 1FN4A 3QHFH 3ARGB 4XBEL 1T89A 4HD9A 5C0JA 4GRMA 4OZFA 3D3VD 3RWGA 4HH8A 3IDYC 2VDKL 4RGMC 1AP2A 4BUGA 5DD0H 5BW7A 1IC7H 4HDIB 3UZVB 5I75C 4K9EL 3SDAB 4LMQE 4HJ0D 1D6EA 3HMWH 4HCRH 4EI5A 1NEZB 2NY6D 1JV5A 2F15A 5MEQA 2D03L 3QNYB 3RIAF 4IS6B 2BERA 4B5EA 4NBXB 4WI7A 3X3FH 1YNTB 5J6HA 2X70A 3IDIB 3CPLA 2VDRL 2DM7A 3QIBC 3ZKMC 1NGZB 3ALWA 4D9LL 4JRYD 4Y4KA 2KZWA 3WKMH 4NFBA 4EIGB 4APQA 5HHQA 4Z95H 3OAZK 4LSVH 3B6SB 3SJVE 2NY1D 3NPSC 3CX5K 4QHLB 5C3TA 4CADA 4I2XE 3TBWB 4JLRA 5HGAA 1R5WA 1QO3A 1NJ9B 2EDEA 3LV3B 3EZ8A 1MRDL 3TNNA 2HYMA 3DMMC 3E8UL 1RD6A 1B3JA 3QCVH 1I7ZA 4OCRL 1N6QH 4YO0A 4CU7A 1CT8B 4RX4A 4ZSOE 3UAJC 1V7ML 3G6DH 4PJ5D 2CLZA 5JQ6H 4PJDA 4QXWA 1KELH 5DLML 4G7YL 1HH6B 4HQQL 1ORQA 3K4ZA 4S1RH 4TQEH 5FGBC 5EULV 1CDYA 3O2WL 3LPFA 1CICC 3I6LE 1PYWA 3EJJX 1KG0B 3BGFC 2GHWB 3L7FB 4XTRD 5I1AA 4FQ2H 5F70A 1N0LA 1AXSA 3HI6H 5E9DE 1AQDA 5TQ0H 3ARED 3X12A 5J9PB 1YEHH 3O6FC 2PETA 3HZYA 1W72B 3GJFH 4R7DA 2ZUYA 3C87A 2D7OA 1S7SB 2ZWLT 3F5WA 4K3GA 4U1IA 3K3QA 3KLHC 1P84J 1QRKA 4MNQB 2PYED 3NCJL 1LP9F 5BVJB 5SX5K 3T04D 4L4VE 3DI3B 2CMRL 1I4FB 3DUUA 1JK8B 4A6YH 3ZHLA 2X40A 1UJTA 3DETC 4ZUSB 1MFAH 4J6RL 3WFHB 1PY4A 4PBWD 3BUTA 1DE4A 4HFUL 4JFEA 1IAIM 1MRFL 2IC2A 5LWYH 1B4JH 4CJ0A 3CVIL 5L8JB 1ZTXL 4OGZA 4OLXH 1C8PA 2P7TB 3MUGA 3VFWB 4MJ5A 4RGNE 4BZYA 4MDIA 4M00A 4XC1H 1V7NH 1N5YH 3P30L 1H5BB 4LNRA 5EZJA 4ZXBC 2DQHL 3VI3F 1H9VA 3ZZ1A 3KYOA 3ULUE 1TCRA 5FYJL 3AAZA 4OD3H 4PRPA 1XF2A 2Z93A 5CEZE 4UIKL 3DXAD 3EJYD 2AQ3A 2X9XA 1H15B 4HIHB 2LAGB 3ES6A 3MQIA 2OTUA 5T3XL 3BD4A 4JFXB 2H32A 4QTIH 4HC1A 1LEKA 1BOGB 1VGKB 4JE4B 3ZYOA 3S37X 3QRGH 3JV4B 1I8MA 4PB0L 4AIOA 1LP9B 4X6FB 4O2FA 1HILB 2KKQA 4J8RB 2CO7B 3WLWD 2C4FT 3VCLB 4DGYH 4K23H 1OAKH 2AS5M 3CDGB 2JB6A 1XGQA 4R2GD 5D8JH 2DMKA 1NDGA 1DQLH 3T4AB 2VLJB 5J57B 1JE6A 1EEZB 1T7WA 1OARH 1WISA 1M05A 4G6KL 1WZKA 2B20A 3AM8C 1CFQA 5KSVB 2GTZB 1OTUC 3QDGB 1HYRC 3MRLA 1AC0A 4YZFF 2BY1A 2FECI 3LIZL 4UT6H 4HS3A 2Q7YA 2P48B 2WBJA 2J6EA 2N7AA 3H42H 3ALXA 4UT7H 3I3EA 1AGBB 4Z76B 3L3KB 2C3XA 2CH8A 4PJ7F 3C8KB 4NP4L 2H1PH 3CDFA 5FM5O 2NX5B 3D69B 1NBYA 5JHDA 4P5MB 4P2YA 3QCUH 5FUOL 2HT3C 3MGOB 4S0TD 4FS0A 4R4FL 3B4NA 5GGTL 3RWCB 3W9DA 5A2LH 5C09A 5IW1B 1LO0L 3GM8A 1FE8H 3MJ9L 2DL2A 1XR9B 3OXRB 1LO5B 1GRWA 4ZFOB 2C3VA 1A6WH 3QIUC 4KMTL 4MXQD 1BM3L 3QDJE 4HIJB 4BFEA 3CK0H 4Y1AD 3IFNH 5F21B 3QXVA 3RGVC 4YFEA 5DHYB 4ZTOL 4LPCA 2Y9RT 3MJ6A 3D39B 3B2VH 5CEXB 4DUWA 4NT6B 4FNLL 3SKNB 4JJ5A 4X5LA 3VD7A 3BESR 4PJ7B 1U3HC 1NH6A 4OQTL 3WN5B 2R0KL 4LLWB 3FB7A 3H3PL 1UQSA 3BPCB 3WD5H 4NZDA 3ZE2F 2A0LD 2BOCB 4F7TB 1HHJA 1EHLL 3DYOA 2AP2A 3OR7A 1D9KD 2UYLA 4ZTPL 4AEHL 4HUKB 2AW2A 4DK6A 5IJKA 2CKBA 1IKNC 3MRIB 1HSBA 1XGYL 5EG6C 2YPLD 3KYMA 3D3VA 1G7QB 3F7RA 5IR1A 2BSRB 4PRNA 5INDA 3UO1L 3S37L 1IEAA 3NACH 2NR6D 2YUZA 4L1HA 3H8NA 1A14L 1HHIB 2EECA 2DN7A 2B0SH 3RWJB 3V7AE 2X4RB 5SWQB 2DWDA 1IQWL 4G7VL 1GGCH 3U30C 3SDCC 3JWDC 5LBSL 3JWDH 2HJKA 1FYHB 5HGHB 4WIQA 4X0KB 1EO7A 4HK0B 3O9WC 1DBKL 1XF4A 4PJDE 3ROOB 3GBMH 3WIFA 3U2SB 4RAUB 4XC3L 3BDBA 1VFBB 3WIIL 4LLVA 3L3HA 4QXTB 1RQ5A 4MAYA 4JDZA 4YX2H 4UV7H 1MFDH 4OZ4A 1SJHA 5D71H 5K9KB 2ADFL 3PGFH 2VLMD 2WUBH 3X3GL 1MPAL 2V7NA 3ZLQC 1I3RB 2X6MA 4E42A 1XGUA 4G80B 5ECJE 5F7FA 4XCEB 2QQKL 2O5ZH 5EUOF 1JZ5A 4FTVA 4GXVH 5CBAB 2VUOA 1ZHLA 5GISL 4H20L 2P8LA 5ITBL 1SHMA 1ZV5A 4ZYKB 3T77B 4TUOB 2YD3A 5IFHH 3QIBD 1L0QA 5IHBA 4JFEE 3NABH 1I8IB 1QBMH 4YDIL 3C2AL 2IWGA 2DM4A 4HZLA 3KPMA 4LDLB 1JWMA 3L6FA 4JFFB 4ORZC 3RWHA 4Q9CA 1WTLA 1W72L 2QKIB 1RV6X 3DMMD 3MCKB 4C56B 4E41B 4HUXB 1DANT 4XP6L 2X4NA 3IVKA 2PYEA 1KCUH 5DRNA 2FWOB 4HHAA 4PRPE 4XVSL 4X4XB 5H35B 2EC8A 5MI0B 1FO0H 5EN2B 3UAJD 3DSFH 1BVKB 3PWVB 5T5FH 4RFNC 4YDKH 5EUOB 1RMFL 5C6TH 1OSZB 5ISZD 4HEME 1IMHC 1JNJA 4HUMB 3GSQB 4UQ2A 1T22B 4G43A 1CICD 1DDHA 3H3BC 3IJYB 4QRSA 1Q9LA 2OK0L 1UA6L 1IM9D 3UCRA 3PXJA 2CK2A 4PJ8A 3VD3A 1DEEA 1DBBL 3KWWA 3O6FD 3DRTA 3F58L 2YRZA 2W9EL 4PRDB 5E6ZA 1RI8A 1UM6L 3UZEA 4L8CA 3KLHD 4J1UB 5D4QA 3KS0H 4F9LA 1MQKL 3H6JA 1BZ7B 1LO2L 4OBRA 1OAZH 5GRVK 5L2KD 3SKJH 1J86A 1FC2D 2B5IC 1PY9A 4KY1L 4UUJA 4HKZA 3DETD 3ZDXE 4QF1A 2ZCKL 4I8DA 1LGVA 3BPLC 3RPIB 3QUML 2COQA 4KVNH 4IRZL 4KGLA 5DJAA 1OGTB 4O51B 2J12B 3NMEA 3BRFA 5B21A 1HDMB 5KVEH 2BC4B 3SDXF 5C0RL 4H1LH 5GSRA 3MRQB 1IEBB 3ILPB 4ZXBD 3TT1H 3DX9B 3S4SA 4CBPA 2VWEC 5JHDE 5C0GA 4UI2A 2APWA 4LU5L 2R1YA 3TBVA 4PRIA 1JYXA 1YMMA 5C09E 3E6HB 4XBGB 1JYNA 1QR1B 5GGVH 4X7TB 1C7TA 2IPUK 3V5KA 43C9B 1L6ZA 2IANA 3NCMA 4I1NB 5TQ2L 3E6FA 4GAYA 2NY4C 4NHUA 1D5XA 1G7JB 3GSWA 1UFUA 4PY8J 1AIFB 5ERWA 4H0GA 1S9YA 1H3UA 1K8IA 3EBAA 2H3NA 4CVWA 2V5RA 5JO5A 2IMMA 1RZ8A 3LHPH 2X1WL 2NZ9C 1UACL 3QWOA 4JAMA 3SDXB 2VLKB 5F7MC 1IAIL 1RULH 4UZGA 1TJGH 2FL5B 3ZL4H 2B1AL 5JW4R 3QEQD 3LRSB 3TP4A 4FQHA 1KPRB 2VIRA 3BPNB 4WI6A 1OTUD 2GY5A 4WFED 1AHWB 2DQEH 4NO0D 2EH8H 5J89A 4F33A 1MI5A 2NYYC 1OAQL 4WU7A 4UOW0 4OT1H 3OAUH 2BFVL 3O8XA 4OLUL 3K74B 2HFGH 5AZEH 4URTB 4LRNH 2WMPA 1MCWW 4YDJB 3SE8L 2Q86A 2GW5A 4JY4A 3FQRB 1WT5C 1SY6L 4N8VA 2HT3D 3SDYL 1BD2B 2PTTB 5EWIL 1YC7A 2BOBA 2DIJA 3L95A 3QIWC 4OCYL 3MGAA 3U36A 4QXUL 1I3UA 3U0PA 3BKCL 1KULA 3P4LA 2NXYC 3MXWH 2BNUB 2YC1B 1TXKA 3QXDA 3KXFA 2DJSA 4PV8A 1BIIA 4MA8H 2J5LB 2YPLA 4LFHD 1XIWB 1DUYA 1WC7B 3IAGC 3DHMA 2XOTA 2HVJB 3RGVD 3GHBH 4OGXH 2XI9A 3R0NA 4PBVC 3FRUA 3U79A 4XGZA 4M4PA 1RUPL 2NQCA 5ACMA 1U0QA 5FA4B 1QSVA 4X4YA 1ZEAH 1VPOH 4FTVE 4WI5A 4XP5L 4OIIH 5KSAC 5C0ND 3C2SA 4U0RC 4ALAL 4J3OC 4NN6C 4IJ3C 3RIFF 3L5HA 1CDUA 5GGRB 4WGWB 4L1DA 3X14B 5F7UA 5AZ2H 3D0LA 2QADB 3BAEL 2NTSP 1AQKH 4H88H 3CVHH 5FKAA 1ZT7B 3VWKB 3LOWA 1CU4H 5EIIB 4KVCH 5I9QB 12E8L 5I8CB 3OXSA 3V0AC 1EFXA 5EBGA 3T65B 1T83C 1VENA 1BJ1H 4Q0XL 3BOVA 3GMMB 1A7PH 1N64H 1C08B 4XH2A 3WJLA 1R5IA 1T1WB 1JF5A 4PGJA 2ZKHH 3SDCD 1MAMH 3ARVA 4OF3A 5EU6D 4RNRB 4TUKH 5C0CD 1PVHA 2BVQA 3UTQA 3O9WD 3L7EB 4EDWL 5F96L 4Y5YC 5GGQL 4OZGE 1WIUA 1WWWX 5D70L 3VFNB 5E00B 1RFDH 5T1MA 3BZDA 2NY2C 4N90D 5DYOA 3DMMA 3TIDA 3TJHC 2D2OA 4UILL 3VI4E 4NRXB 5HPMB 4CVZB 4XNUH 1SYVB 4PJ5B 2RFXB 5F3BA 1PLGH 2BNRD 5EO1B 4XZUA 4XI5C 1WZLA 1MCRA 4NO2B 4PTTB 1GGUA 5A2JH 5HYSB 1PSKL 3MRJA 1AGEB 4MLSA 1IM9A 5HDQH 3MMEB 2WP3O 4GKNB 1IAOB 3H0TB 1ND0B 5I15H 5J56B 4LSQH 1KJVB 3S34L 1U58B 1P4BL 4KI1A 1AXIB 5M94B 1KJ2B 3MV9A 4H26A 1CTNA 5E2WL 5FM8A 1T3FB 1FHGA 4RZCA 5TPWL 1BOYA 1KIRA 1ZMYA 3EO9L 3ZYJA 1TNNA 4Z7QE 5I18L 5ETUB 3U4BL 1ZT4A 3CFEA 3IRPX 4GMSL 4EN3C 5IFJA 2YUXA 1P4LA 4L3AA 4ZUTB 3UDWC 1EPFA 1CXFA 3NZHH 3PNWB 1BBJA 1XGPB 4PRIE 2GSIB 5C0IA 2XQYG 3X17A 5F9JA 1YMME 3UPRA 2CLVA 3ZE1E 4GKZB 2C1PB 1RZKC 3LKQA 4PR5B 2WIMA 4AK1A 1RZKH 2HWZH 1BFVL 2IANE 1AKJA 1CF8H 3W0WB 1FNSH 1AGCA 2G9HA 2RIKA 4QHNA 4WVRA 5DFWH 2I60H 2GSGB 3QUXB 3TF7C 4WU5B 5I1KL 1IGTB 4P2QA 1B6UA 4OB5L 3FN9A 3OV6A 1JPFA 3BZ4B 2NW2A 5IBTH 1GGIH 5BCAA 1J0IA 1IVLA 2MTPA 5I17B 3EGSA 1M7DA 3KJ6L 2NXZC 5SWSD 3NCFB 3HNVH 1A4KB 3QFJA 3QNZB 1C5DB 1J88A 1F97A 4YAQB 5M7QA 5INCA 2J3SA 2Y23A 5KVGH 3FO2B 3MLXL 4DAGH 2DIBA 3P0YH 1MJ7L 4QRUB 1RIUH 3VWJB 5JUEH 1KEML 2VXSH 5BQ7A 1MI5E 3EYVB 4EVNA 1RJYA 2BRQA 1WBZA 3P9MA 2ARJA 3ZMRA 2MSPA 3GUTB 3OR6A 1JHTB 4LKXA 2UZIH 3B5HA 4JDVB 3VGAC 4L3CB 4HW6A 1T66C 1CD1B 5T1KD 1FDLH 4KTDH 4PV9B 2VR5A 3NTCL 4YQXL 2Z8SA 4L9LB 3KXFE 3OJDA 1JGLH 1KJ3L 3VFTB 5HYJA 1WLHA 2YPLE 4BELD 3Q3GA 1DBML 1HZHH 4XT1C 2NY4D 4PGCB 1RVFL 5SX4I 3ARDC 1QLEH 3I85A 5GGSA 4R4BB 2NW3B 1I8KB 3VXRD 3IDNA 4PS4H 1AR1D 2AABL 3G9AB 3HI1B 2EDXA 2R23B 1NGWA 4Z6AT 2NZ9D 4V1DD 2WQRA 4P9ML 1FL5A 2R0LH 4HUUB 2PCPB 4YWGL 1WZ1H 3FN0H 2A6DA 4ORGA 3IGAA 4RISL 2A6JA 5IW6B 2EIZB 1A6UL 5IHUH 3MRRA 4RBPH 4Y1AB 4O9HH 4YHNA 5FK9B 3TCLA 3WDIA 4H25B 2EXYC 5ALCH 5BV7C 1F13A 3GM0A 1G9NC 4XAWH 5JIHA 1G9NH 2YA0A 1NCBL 3KJ4C 3LQMA 4P3CL 5TDOB 1EHAA 2W65A 4NKOB 1KT2A 4YHZH 5C2UB 4ZO7A 3JV0A 1NC4B 5E8DH 4YR6A 4X99A 3RTQB 4XBPB 5EZOL 4OI9A 3QIWD 4UMGA 3CZJA 4WCYH 5J12B 3O11A 3FONB 3RWIA 4MB4A 1MAKA 1N59B 3AS1A 3CCHA 2JCCF 3V52H 3CLEL 1DLHB 4F7PA 1ZLUH 2W1NA 3MLVH 5D1ZA 5KVFL 1YA5A 2NXYD 3FQXB 4MA7H 3FFCD 1FNHA 1GC1C 3C5SA 3MUJA 4KUZH 4KROC 1D5ZA 1GC1H 3T8XB 2RB8A 3U4EA 4TSBL 4K2UH 3SEPA 5AD0A 4HF5L 1OAXH 3KHOA 4PLNC 2A9NH 3P4OA 3AB0B 4K3DH 4M6OH 2DMCA 5I1CL 3DV4A 4EI6B 2OLDA 3K4DA 5CWSA 1TETH 1IBGL 1JN6B 3P77A 2LAAA 5D7JB 5DD6B 3NVQA 1AD0B 4UTAL 1FZKA 3S35X 1T7VA 1E4WH 1F6AB 2QV2A 3RDTB 5C0CA 2X1QA 4ODVH 5KSAD 4OKVB 4GW1A 4TVPL 4YFDB 4U0QB 5GXBB 2ATKA 5KOVC 2ED7A 2IMNA 3CXHK 3QUZD 3HG1E 3DGGA 3OB0K 1RJLB 5IESL 1J1PL 1WBYB 5HHMB 2JCCB 3GIVA 6CGTA 3ECBB 3IDYB 3MRFA 4RGMB 4XNXH 1X7QB 2NTFA 3VG9B 1MVUB 3GSXB 2VLLB 1PW3A 4Z7VA 4NZTL 3S3JA 3WUWA 2APXA 2H8PA 3MV9E 3HNSL 3SOBH 2AEQL 4YNYB 4OGAC 5TF1H 5C7XL 1VKXB 4KZEH 3BGMA 3HMXA 3QG7H 1U8OA 3L3IA 4XPBH 3U7YL 1L4IA 4GRLC 4M6MH 2GAZB 2VO5A 5LCVL 5IB4A 1LE9A 3VJ6A 3LD8B 1NBVH 2CIKB 15C8H 2EC9U 2ZUUA 1J0YA 3FMGH 1JF6A 4HG4K 1S5HB 2IAMD 2IQAB 3OKEB 4FZ8H 4OD2B 4P59H 5F7DA 3QJFB 2VZSA 5TDNA 5ESVB 2VDMH 4L8DB 4M7LH 1EXUB 1JMZA 3MA9L 4PJAE 5HHOB 3TJHD 1MAJA 1KJ2L 3PHSA 4P2QE 4N0FB 1ZLWK 2BVTA 3HC0B 2CXGA 2W0FA 3Q6GL 4MGXA 1S7QB 4JKPL 4LHQB 2F5AL 1BAFH 1MIEH 1FO0A 5ALBH 2RCSH 4K8RL 1JZ4A 3OKDA 5KS9A 1U8NB 1FVEB 4Y19A 5E6IB 4BM7A 1DSFH 3DRQA 2YR3A 4XI5D 3VXPB 3GSUA 3AGVA 3S96B 3QFJE 1N4XH 4NQVB 1FLRL 1X4YA 4PD4J 4N0YH 1Q72L 4GSDH 4OJFL 1CBVL 2Z91B 4AEIL 3DYPA 4ODHL 4MD4B 3MA7B 1CVSC 1KPUA 3RKDC 1AD9A 4MQXC 2BCKB 2MCPL 2QR0A 1KCKA 2AJUL 5CJXC 2LTQB 1EMTH 2YD4A 4LCIL 1E6JH 1MHEB 1BECA 1Z9LA 4OLVH 1CD9B 3RGHA 2DQUH 3ZT5A 4EN3D 4XNMA 3TIEA 4J3TA 5IQ9B 3PIQB 3VGDA 2EH7H 4A6YB 5BS0B 1MFEL 2V9TA 4NN7C 1MRCH 1PG7H 3BO8B 3C6SA 1MFCL 5BZWA 4WFEE 1P7QB 4OF8A 4FXGA 1BQSA 4PPTA 1OF2A 4UBDC 1XGRA 3BYYA 5FKPA 5JW3L 5HYJE 3MRGA 2AGJL 5FF6A 4KK9C 1KN4H 1WWAX 3I50L 2VDLL 4MNHA 3VFRB 3S35L 3NFSL 4ETQA 3C08H 4KHXH 2G60H 2XY2A 1GOFA 1TVHB 4L3ED 4ZXBB 2ZSWB 3V6OA 3DI2B 4P46C 4NKDB 4P4RB 1HHKB 1V3MA 1FAKT 4C83A 2IH1B 3F65A 1YJDL 2BVEA 2I5YH 3PL6A 4LHUD 2NXZD 2V2XB 4TULH 4OFVA 1OGAA 1A1OB 3R06A 4WHTB 4JO2L 5JPNA 4OZFG 5ABDE 4WFFD 3M17B 4MSWB 5F1SA 1KIQA 4Y8DC 1U91B 2DWEA 3LZFL 1OB1A 3G6JF 4JPIA 5GSVA 1CG9A 2FJFB 4KKAC 3QDAA 3ZHDA 1XF5B 5JOFB 2UY7A 5C08A 1R3KB 1BZ9A 4XNQA 4MAUL 3MV8D 2OZ4H 2VQTA 4V1DA 3U48A 5EO0B 1LNUA 2ZOLB 2E9JA 3LN5A 1J9CT 5FO9A 5F1IA 4I3RH 3LKNB 5FDYA 4RAVA 1T66D 1Y6KR 4Y2DA 5K9OA 2HVKA 3HC4L 5AWNH 5EA0H 3U7AA 1HH9B 1M7IA 4M7KL 3T1FB 1FV1B 2XT1B 2BRRL 4RCAA 3V7AG 4AL8H 3GI8L 5ID1B 3WJJA 1CE6B 2GUOB 3G6JB 5DJZB 3U82B 2QBWA 3O4OB 2E6QA 5CMAB 5EC2A 3QJHB 4CKVX 1P5UA 3OKLB 1WT5A 1LEIA 3MLRL 5GS2H 1KPVB 3BZEA 1FAIH 3ZT6A 2IADA 5IK3A 3E3QE 1ORSB 1UVQA 4ZAKD 5I19H 2KQMA 4D2NA 2X2YA 3QIUB 4GLRH 3W9EA 1DBAH 2P43B 4WV1B 3JV6B 2NLJB 3OAZH 1HK6A 2IH3A 4P2OA 1U3YA 3U0WL 1G7IB 1RZIB 5DHVH 3QULA 1K85A 1TNMA 2EXYD 1CN4A 2G2RA 5J0BA 3IDMA 3GJEB 3QXUA 4U49A 4Z7VE 2YN5A 2CDGB 1YQ2A 1CLYL 2Q3AA 4P49A 4NO3A 4UTBH 2P8PA 1U3HB 5DD1H 4AEFA 4Z5RB 2EYRB 4BSWB 2MWCA 3W11C 3HR5A 2P42B 2FEDD 4D0CA 3QUZA 3QDMD 3TVMA 1MEXL 5IIEA 2BNQD 3CVHA 4OF6A 5ICZA 5AUMB 3MCLL 2X89D 3OG4B 4KROD 4KDWA 1HOCB 5J6GB 1H8NA 1U93A 5D7SH 4PRHD 1IC7L 5EBMB 1Y0LA 5LXGH 1NFIB 2OX5A 2ZG1A 3SJVB 1IAKB 1NSNH 2FGWL 5HVGB 1HQ4A 2VMFA 3NFPB 1RK1B 5KS9E 2DTSA 3O9WB 4Y19E 2AXHA 1NFDF 3CC5B 1P6FA 1QP1A 2M26A 4P2CG 4X98A 1FJ1B 2IAMA 4DFIA 4YGAB 5HI3C 1F6FB 1A3LL 1UWEH 3KYKL 2Q6WA 2VN4A 1TZIA 2OM5A 1I1YB 2D7NA 1HXYB 5ANMA 2XTJC 3GMNA 4ZD3H 4GW4B 3TFKC 1JNLH 3L5IA 2MFNA 4P5TC 3VXMD 2DQCH 4UV4H 4PIRF 1B4RA 3MRMB 2HH0H 2VXQH 5F7LB 2BNRB 1T1XA 5DRWB 2AI0H 4OGAD 2CUIA 3DBXB 3L3JA 3TESA 3ISWA 4GRLD 1E27B 1CFVH 1S9KC 4P57B 4M6NH 3MACH 2OP4H 1KFAL 5GRUH 3V6ZB 4GXUN 1JGDA 4EZMA 4LSSL 2OR9H 2PXYB 3UTPD 4JKMA 3QHTC 3EFFA 3TZVD 1TCMA 3FB6B 2XWTA 1NFDB 2FX8L 3UTTD 2CGRH 1VFUA 4KZDL 1P4IH 3NH7L 2PO6C 4WHDA 4KRMB 4IIQB 4XXCC 3BH9A 4G9DB 3GHEL 4P23C 1RZGA 2IGFH 4MXWL 3V6OE 1B2WH 2F53D 3MRHA 5FO8B 2ZP0T 5FYLH 5DFVC 3TLRA 5C0DB 3O6MH 1EGJA 1UXSB 3DX7A 1TZHB 3BZFB 4MD0B 1E4XL 4R3SB 1D6VL 4NQUA 4A6YL 3I02B 2CK0H 5JOPD 1OGAE 4P4KA 3QUKA 4AQOA 4M48H 2X41A 1OD7A 4NRZA 1KB5L 4HEPG 2RJMA 5FOBA 3D25B 3DURA 1JUFB 1MLCA 1OY3B 4FQLL 1HIMH 4DCQA 1T7YA 5GGSY 3RKDD 4I0PC 5C08E 1HKLL 4MQXD 4NKIL 5D7KD 3U1SL 5GIRA 3HRZA 5FUZL 4UDTB 1CXHA 1HI6B 1UXWA 3MSPA 1N3NA 5C0EA 3FQUA 1K2DA 5DJCA 1HNFA 3KR3L 1CFSA 5L8LB 3CFIC 4V1DE 1ZLSL 5TE7H 4YEEA 4LHUA 3FT2B 2IBBA 3A6CH 4O2CB 4GKSB 4HIEB 1INDH 1Q0XH 1A9EA 3MLTB 4JR9H 4RMTA 5D72H 4KTEH 1A5FH 1IGMH 4EUPA 3MNVB 4NRYA 2EDBA 3BPLB 5L9DL 4WDIA 1IGYB 4QCIB 1J0JA 1HCFX 2OR7A 2A83B 2FZ3B 4UBDD 3GSNB 3MZGB 5SWZD 5JORA 4KK9D 2EEDA 4ZS7H 4H1LB 1FH5H 2IF7A 3RRQA 1M6OA 3ARBC 5FUCE 5ID0A 2XWJA 4A2MA 5LGJB 4P46D 2E7MA 1B0GA 4ELMA 1KENH 4HBQA 4M61B 2R4SL 3BQUC 3OSKA 2D7TH 3VRJB 1F2XK 2GITA 2MQCA 3MPCA 2MQ0A 3THMH 3EYOB 2D7QA 2HRLA 2GCYA 4HPOL 1F3JA 3IFOB 3P0VH 4NUJA 1NAMA 4CN1A 1TJIL 4TRPL 3PHQA 5L8KB 3F8UB 4RIRB 1MHHB 3BI9X 3D9AL 3PJSB 2FBJH 2ZUQC 5IMMB 2ZG3A 4HKBB 4OSUH 1NMCB 3RY4A 3OHXA 1R0AL 5JZ7C 4XB8A 3F7YB 4KKAD 3CJJA 5IB1B 1S3KL 2AEPH 3Q2CA 2BJML 2F54E 1GOHA 4XMPL 1CL7L 1T1ZB 4WHYH 3M07A 4X5XA 3CLFH 4ISVA 5CJOH 4GRMB 4OZFB 2C7UA 4G3YL 5F9WC 5E4EC 4KQ3H 1AP2B 3WO3B 4HUNB 2X4PA 4X4MA 3QI9B 2AEIT 1SYSB 4R4NC 1QKZH 2CDFB 4ZAKA 3U0TA 4QRQA 1K3ZA 4PJDF 5IQ7H 1GGBL 2DJUA 1JV5B 2YN3A 3EKCA 3WL9A 3FQNA 4IHOA 3WHE1 5MEQB 2E8YA 4Q9QL 2X70B 2WWKO 3DROB 3K1KC 1FNFA 4GJTB 4XVUC 4Y4KB 3TBYA 2Z31A 5TFSH 4N8CH 1DLFH 4Y4HB 4APQB 4JRXD 1OSPH 3BJLA 4M5YL 3GI9H 3MGTB 4CADB 5GS2D 5DD5H 4JLRB 1IM3A 1QO3B 5DURD 3QIWB 3TWCH 1QOKA 3VFPA 4MA1C 4XVJH 3TNNB 1KC5L 4YHMH 5FYKU 3ROLA 4AH2B 1F00I 1MIML 3U9PH 1ZSDB 4TPRL 1I7ZB 1DL7H 2R0ZL 2E27H 1WK0A 2DQDH 4YBLB 4Q6IC 2BNQA 4YO0B 4G6AC 3MRNA 4NUGL 1D5BA 3UJIL 2QL1A 5J11C 3PQYB 2ATPA 3EOAA 1K4DA 4PJDB 1I7UB 3T0AA 1YN6B 4QRTA 1ORQB 5ANME 3IU4H 3KPSD 1YPZF 1FFOA 1ZOXA 3MV7A 4WW2A 1WCBA 2GJ6A 3K2MC 4ONFH 1AXSB 4AY0A 1AQDB 2EDYA 3STLA 2C1OA 2IG2L 3HZYB 2E7BA 4R7DB 5I1DB 4GG8A 3GBML 3F5WB 4IJ3B 3WO4C 1RUML 1I9EA 1ZHKA 1K5NA 4TSAL 1S8DA 2ILLA 3CH1A 1DEDA 4LCUA 2YD8A 2NY7H 2FB4L 4CDHA 3OKMB 5JHLL 2MHAA 4ONHB 3S4SG 4GT7A 4KJQD 4NNPH 5L0QC 4QRPD 1FIEA 1OQXA 32C2B 3LY6A 2YXFA 2W91A 3O4LA 3VXMA 4BSJA 3BMVA 5HTSA 5B38A 2VL5B 4JB9H 1UB6A 3IJSB 1A6PA 4O5LH 3C8DA 3B8SA 1YPZB 1J8HA 1MCBA 3RNKA 1LK3H 1U8IA 4LNRB 1AFVH 5DJDB 3UBXA 5EZJB 1I1AC 3G5ZA 3MUZ1 3KYOB 1DQML 3T0EC 3VE0A 3GRWH 4PRPB 3LKPB 1VA9A 2Z93B 3TZVA 3QEUB 5I8OL 3ZDXF 5ADOH 4ZFGH 3ES6B 3EOTL 2OTUB 4LARH 3UTTA 2NY3C 3WFCH 1KGCE 3HZKA 2VDOL 2WUCH 1LEKB 4HIIA 1MELA 2NY2B 3P73A 3RAJH 4FA8A 4XCNA 3TPUA 1Z6JT 3TFKD 2OMNA 4K3EL 2F53A 4YIQA 4WO4D 4P5TD 1S9VB 1AJ7H 4R9HA 3NCEB 2XZCL 2JB6B 1TDQA 4XBEH 2BVYA 4U6XA 1VADA 5JDSB 1NDGB 2VDKH 2J4WL 3MCG1 3N9GL 4POYA 3QQ4A 4NQXA 4K9EC 4LOUC 1TVBA 5CEZL 4K9EH 3SCMC 4OUUA 2F58L 5KTEL 4HPYL 3FO1A 2AK4A 1MREL 3STBA 2D03H 4PP2A 4WW1A 4N8VG 2JK5A 3MRLB 2VDRH 2N56A 1MLBA 4JFZL 4HS3B 4RWHA 2Q7YB 4Y4FB 4EJ1C 5CIPH 4P23D 4D9LH 3MOBL 5J1AA 5FYLD 3LS5L 5DFVD 2Z92A 4ELME 4JFOA 5DC0A 3B8YA 4P48A 5C1MB 1U8PB 4N9GB 5KW9L 3V8OA 5JHDB 1MRDH 2OL3L 3OZ9L 1OWRM 3E8UH 1RZ7L 1UWXK 2DRUA 2MKLC 4OCRH 2VAJA 2QQLL 1U36A 5C09B 4WY7L 2FHBA 1OQOA 1ED3B 3QSKB 3GSNL 3QXTA 4JZNB 2NY0C 5DLMH 3EHBC 4G7YH 4HQQH 4M4RA 4DKDC 4Z0XB 2JIXD 1CR9L 3O2WH 2HAZA 3KPNA 2XRAL 4F15C 1INQA 1EV2E 1X6NA 1ZK9A 4B7IA 4G6ML 2ICES 3S36L 4HLJA 4M7ZC 4X4ME 3MFFA 1U92B 2VZ1A 4Z77B 1URLA 1FFNA 1PKQA 4WWKD 4LVHB 3L9RB 1CGWA 3BX7C 4JVPA 4IOIA 1C7SA 1W0VB 4NNYB 3DLQR 1UT9A 2D3VA 3NCJH 5D7LA 3CDCA 1HHJB 2IALB 3TN0A 2GT9A 4KKLD 4W68A 2CMRH 3MV8B 1U6AL 1UKSA 1ZHBA 2MCG1 2APFA 2DTML 3KVQA 4HULB 4PGBB 2CKBB 4K3JL 4J6RH 1L6XA 4HFUH 1I85A 2D0GA 3KYMB 1MRFH 3NA9L 3QWRA 3CVIH 5IR1B 2DLFL 2AAVA 5INDB 1ZTXH 3BQUD 3VGAB 4L8BA 2VJXA 4YC2C 4K07A 3C5ZC 4GG6F 3P30H 4F2MB 5IB2A 2B2XL 2DQHH 2DWDB 4QOKD 1JP5A 5CEYB 3JUZA 2DQEL 5FYJH 1JZ6A 4JFDD 4KJPC 4UIKH 1XCQA 3WIFB 5LAXA 4FXLA 1XF4B 5HY9A 5T3XH 1QACA 3ARDB 3MZTA 5A2IH 5JZ7D 1PBYA 4F7EB 3D2UA 5BZDA 5JXAL 4PB0H 4JRXA 4WUUA 5C2BL 3TA3A 4UINL 4N0UA 4QHUA 3VU2A 1NGYA 3L3HB 3MV7E 4KDTC 2GJ6E 4MAYB 4JDZB 4TNWK 1BQHB 3QHZL 4PG2C 5DUPH 4OZ4B 1SJHB 1CLZL 3K1DA 3RL1B 4BZ1L 3B5GA 5D1XA 2V7NB 4HKJA 3ET9F 4E42B 2Q8BL 4R4ND 4FTVB 4MA8L 4OZGF 1IC1A 5D7IF 5EFIB 5FHBL 1OPGL 3G9VA 1ZHLB 2VLRD 3SE4C 2ESVE 3BP6B 5BRZD 3HNTL 4GG6B 3QUYC 2PR4L 1JYVA 3K0WA 3O45B 3VXOA 1JHLL 1G6RA 5BV7B 4FFWD 4G6KH 3IS1X 5EU7C 3O4LE 4Y16A 4XVUD 1U8KA 2I9TA 2NPLX 3NCYP 3O2DA 1QSFA 3UMTA 4KI5C 3LIZH 3NZ8B 2QHRL 1JWMB 3QNXA 4G8GD 5C9KA 3RWHB 5D6CA 1J8HE 3CFKA 1RUQL 3UTSD 1MUJA 2X4NB 5DQ9A 4NP4H 4KUCF 1Q94A 4UIMA 1KLUB 4DW2L 3KPRB 4KJYA 1QVOA 3H9SA 5B8CA 4RMSA 4XCCL 5CUSL 4G6AD 4KRPB 5DSCA 4BFIB 1BREA 1UJ3A 3I75A 4R4FH 3WNKA 1GIGL 3MRCA 1H0DA 2XQYK 5C07E 3LQZA 5GGTH 4OZGB 5D7IB 5C6WH 2IQ9L 3HAEA 4AENA 1LO0H 1DDHB 3CFCL 2LU3A 3MJ9H 2H6PB 5EU4A 5MHSE 4KMTH 1DEEB 4PJ9D 3NIGE 1BM3H 5ITFB 4Z7QF 5BO1L 5K9QG 4ZOCA 1E4JA 5EBWA 5JQHC 1YMHA 4ZTOH 1L7TL 4U6YB 2HJLA 1Q9WA 3VXQB 1ZGLP 4L8CB 3WDHA 3PGCA 4YJZL 2W38A 4FNLH 3JTSA 4XX1E 3MLUL 1RFDL 5BJTA 1AE6L 2AK4E 4OQTH 4HKZB 2R0KH 2NY5L 3H3PH 1NGQL 2JB5L 4KK5C 4QF1B 5C0AE 4XPGL 4S10A 4I18A 4WO4A 1EHLH 3I9GL 1G7MB 2ZZUT 1GZPA 2FATL 2Z8WC 5DJAB 4ZTPH 1YC8A 3VXSD 4LSTL 3WBDA 4G6JH 1XGYH 2BHUA 4CUCA 5KN5A 5F7YC 2CUHA 4XVTL 4KV5E 4LCCA 1NANH 2WQ8A 4NKQB 4X80L 3BSZL 4H0HB 4GH7B 4WRLA 4RAHA 2J1KA 2XPGA 3BP4A 3S4SB 3UO1H 4S2SB 1QRNB 3S37H 3T0ED 3ARPA 2M2DA 3SDAC 2VAAB 2ZJSL 4DGIL 4JRWA 1A14H 5C0GB 3A6BL 2WINB 3GBLA 3WE6A 2A6IA 5HDQL 2R1YB 1GZQB 1QSED 2NY3D 3OX8A 3TBVB 4PRIB 1IQWH 3MTRA 4G7VH 2FJHA 1YMMB 5DRXA 5LBSH 1ZVHA 4NIKB 4PFEA 4JQVA 3V5KB 3ZT7A 4PP1C 4F58L 1DBKH 5GS1B 3LKRB 5DJ0A 2IANB 4XXCA 2K7PA 1HCVA 3RZWA 4XC3H 5C0BD 4GAYB 4MJ6A 4YBHA 3CIQA 1D5XB 2HN7A 4NHUB 5HSFA 4JFYB 2J6EL 4FN0A 3GMPA 2HLAA 3K80A 3WIIH 1S9YB 1VDGA 3BMWA 3EYUL 3DVGA 1K8IB 4HBCL 4YHIB 1MCFA 2H3NB 4JO1H 4RRPA 4ZQKA 2XTLA 3X3GH 2X4TA 1A3RL 1QTYT 1MPAH 4ZOAA 3RZCA 1NKOA 4LOUD 3SCMD 2EDHA 2JJTC 5JPMA 1PKQE 2Y6SC 3IB4A 2QQKH 5DMJB 3WMSA 1KYOK 5MENA 5D7LE 3AS3A 4H20H 2VIRB 5ITBH 4NQCD 3JWNC 1UM5L 4NQED 4JHAL 4DKAA 3MOQA 4X7SL 1MI5B 5JW5A 4DTGL 3O8XB 3FT4B 4YDIH 1X5HA 3C2AH 1UZ8A 2XWBA 2O61B 4G9FB 1A47A 3QBTB 3IFPA 3HTLX 5SV3A 4WWKA 1W72H 4JY4B 1I7TB 4N8VB 4XP6H 4IRSA 2BOBB 3L95B 4NSKB 2AQ1A 1YY8A 1INEL 4LK4A 4XVSH 3UPCA 3ULSA 4DKFL 5IW3A 3U0PB 1TQBB 1OAYL 4N5EC 3L3GA 2VISA 3R4DA 3KXFB 4PV8B 2NY0D 1RMFH 3OWEA 3EHBD 3NIDE 3QPXL 4JRXE 4WUUE 4MQ7B 2CKBL 5I8EA 1LO3L 4N0UE 3HPLB 5FGSA 1T5XA 2X4QA 2YD6A 2YZ1A 1UA6H 2E7LC 5HJ3A 4JZOB 1X3DA 1DBBH 3FRUB 4YHKL 4ZFZA 1MNUL 1H5BC 3FN3A 5GRZA 4NWTL 1ZANL 3F58H 2W9EH 2YMXL 2BVPB 1UM6H 1G7PA 2BY2A 3WUWG 4YPGA 2C9AA 3QQNA 4ZOEA 4D94A 4WTZA 1LO2H 1PJ9A 2EZ0C 3D0LB 3SE3C 5TJWK 4KY1H 2ZCKH 4JO3L 1QSFE 3PP4L 5E2TL 3KPPA 3TO4A 3QUMH 1AC6A 2SEBB 3OXSB 4IRZH 3FN0L 4MXVE 3G04A 2EIBA 3G5XB 3MROA 3KDMA 3PP3K 3S5LA 1SMAA 5IKCB 3C5ZD 3PGDA 3OB0H 3EO0A 2PYFA 1IZJA 4XH2B 4QNPE 1R5IB 5BRZA 3H9SE 5FYJD 1JI1A 4NJAL 4YXLL 4KJPD 5T3XD 1S7VB 2VZVA 4ZUVA 1QNZL 5ALCL 3HE7B 3UX9B 4LU5H 5B3JE 5D5MA 3OAYK 1IKFL 3J8F7 4XAWL 5BV7L 1TTUA 2KZ1B 3LH2L 1PKOA 4HLZH 4U3HA 5T1MB 1I8LA 3O3AA 5DYOB 3SO3B 1BQLL 4G8GA 3FO9B 3HC3L 5TQ2H 2PW2A 4WI8A 5CJ8A 2OMBA 1OTTC 4I5BA 1VFAA 3UTSA 1AGDA 3BWAA 4U1MA 5CILL 5DXWA 5I6XC 5BOZG 2H2SC 4IM8A 3GFUA 1UACH 1KIUA 1KIPA 1IAIH 3QUYD 4EQ2A 5E94A 3PG2A 4JVUA 1MY5A 3HG1B 3MRJB 2B1AH 3KPSB 5DEFA 4PJXA 1ZLWH 2QSTA 4NQDA 4PJAF 4PJCF 1ZKAA 4ELKA 1TETL 4BH8A 4PJ9A 2JJSC 4KI5D 2ARJQ 2Y7QB 1JGEA 4X4ZA 5IB3A 1OAQH 2ZOKB 2BFVH 4OLUH 3MV9B 4H26B 2MKWA 2G75A 3WFZA 4NDMA 2ZCHL 4RZCB 1KIRB 4YXKL 3D85B 4I4WA 4M93B 4LKCA 4FOMA 3CFEB 5IMKA 5IFJB 2QTEA 1P4LB 4R8WL 5IEHA 1SY6H 1Z2KA 3WEXB 4PLJC 4QRPB 5DK3A 1BBJB 3WN5C 5EWIH 3WIHA 4OCYH 1KXVC 2BDNL 5C0IB 4QXUH 1J05A 3UPRB 5F8RC 2C3WA 5TGBA 4G8FB 3P2TA 3BKCH 5ICXA 1JPSL 4D0DB 4NCC1 2J2ZA 1AGCB 4XWGL 4QHNB 5F6HJ 4S1QL 1ZGLB 1DQDL 4PJAB 5C9JB 4PJCB 1N0XL 3O3BB 1JPFB 2NW2B 3MREB 5EZLA 2FH8A 4EDXA 1KBGL 1BQUA 4DUXA 2PN5A 4OTXL 1OW0A 1RUPH 1M7DB 2DYPA 3B3IA 3VGHA 3FOMA 1NFKA 1Y6NR 2XTJB 3QA3A 3QFJB 4XP5H 5MENE 4LRIA 4ALAH 1GVIA 4KK5D 5INCB 3B9KA 4D3CL 5L6YL 4O58L 3VDAA 3BAEH 4U4BA 1ZLVH 3DO7B 1WIPA 2R69L 4HKXB 3VFUB 5HVFB 2CSPA 2YD7A 4MD5A 3ARGD 5FCUL 1ES0A 12E8H 3P9MB 2ARJB 4JZJA 4KQ4H 4NWUL 2ICWB 3OR6B 4Z7NE 1GSMA 3GMQA 4LKXB 3SDAD 1JYWA 2BSED 4X8JA 1MFBL 3JVGA 3NPZB 5D1QB 4KPHL 3D0VB 4RMWA 4NGHL 3BP5A 4LPWA 5F1NA 4Y5VA 1ZA6B 5D6DC 3MNZB 2PO6B 3NAAL 1SVCP 4NQEA 3VXUE 3PABB 3REWA 4PP1D 1FL3A 3T2QA 4WTXA 4EDWH 5JA8B 5CIPA 5F96H 5J13C 1ZHNB 3B5TA 5HYJB 4U3XA 5AG8A 5D70H 1TITA 3IJHA 1OWWA 1DQQB 1S7RA 4Q7DA 1QLFA 3W39B 5JDJA 5JNYB 3GB7B 1Z3GL 1MRCL 4WI9A 1RK0B 1N7MH 3F62A 4UILH 3VFSB 1RURL 2UV3A 1NGWB 1C1EL 1JRHL 4KGJA 1FL5B 2Y6SD 5IT2L 5MI0C 2A6DB 2VITA 5DR5L 3IGAB 1UKTA 4PLKC 4I0PB 4AIZB 3C08L 1NCAL 4JHWL 4KHXL 2X7LA 3MUY1 4P3WA 2Y06L 4PY7A 1PSKH 3TCLB 1T1YA 5FCSH 3GMLB 3MRKA 5ACZA 4HX1B 2H26B 2I5YL 4CJ1A 1DTUA 3FOLB 4U1LA 3S34H 1KT2B 1P4BH 1S7WB 3FHQA 5I30L 4X99B 1BMGA 6FABL 3FB5B 5E2WH 4X5WA 5E1AB 5TPWH 5BRZE 4GRWE 3O11B 3RWIB 3EO9H 3SPVA 4MNQD 2P5EA 5I18H 4GMSH 3MJGX 43CAA 4N5ED 4M8QB 1QFOA 1MJJB 3VRLF 5D5ME 5DMYA 1X5YA 3KYAA 3ARBB 1D5ZB 5IVOA 5HGDA 1JWSA 4Z7VF 2VXTL 1BFVH 1VFOA 3P4OB 3DTXA 4HWBA 3P9LA 2HMIC 3UTSE 3DV4B 3CZFA 5JXEC 5I1KH 3NIFE 3CFDA 4L29A 3I6KB 3P77B 1QHPA 4NZRL 5IHLB 4JFQA 4QRRA 1NBZB 3LSOA 1FZOA 2P45B 1NGXB 2FEEI 2Z8VC 1CQKA 1RSFA 3KJ6H 2ATKB 2F5BL 5I66A 2EZ0D 1P9MC 1IC5L 4OCWL 3GGWA 3SDDA 4PJXE 5E95B 1S7XA 3L3OB 4NQDE 4PJEB 1YNLL 1ZVSA 2BY3A 1QBAA 1K8DA 3MLXH 4ENEC 3REVB 4HWEL 1KEMH 3STZB 4LBEB 4Z7VB 4ERSL 1KYOJ 5TH2A 3WUWB 5KS9F 1FPTL 5DUBA 4YHOL 4PRAA 4HS6B 2P47B 4Z18A 1DBAL 3BGMB 1U8OB 3L3IB 2VLJD 4MJIA 3WS3A 4JQXC 1QG3A 5IB4B 1LE9B 4U1SA 2V7HB 2VQ1A 1EO8L 1UB5A 2EEAA 2FHCA 1RIVL 4MCZA 3HZMB 5FB8A 3NTCH 5F7DB 4YQXH 3BPNC 1KCRL 3QDGD 4V2BA 1LWRA 1XF1A 5TDNB 1KTDA 1AHWC 4CVXA 1KJ3H 2VDPL 2N4IA 1KEGL 1DBMH 1HQRA 3RL2A 1RVFH 3QO0B 1JNNL 3BP7B 3GDBA 1X9QA 4H0IA 2FDBP 4P3DB 4Q6IB 1R24A 1U8QB 2FJGA 1YYLL 3RUGA 2FBOJ 3T09A 2NX5D 1VACB 3PDOB 2C4XA 2I9LB 2AABH 1S9XA 5KS9B 1FNGB 2VZTA 1AO7A 2H2SD 2G5BB 4Y19B 3DRQB 3V79C 4P9MH 3QRFM 4R0LC 3GSUB 4YWGH 1FP5A 3TGXA 5HDLA 4HH9A 4P0DA 4LHUG 4RISH 5IWLA 3I6GA 1A6UH 4M7JL 1JFQL 3VFGH 4CMMB 5KJRL 4EUPG 1FCCA 4IMKA 1AD9B 3OF6D 2FHFA 1T04A 1A2YA 3N85L 1FGNL 1E28A 3U6RB 2ITCA 4OF7A 3D39D 4LVOB 1NCBH 4P3CH 2CO6B 4TVSa 4CN6A 5FFLA 1P2CB 4OQTA 5DMKB 4HGWB 5BVPH 3WCYA 1A7RL 4D8PB 5D9SB 4PLJD 5L0QB 5H94B 5EZOH 5IVZA 1OLZA 4HAGA 3VRIA 3PWJB 4XAKD 1V3JA 2FO4A 3CLEH 4BUHA 4FXGB 5KVFH 4DOHE 2QADC 3U46A 1V8HA 1XGRB 1VGEL 3T3PF 1A6ZB 3MRGB 5FF6B 2AI0L 4W6XB 2JELL 2X4UA 3ARGA 4OD1H 4TSBH 3VFOB 3VWKC 4ETQB 5I9QC 4R26L 1I1AB 4HF5H 1RY7B 2APBA 2VH5L 3T0EB 5EPMA 4IRJA 1T7XA 3QG6A 4HDIA 1VB9A 5I1CH 4C83B 4U05A 5F9DC 3ZDYF 2XN9A 1NEZA 4Q58C 1IBGH 3PL6B 5F44A 2P5WB 2R0WL 1OGAB 4IS6A 5FECA 2Y5TA 4TVPH 2DWEB 4XMKL 1OB1B 4JPIB 1NGZA 3MBEA 1YECL 5CP3A 5IESH 2I24N 1FVDB 5C08B 4X9GA 3C6LA 1BZ9B 5CZKA 5DT1L 4QGYA 2R4RL 2ZNXA 1NBQA 3UPAA 5IOPB 4P99A 5M95B 1ADQA 3SCMB 3VDCA 1YEFL 4WUKL 4NZTH 1LNUB 3HNSH 2AEQH 3LN5B 4U31A 5FO9B 4MJ2A 4M5ZL 5MEOA 5C7XH 2DQFA 5EC1A 1CS6A 2P5EE 1HWHB 3U7YH 4NQCB 1QEWA 5LCVH 5DS8B 2HVKB 1DVFC 5F97E 2EDNA 1M7IB 3DPBA 4M1DL 3OGCA 5EU3B 4PGDB 4OV5B 4FXKA 4G8EA 1XGTB 5E2VL 5J9PA 3WS6A 3MBXL 3KLDA 5I1GL 5EC2B 5H37G 3FCTA 2QSVA 3TT3L 4JFFD 3WDJA 5JIPA 1LEIB 1S7SA 5E5RB 1KJ2H 4LGSB 3WNLA 4C56D 4E41D 3Q6GH 5DA4A 3BZEB 3M1BA 4JKPH 2F5AH 4WFHD 4MNQA 3QAZC 4QRRE 3WLBB 5CBEB 2IADB 4K8RC 4L8SC 4K8RH 1ZT1B 4O2EA 5EUKA 5IVXE 4ODTL 1UVQB 4ZS7L 1I4FA 3NA4A 1GHFL 3W9EB 4ZUSA 5IROA 3WFHA 1FLRH 2IH3B 1Q72H 4OJFH 1TJHL 1CBVH 4AEIH 2D7TL 4ODHH 2F54B 4LAQL 1N6VA 2P7TA 3MRPB 3VFWA 3O41A 4BA8A 3Q5OA 3JUYA 3RPKA 1LVEA 1JPST 1EHNA 3QUXC 2MCPH 3P0VL 4XWOC 5A16A 2BSSA 2AJUH 4WEUD 2P8PB 3T0VA 4BYHA 2FBJL 4LCIH 3RVUC 5B38G 1H15A 4HIHA 4MJIE 4JFXA 4D0CB 4JM4L 3VGBA 1BOGA 1VGKA 3TVMB 5E5UB 1ZWIA 1MFEH 1IJ9A 1ZE3C 1FYTA 1LP9A 4X6FA 3BRDA 3UBXG 1HILA 1MFCH 1YUHA 1DP0A 1ONQB 3CSYA 5DUMH 5D2LF 5GRYA 1PQZB 5IF0B 5JW3H 2XQBL 3VWJC 2AGJH 3CDGA 1G1YA 1Y0LB 3I50H 1B9ZA 2VDLH 4QTHB 5T5NF 3T0XA 3C5ZB 2HMID 3S35H 3NFSH 3CU7A 1HQ4B 5JXED 5GJSL 4KXZH 2EDJA 1R6VA 4U1KA 2B8OT 4X6DA 2VR9A 5I8KL 3RUGE 2ORBL 2VLJA 3T4AA 3T08A 3WHXB 4Q9RL 1T6WA 3HMXL 4JEGB 1F5WA 1AO7E 3PWLB 3CDYA 4OQ1A 4FQXA 5GHWL 4BK5A 3JTTA 4IMLA 4AT6A 2Q7NA 1GL4B 4N8CL 4EIZC 4JO2H 5KSVA 2GTZA 3QDGA 1L0YA 1P7HL 3PV6A 4PREB 5F7WC 3OTTA 4L9LC 1QPXA 2AJZA 2UUDK 3LZFH 4P2RA 5ANMB 3ZDZE 5FA3A 4XX1G 5TDPB 4ENED 1DL7L 3L3KA 5D2LB 4FQIL 4MAUH 2NX5A 3D69A 1JVKA 5J8OA 1YYML 4N9OB 3MGOA 3L3JB 2DD8L 3LCYA 4W4NA 2VLKD 1G84A 2DMBA 3IU4L 5IW1A 1JGDB 3EFFB 1OP5K 1PEWA 1XR9A 1HHHA 2XWTB 3OXRA 5L2JA 4ZFOA 3HC4H 4D9QD 4ODXA 1UWGL 3OF6A 4M7KH 1N2RA 1J7VR 2BRRH 1JPTH 2E5EA 3K8KA 5DHYA 3GI8H 3BH9B 4GAJL 3D39A 4RFEA 5CEXA 3A67L 4NT6A 2EXWC 5HGGS 4BZ2L 3NN8A 2EKJA 1BGXL 3SKNA 1BX2A 3WUZA 3MLRH 2XN9E 5JA9A 3DX7B 5LG1A 3P3YA 3WN5A 3H9HB 4XXDA 1BD2D 4E9LA 3BPCA 4P4KB 3P11L 5J12C 1KB9J 2BOCA 4HJGB 3T0WA 4F7TA 3QEHA 5KVDL 4OV6F 3V4PL 4JGUA 5FOBB 3VG0L 3DURB 3MJ7A 4DCQB 4PJFF 3MRIA 5GRVL 2OXHA 1XIWD 4ELMF 3U0WH 1G7QA 3EDKA 5JIIA 4U1GC 3CMOL 3CSGA 1XZ0B 2BSRA 3HRZB 4HT1L 1IGCL 3CFBA 4NYLA 3O3DB 2CRZA 3RVXC 5C0EB 3FQUB 1K2DB 1VEPA 3AB0C 4NM8L 5DJCB 1J1OL 3T4YB 1HHIA 3VXNA 4LARL 3B43A 5MP6H 3SO5A 1CLYH 3WFCL 2X4RA 5SWQA 5I1IL 5D7JC 1LO4L 4OGYL 3F7VA 4EUPB 5HGHA 2Q20A 3RDTC 1I1FB 3ROOA 4OCMC 3UBXI 4OZHF 4OIBA 3ARUA 4WDIB 2WP3T 1JJUA 4O4YL 4GOSA 1AJ7L 1MEXH 3AFLA 2QADD 1U2HA 3WFDL 5JORB 3MCLH 4UNUA 3E1F1 1O5DT 1JTOA 1JF1B 3VWKD 4JFHE 1BVZA 3VH8G 4MCYA 3VG9C 2XWJB 4PJFB 2XA8L 1P7KB 1I3RA 4ELMB 5EB9A 2P44B 4YHYB 2FGWH 1MWAA 1PAMA 2GITB 2VSCA 2GCYB 1KF9B 4GS7C 1RU9L 4NUJB 2LABA 9CGTA 1V3KA 3LD8C 2J8HA 4TUOA 4TVPD 4PJHA 3TYGL 3H2WA 4GFTB 1VEMA 4JO4L 1A3LH 3KYKH 4Y88A 5KOMC 1I8IA 3HUJA 2DDQL 4OZHB 4E0RA 5IMOB 1Y18B 1C16A 1LEGB 3ZE0E 1GYAA 3MCKA 2R2HB 4C56A 4E41A 1ITBB 4ZPVB 3N1FC 3HE6A 2C7UB 4K55A 1HWGB 3UC0L 2FWOA 1ROWA 2X4PB 4X4XA 5K33A 3BVNB 3U0TB 3GJFK 3RWDA 1BVKA 5E6IC 3WL9B 3IDJA 4KKCC 4C59B 1FYTE 1LP9E 4FFZH 1KFAH 5K59E 2EYTA 2VXUH 4LSSH 2J8UA 1H3TA 1QBLL 4N68A 5SX4H 4WW2F 2AKRB 1SBBA 2OCFD 2FX8H 5F1OB 4KZDH 2Z31B 1X44A 5JW4N 3NH7H 3INUL 4Y2OA 5TE4H 3GHEH 2B39A 2X1PA 1IM3B 2LTQC 3HAEG 4MXWH 3VFPB 4X6DE 5CAYB 2VLJE 4RFOL 3ROLB 4J1UA 4K8RD 1J5OL 4KWUA 1LMKA 1E4XH 1D6VH 3MRNB 1IT9L 4RMQA 5IEKA 5DF0A 2ATPB 3EOAB 5KANI 1K4DB 3VA2C 1PZUB 1LD9B 2DQTL 3KHQA 5ICYA 4HS8L 1KB5H 4P2RE 2ADIB 3LEVL 4FABL 3W0WD 4FQLH 5B39A 3ARSA 4YFLI 3MV7B 4OM0L 1HKLH 4WW2B 2GJ6B 4L4TD 4NKIH 3U1SH 3GSVB 1U8LA 3QUXD 5ILTL 4XWOD 5EH1A 5FUZH 3MRQA 2NX5E 3ILPA 1RHHB 1MSPA 1A6AB 3STLB 1CXLA 1M71A 2C1OB 5DDHA 3KR3H 4XP9L 1A1MB 3RVUD 2F74B 4JVWA 1ZLSH 5F93C 5JR1L 2XZQL 3E2HC 1OL0A 3QQ3B 4LIQE 1ZHKB 1K5NB 5D2NC 1S8DB 3CH1B 4LCUB 1QR1A 3MYJB 1RZJL 4ZDHB 5GS0C 2ESVB 5I74B 5GS0H 4G8IA 43C9A 4TNVK 2MHAB 4PBXA 1Q9KA 3QUMB 5EOTA 2P8MB 1RUKL 5L9DH 4Z0BL 2BY0A 5DUPL 2XV6B 3U83A 3K2UL 4Z7OE 3OJMB 5HHPB 3VXTB 3GO1L 2ED8A 3O4LB 1G7JA 3NIGF 4OLZL 3VWJD 5FAAA 3V4VL 4YZFE 1T7ZA 2A77L 1ACZA 4DKEL 3D39E 5F3HA 1UB6B 3SGJA 2XYCA 1JZ2A 3MR9B 4PUBH 4RMUA 1J8HB 3RNKB 4JM2F 2ENSA 2VLKA 3RP1A 2R4SH 5I16A 2XFXB 3ARFA 2E6JA 2FL5A 2DICA 5EZIL 3VE0B 3LRGA 1I9RL 4DWHA 4HPOH 3B83A 5HVHC 1TJIH 4RRPG 1GH7A 4TRPH 2WLYA 1OTSC 4GLRI 5C07B 5CGMA 3B9AA 3D9AH 1F4HA 1NLDL 3AC0A 4XCNB 1R0AH 3OKNA 4JFPA 4LCYB 5C0FA 1U9KA 1S3KH 1HINL 5KG9B 4R96B 2BJMH 3ZO0A 5E7BA 2XNAB 3WFEL 3CAFA 4XMPH 4YDJA 3O4OC 1CL7H 4FZEL 5I6XB 3DYMA 1Z9OA 1G9ML 4U6XB 4PY8I 4OUOA 4UAOB 3VW3L 2D31B 5F72S 1EGJL 4WEBH 4G3YH 2PTTA 2CRYA 3X13A 3QQ4B 4NQXB 5DJ8A 2VKXA 5E8OA 1P6AB 4JM2B 1IGJA 5DJ6B 2BNUA 2YC1A 1IAMA 3O3EB 1GGBH 3FO1B 2AK4B 1T5WA 3DX8B 4J4PC 3W82A 1F11A 4AMKL 4QT5A 4WV1C 1XIWA 3ZE2E 4WW1B 4Q9QH 1WC7A 5C0AB 2JK5B 4GBXA 2FLBT 5J1TC 1Z5LA 1KSRA 1JTTA 3WV0A 2OSLA 1JIBA 5C70A 4DGVL 5J1AB 3SKMB 2HFTA 3KYNB 3C09B 4ZO9A 4JPKH 4JFOB 1MF2L 4M5YH 2EDLA 2HKFL 5I1EL 4WFGD 2V6HA 1NC4D 3RTQD 4IOFC 5F7EL 1KC5H 1MIMH 5T3ZE 2GIYA 2JJUA 2JJVA 4TPRH 5GGRA 2R0ZH 4D9RD 3UJTL 4KFZC 3KGRA 2C3HA 4PJHE 1S7UA 1A9BA 1VEOA 4NQTA 4NUGH 3UJIH 4KDVA 4G6JL 3HUJE 4QXGL 1MCHA 1S7TA 3TO2A 5KVMC 4FQCL 3LS4L 4M3JA 4WTZG 3KPNB 3RVXD 4C56E 4WFHE 3LKSA 3DGCR 1MCIA 3J7HA 4H8WL 5D7JD 2IG2H 3MFFB 2FSEB 4TOYL 3RDTD 1NAML 4Y8AA 1FFNB 4LAJH 1RUMH 4GQPH 4JRYA 3IU3A 4TSAH 1XF3B 3NIDF 4IOIB 2ADGA 2ICWI 3S5LG 3P0GB 4PG9A 2J8UE 2FB4H 3TN0B 2GT9B 5HHMD 5JHLH 4F9PA 1ZHBB 2O26U 4JO1L 1OAUH 2FX7L 4NRXA 4CVZA 3WSQL 1SYVA 4U3CA 5LVEA 4L8BB 4PJ5A 2RFXA 2ZUWA 5EO1A 2QQQA 4CMHB 4NO2A 1F8TL 4PTTA 5HYSA 1DQMH 1RJZA 2A74A 5J13B 2WK2A 3VH8B 3ZKMD 5I76A 5I8OH 1HNGA 2PXYC 3BH8A 5LAXB 3EOTH 3QZWA 2VDOH 3D2UB 3AREA 3HCVA 3MMEA 3CGTA 1IAOA 3H0TA 4WUUB 4MXVF 2VR4A 3PP3H 1KJVA 2HJFB 2JF1A 4O00A 3TA3B 4N0UB 1NAKL 1KJ2A 4M43L 4IIQC 4PYHA 4UOJA 5ENWB 4K3EH 1G1CA 5HHOD 2ZG2A 4AQ1B 1T3FA 4KHTL 4QNPF 2XZCH 4HKJB 4RGNC 5ETUA 3AMKA 2XICA 3IKCA 4ZUTA 3PNWA 2APTA 5B3JF 3ULUC 2J88L 1BF8A 2J4WH 5DJYB 5E6ID 3N9GH 3HS0B 1F3RB 3UTOA 2C1PA 2WZPD 5CEZH 2OI9C 2OR8A 2X4OA 4QY8A 3VGFA 2F58H 4Z7UA 5KTEH 4HPYH 3SBWA 4J3WA 3RY6C 5TF0A 1CE1L 1G7LB 1PG7X 5IM7B 3VXOB 1G6RB 1CLOL 1MREH 1XR8A 2DM2A 2NMSA 1MCDA 2AJXH 2EKSA 4Y16B 5DRZB 1U8KB 2R56L 5CINL 1MJUL 2I9TB 3IDUA 4WU5A 1IGTA 3RVVC 5IGXL 1QSFB 4ONGL 4FQQA 2XKNA 1BFTA 4JFZH 4LLYB 3QNXB 4LPYA 1PFCA 3MOBH 3DXAA 3S3PA 4OAWB 3P4MB 5I17A 3CFKB 3LS5H 1BVLA 1MUJB 2P1YA 2VLKE 2EDTA 5DQ9B 5FGCE 1T21A 4UIMB 4KJYB 3QNZA 5KW9H 1QVOB 3H9SB 5B8CB 5BS0D 2OL3H 5GRJL 3OZ9H 3PDGA 4YAQA 1RZ7H 1UJ3B 1KUMA 4D9QE 3FO2A 3MRCB 1H0DB 1P7QD 2QQLH 4ZUWB 4LGPB 4CU8A 4WY7H 4JCLA 4OF0A 4AENB 3EYVA 5DMGC 3GSNH 3WNPA 2LVEA 1IGIL 1HXMB 5EU4B 1CR9H 2XRAH 3MV11 1YMHB 3QDHA 2HJLB 1U8JB 1A6VL 4BK4A 4JDVA 1F3DJ 4G6MH 4Y89A 3S36H 3CX5J 3JZ7A 4LLDA 3PGCB 4LCWD 1QFWI 2CR6A 4PV9A 2A1WL 1ACYL 1U8MB 4HGKC 3NBNA 4FP8L 4HK3N 3IAPA 5BJTB 4ZPTB 4XPFL 4GQ9H 4JPVL 4X6CF 3VFTA 2EEBA 1FIGL 4YBQC 5FGRA 4D0BB 1NMCC 4PGCA 5I1LA 3ARXA 5E2UL 4I18B 2VE6A 1DQJB 5JMRA 4R4BA 2NW3A 4KK8C 1OVZA 1GZPB 5FYKL 1U6AH 3ULVE 1EEUA 1ITCA 2DTMH 2OBGA 1I8KA 3DUHA 1SM3L 3HLAB 4K3JH 1Q8MA 3HI1A 1T89C 1XT5A 5KN5B 3NA9H 8FABA 2DLFH 4LP4A 4OZFH 1DJSA 3TH2T 2XPGB 5BW7C 5DMIL 4BKLA 3EYSL 3QI9C 5KBNC 5IW6A 1C5BH 4I9WD 3DIFA 4KH2A 2Y72A 3WE6B 2A6IB 4EI5C 2B2XH 4CW1A 5JW4M 3SHSA 3GMOB 1OTSD 4FQJL 4Y1AA 3T0BA 1EBPA 2NNAA 1NMAL 4H25A 4NQSB 3D3VE 1EHXA 2BSTB 5DJ0B 3FB8B 4CDGC 4X6CB 5JXAH 4Y4KC 3RKPA 1I75A 4WI4A 4HWNA 5TDOA 3DWTA 3V6FB 4R7NB 4NKOA 3GMPB 2HLAB 4Y4HC 4APQC 4Z7NF 5C2BH 4UINH 4F37K 4K7PY 3SKOA 1NUNB 3RTQA 4XBPA 2CRMA 3QHZH 1CLZH 4R0LB 3QFDB 2X4TB 4DN3L 3FONA 4BZ1H 4U7SA 3RZCB 2W60A 1D9KA 4GUPA 1DLHA 2YK1L 2Q8BH 4YBLC 5JPMB 2F8VA 3FQXA 4JRYE 4POUB 3GSOB 5MENB 1QFWM 4X9FA 3QIUD 1OPGH 4J4PD 5FHBH 3HNTH 1FNAA 1R3HA 2PR4H 4XNYH 1A22B 4LSUL 4PRBB 4RGOH 1JHLH 1I9IL 1SBSL 4U7MA 4Q2ZB 3G5VB 3SY0A 4EI6A 2DIAA 4MVBC 1JN6A 2QHRH 5A2FA 1U3HD 2ICWJ 3JV5A 4PJ5E 1UH2A 4XP4L 1F6AA 4IOFD 5CSZA 5EOQL 1RUQH 4XPTL 4IRSB 3F6LA 4S1SH 3RWFA 4S1DC 4DW2H 1RJLA 2X05A 4XCCH 5CUSH 1ZS8B 3L3GB 3QB7C 3BHBB 3VXUB 1GIGH 2FR4B 1B0RA 3ECBA 4ONOA 1AGFB 4KQ4L 2YA1A 4FQPA 1ZVYA 1MVUA 5I8EB 2IQ9H 3GSXA 4LPUA 2GFBA 1T5XB 4KMLB 4HCRA 3CFCH 1CD0A 1I7RB 3RNQA 1A7OL 2PYEE 3SJVD 4HUVB 2EE3A 1VKXA 2OTWB 4GRWF 1P53A 3G6AA 3H7LA 5BO1H 4ZFZB 3TNMB 1L7TH 4LLUB 3GEWB 1EO5A 3QIBA 5D5MF 4HMCA 1MHCB 1WAAA 1TLKA 4MMXC 1FVCB 2IQAA 4OD2A 4Z7UE 4X6EA 1F4YL 3MLUH 2X9YA 2LV4A 3QJFA 2FX9L 4HC1H 1MCKA 1WFTA 1AE6H 4L8DA 5CKAA 1X5IA 2V5TA 2NY5C 5E7FA 1EXUA 2NY5H 4LPXA 1NGQH 1DN2A 2JB5H 1N7ML 1IQDA 5CJBA 4XPGH 2LQRA 5HHOA 4C4KO 4Z78A 2ADJA 2XACC 3I9GH 4LASL 4YE4L 3NIFF 3TO4B 4DFHA 2OJEA 2AEWA 1S7QA 2FATH 5E9DD 3G04B 3DXAE 4LSTH 3KG5A 3IDXL 4MLIA 3ZKXB 5FEBA 5D93B 3S5LB 1U8NA 1FVEA 5K93A 1FORL 1JWUB 3PGDB 4XVTH 2FECL 3EO0B 4X80H 3BSZH 4F8QA 5FGBA 5ISZA 1DVFB 3VXPA 2AJYL 1KCVL 1UEMA 4GRWB 1CICA 4PJXF 5E4IA 4DGIH 2ZJSH 3I3BA 4LLMA 3A6BH 2PXYD 2Z91A 2UZXB 4L4VD 1DR9A 5D5MB 1G6RL 3KPLA 3FO0L 3RWEB 5T1LB 2AXFA 3O6FA 1C12A 3GJFA 2BCKA 5I1JL 2DL9A 4QKXB 4F58H 2RHEA 3O3AB 3ETBF 4Y4FC 1MHEA 2WBJC 4W6YB 4MZ2A 3QAZB 4JHZA 3K8MA 2J6EH 5E8PB 5L2KA 4L8SB 3BWAB 4U1MB 1X5ZA 4CRPA 5IQ9A 3EYUH 3PIQA 4A6YA 3PWPB 5BS0A 5BXFA 4HBCH 3WYRA 4DVBB 3QQ9C 3BO8A 2VXVL 1A3RH 2WAHA 2R2BA 1NC2B 5F89A 4UQ3A 5CEZD 3WKNA 1P7QA 2CDEA 1W8NA 1UM4L 5E94B 1MVFA 3RA7L 5DEFB 4ZO6A 4Z7WA 4PJXB 4L4TB 3DVNA 4NQDB 5DEGB 4ELKB 5JOEA 3RVVD 3ZTJG 4ZXBA 4J7RA 1UM5H 4G6FB 4JHAH 4P4RA 1HHKA 3C60B 1NMBL 4X7SH 3ARRA 4DTGH 2ERJC 1TIUA 4NDMB 1B88A