3VI3F

Crystal structure of alpha5beta1 integrin headpiece (ligand-free form)
Total Genus 41
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
41
sequence length
218
structure length
218
Chain Sequence
QVHLQQSGAELMKPGASVKISCKATGYTFTSYWIEWVKQRPGHGLEWLGEILPGSGYIHYNEKFKGKATFTTDTSSNTAYMQLSSLTSEDSAVYYCSRALALYAMDYWGQGTSVTVSSAKTTPPSVYPLAPGSAAQTNSMVTLGCLVKGYFPEPVTVTWNSGSLSSGVHTFPAVLQSDLYTLSSSVTVPSSTWPSETVTCNVAHPASSTKVDKKIVPR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Cell adhesion/immune system
molecule keywords Integrin alpha-5
publication title Crystal structure of alpha5beta1 integrin ectodomain: Atomic details of the fibronectin receptor
pubmed doi rcsb
source organism Homo sapiens
total genus 41
structure length 218
sequence length 218
chains with identical sequence H
ec nomenclature
pdb deposition date 2011-09-21
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3vi3F01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3vi3F02
3MRRB 2NY3D 2A2QT 5B3JE 5F6IB 1OLLA 1MNUH 5AUMA 1S9WA 1N8ZA 2EDNA 1UKQA 3MCKA 1JYWA 4RGNE 3AB0B 2VZ1A 1KBGH 4XI5C 5C86A 3MBEA 2FWOB 5JUEH 4JRYD 2NW2A 2XG5A 3SDYL 3BEVB 3OKDA 1PGRB 2BVEA 3C09B 1I9IH 4EI5C 2VE6A 4HKJA 4NN5C 2AXHA 3P3YA 3X13A 1AXSB 1XIWA 4WTXA 2FEDD 4UT7L 3V4UH 1ZGLP 4U1SA 2NXYB 2FB4L 2AV7A 3QNXB 4ODHL 1XMWA 1EGJH 4PJEE 5J13C 3GBML 5EA0L 1GOGA 4FP8L 4BSVA 1KYOJ 1RUPH 1XGTA 3Q5YA 4PJCB 1IC4H 4M8QB 3S6CA 2ADIA 2Z92B 4OQ1A 3TA3B 3QDMD 1HHIA 3SQBA 1DFBL 3TWCL 1S9YA 1W0WB 1BGXH 2Y06H 1UG9A 3MUGA 1XGPB 5BCAA 1QYGH 2PNDA 1EEUA 1OCWL 1OSPL 4PRDB 3WFBH 1RZJC 4Y4KD 3A67H 3C8KA 4Z7WA 2LE9A 1BWMA 4OLVL 2HG5A 3VXTA 1C08B 1WAAF 1QSEE 3O45B 4IDJH 1T03H 3P4MB 1VHPA 2DIAA 1Q0XH 1PG7X 4U7SA 1TNMA 3SKOB 1FL6A 5DC9B 3SKNB 1DQDH 2Z9TA 3NN8B 4GRMA 4BZ2H 5I19H 1TVBB 3RWIB 1MEXH 3ULVF 3RJQB 1LO4L 4PV9B 2COQA 2DWEB 4L4TE 3GI9L 4L9DA 2CGRH 4RBPH 1JE6A 2ZCHH 2ADJA 3C2AL 3D9AH 3GO1L 1G7LA 4X5WA 4ZD3L 3RU8L 4BQBA 4DOHB 1T7YA 4EZMA 2Z8SA 2Q8BH 5J1SC 1FFQA 4GAGH 1UB6A 2VITB 4G80A 1NAKL 5EOCH 5CEZD 5MI0B 1ZLSL 3KPLB 3QO1A 1FORH 3MLZL 2FJGB 2Z4QB 5ICYA 1BECA 5FO7A 4GMSH 4NQCE 5E1AA 3BGAA 2JIXD 1G7HA 5D5MF 3WN5C 5DD0H 5GS0C 5IVXE 1IGCH 4X0KA 5DD5H 4YO0B 1F42A 4APQD 2BRRL 3FB7B 1M05B 4EDWL 5EZIH 1RJLB 2DQDL 3WUZA 4WEMB 1INDH 4EI5B 3FRUB 4U3CA 2CRIA 5EPMA 1XEDA 2B4CH 3ULUD 5CINH 4LCUB 4DGYH 4JRXA 3CH8A 3R8BB 3LB6C 4TNWF 3WKNA 2DAVA 5CBEB 4GG6E 3AAZA 3V4VL 4N90D 1S7XB 3N0PB 5E2WH 3ULVH 3IFOB 1AKJA 1A21A 4JVWA 3GMOA 5D7KE 3TFKC 2XT1B 4MDJA 1D5ZB 1FDLL 2Y07L 4GOSA 5KANI 3BWUC 1OP3H 2CO6B 2DQEH 3MMEA 4YDJA 3P30H 1AP2B 5C0AD 3RZWA 5HVHC 3LD8B 3UEZA 3NCMA 4ORZC 3DV4B 5JZ7D 1XR8A 2PETA 1JNHA 4OZFG 5GRYA 3NPSB 1CFTA 4PREB 1LK3L 1OSZB 1GGIL 5C07D 3B9EA 3E3QC 3VRIB 2XWJB 1UM6L 4D8PA 3RNQA 3VD9A 4Z7OF 3FO2A 1KB5B 3OKNA 2V6HA 4IM8A 5HHOD 4KKCC 4NKOA 4OLWH 4P2QA 3VXSD 5I8OH 5T1DL 1C8PA 3P0GB 3KWWA 4BKLA 1DVFB 5HI3D 4X7TA 5C7XH 4PGBA 4MAYD 3EUUA 5FCUH 3MYZA 4PY7A 2E7MA 4Y4FC 2HLFD 1IGJA 3BEWA 3QDGB 3BMWA 1MY7A 1G7PB 1U91A 1S7VA 1QQDA 4XMKL 4MJID 5HHVH 1A6VH 3CZFB 4KKLD 1D6EA 4YK4C 3GSRB 4OSUL 4EN3B 1AGCB 4PJ5E 4C56D 5F7HA 4Q6YA 1IJ9A 2BJMH 2V7NA 1YEEH 3BMVA 3SQOH 3BH9B 1J1OH 4N1CA 3EOBB 3C8HA 4U4BA 3KPTA 4HBCH 4YWGH 4KMTH 4WDIA 1ES0B 2QL1A 4JY4A 2YOCA 4S11A 5E5MB 4TRPL 3ARSA 1TVHB 3F7YB 3UO1H 3EOAB 1XGRA 3WHXA 1KPVB 1Z9SA 5IEKB 4EI6B 1J1PH 3BKCL 3G08B 5BRZA 1DQLH 1KGCD 3M45A 3GNML 4G7YL 2BOBA 3UJIH 3AS1A 4FHBD 2J8UB 1K6QH 4RFOL 5B38A 1HNFA 4FS0A 5C0BD 5F71A 3WSQH 2EDOA 3UXFA 1NFIB 1QFOA 1T7XA 2Q7NA 1KULA 2FX8H 3O2VL 3QHZH 4KVCH 1JWUB 1C5BH 5L2KB 1HHHA 5FV2A 5L8LB 2I5YL 3SO3C 1FE8H 1MFEL 1NCWL 1WBXA 2WBJA 3GMLA 4GW4A 1B88A 3UDWC 3GBLA 5EU6B 1FH5L 4FQJH 4W81A 1NFDF 1OGTA 3EOYG 3B6SB 4UV7H 4K3DH 1KSRA 3ILQD 3LN5B 5TFSL 1R5IB 1IEBA 2EYRB 1H3PH 2PW1B 4Z6AT 3MV7A 1IKNC 5FA4B 4NP4L 4NO0A 4LCWD 1WCBB 4YNYA 1CFVL 5IROA 4GRWB 1X5AA 5IOPA 3WLBB 2ZG1A 3STZB 4P23D 2R1WA 3JWOC 2VZOA 4XNXL 2UYLA 3IFLH 1AH1A 4GFTB 1WK0A 4M6OH 3B5GA 4OB5L 4HKZB 2LTQC 5C09B 2HT2C 3FB8A 1QHPA 1REIA 2R23B 3ARBA 4JFQB 1I7RB 5C0FB 1RHHB 4X8JA 3BAEL 1J0HA 4KXZI 1OQOA 2Q8AL 3G5VB 4L3AA 3IDIB 1YYLH 4ZTOH 2W65B 3MRFB 3BZ4B 3MOQA 3VG0L 3QXAA 3AVEA 4U6XA 4Y4FB 4UIKL 5IG7A 5J11C 4PJIA 2DQJH 3SGKA 2V5SA 4GAYA 5I8KH 4O02L 3UC0H 1CZ8L 1EBPA 1JUFA 1UKSA 5T3XD 1G6RH 5HJ3A 2ZWLT 5LXGL 1HXYA 5JPMB 2R0WH 2O61B 5D9SB 2OJZL 3MRGB 3TNNA 5CP7B 1YMME 1A6ZA 1Q9KB 3GJFK 4Y89A 2K1MA 2AXGA 4YK4B 3SJVB 4Z8FL 3WDJA 1WCQA 4KJQC 2C3XA 4TSCL 1T0NB 1QSFE 3PXJA 4MNHA 3W39B 5KSAB 5LAXA 4WUKH 4GXUM 2VYRE 3TO4C 2OMBA 1PLGL 5D6CB 3VXQA 3ZTNH 1YEJH 1E4XI 1YDPB 5GS1C 3CXHJ 1UACL 5KSVA 5ESVA 1WLHA 1KNOB 4HIIB 2X4TB 1FN4A 4XP1L 3P9WB 5IMMB 1QFUH 1KEGH 4YPJA 5T1MB 2GY7B 5GGRY 5I2IA 4Z5RB 3VWKA 3G6JF 3UTPE 4N8CL 2QQNL 2X5PA 3N9GL 2DMCA 4BH8B 4UB0H 5JOFA 1MF2H 5DUBA 1K5NA 1M71A 5HYQA 1U6AH 1DBBL 4M1CD 1J88A 2L0DA 5IHZA 2ATKB 2AEPH 4K07A 1FRGL 5DO2C 2J2ZA 3QDJB 2XQYG 5C0CA 4WI3A 3MRJB 1UZ6F 2ED9A 2Q76B 3JWDH 4M9PA 1N7MH 1YNKL 3T1WA 1X4YA 3QRGH 2KL6A 4LEXL 5SWZB 5D1QA 3O0RL 2R1XB 4UAOB 4DVBB 5FUZL 1LWRA 1SMAA 2IQ9L 3HE6C 4W68A 2A0LD 2C1PA 3L3JA 4K9EL 3S36X 1MFAL 5D7JA 2W38A 4B5EA 3REVB 4KJYB 3NOIA 3HMWH 2NYYD 4JVUA 4OUUB 5I1KH 4LLUB 2J88L 3GK8H 5L88L 4LMQE 5KG9B 3GI8L 3VI4E 3EFFB 1JV5A 1JI1A 2G2RA 3FHAA 2O5XL 3PDOA 3ESUF 3SE4A 2A9ML 4QHKJ 2G75B 4KY1L 3C8DA 2LTQB 4OZGB 4HK3J 3W5NA 4F57H 3T65B 5FUOL 4UUJA 1AGDA 4YHPB 5BXFA 3IJSA 3KLAB 4JR9L 2ZJSL 1ND0A 4IS6B 1SEQH 1NDMA 5TE4H 1LP9B 4I13B 5FB8A 1UM5L 2FGWL 4P4RB 1CGYA 5J11B 3NFSH 3JSSA 2XWTB 4WJ5A 4XPGL 4D9QD 3MV01 3WL9B 1V7ML 2P8LA 1I8LA 2YA2A 4ZDHB 3T2OA 1JF5A 5IMOA 1P7QD 2IGFL 2VH5L 4LP5A 4WNQA 4O2FA 3V0AC 1A9EB 5CJOH 4NNXB 2DLFL 4OF3A 3W0WE 3QBTB 3GGWB 5ISZA 5HDQL 5GZNC 2BY1A 1JZ3A 3BGFC 3FFCB 4ZODA 4B7LA 1C12B 4QGYA 3L3OB 4JFFD 4LPVA 1FVDB 5GS1B 4HUUA 3HI5L 3PGDA 4PJHA 1DDHA 3QQ3A 4YZFE 1HK6A 1T2QH 3Q6FB 4FQCH 2OCFD 1EK3A 3EYSH 4NN7B 5FM4A 2B1HH 4OBSA 4H88H 1T83C 2OL3B 4TUJA 1T4KB 1Z9MA 1YMHA 2OTPA 4YXLH 3CLFH 3IAGC 2X05A 3WFHB 2ZKHH 4WY7H 3RX5A 1EEZB 4LLAA 4HC1A 3T4AA 2HFEA 4JO3H 5DEZA 5DK3A 1OP5H 5JW4R 5E4IA 4KVNH 4XNZC 1TJIH 2AI0L 2YK1L 4FZ8L 3JV6B 5J6HA 3OXSA 3UTZB 4MNQE 3UBXG 1B0GB 1V3LA 4WHTA 1DUZA 2QLVB 3TYFA 2O5ZH 3T0EE 1Z3GL 2Q3AA 4U2YA 2F54A 4ZUUA 2R29H 2IG2L 3D25B 4M5ZL 4Y16D 4JHWL 4BZ1H 5I30L 5F1IB 1M1SA 3BI9X 4JZJC 5C08B 1BOGA 3D85B 3TV3H 1G84A 5FM5O 4WO4C 2DOCA 3DYOA 3DX6B 4MD4B 1NCBL 1IM9B 4X6DF 4HC1L 3HE6B 3IDJB 4JKMA 1F6LL 4GAFB 5B8CC 4DCQA 1PKQA 2W91A 2P8PB 5D4QA 1PYWA 2BMKB 4XNYL 3GFUA 5K33A 2EDXA 2FATH 5DHVB 1Q1JH 1TETL 3R06B 2EEBA 4V1DA 4LFHD 1KGCE 4RMTA 1YA5A 2VLJD 4Y1AB 2OLDA 5TE7L 4LHUG 4GJTB 5DTFB 1GJIA 4QTHA 5JDJA 2DTML 4I9WD 5DVNA 2X1QA 1U93B 4KK5D 4RQQB 4MJ2A 1JZ4A 2EZ0D 1B6UA 2VABB 3LZFH 4A2MA 2QSTA 3KYMB 4HXAH 1ZEAL 3O3BB 5ILTL 1T1XA 3CCHB 5GSVA 4W6YB 2GK0B 4U1JA 5I1EH 3F58H 2ARJB 2UZIL 3KXFB 4ZSOA 2HWZL 4RISH 4YDLB 3MRNB 3ARZA 1C5CH 3W9EB 1JGLL 4NHCL 2W0FB 3TNMA 2VQ1A 4O5LL 3VFNB 1M7IB 3LPGA 1JHKL 2AVGA 3MOAL 4H5SA 4L8SB 3C6LC 4TVPH 5IB3B 2XXMB 2JCCE 1A5FH 4L3ED 3N06B 5GGSY 4QRTB 2H26B 2I07A 4DZBA 1NEUA 4R8WH 3UTTB 4NO3A 4OZFH 4U1KB 2XA8H 5EORL 1BVLB 1LK2B 2W9EH 3UBXB 3RNKB 5GPRA 4JO1L 3NZ8A 4LSUH 4NZUH 3SHSA 3LRSA 4Q9RH 3MV8E 5IJVB 3C5ZD 3OG6B 3KPSB 5EUOB 3VXUB 5HGHB 5FFLA 3ULVD 1CR9L 4CW1B 4ZS7H 4IIQA 5DZNA 4K23L 3L3KA 4I0CC 4OLXH 1UVQB 1WIUA 3C5SB 4YXHH 2DI7A 4GRWH 2MSPA 4OLUL 4WI5A 4XNZB 4PB0H 2A9NH 4PRIE 4KRPC 3WS3B 4TUKL 3U9UB 4ONGL 3GSQA 1NSNH 3RL1B 1U95A 1PEZA 3B9AA 3DOSA 2A6KA 4UT9L 1Z0MA 3RDTA 3QFJD 4FTVB 1UQSA 4PJAA 4G6AC 1YQVL 5CJXC 3MA9L 4R3SA 3BZDA 3O3DA 2I24N 1FJ1B 1GRWA 2EDKA 4JZJB 4WO4B 1T22B 5DEGA 4OTXL 2IPKB 4XC1L 1VEPA 1JRHH 1OAKL 3LQZA 4MJ6A 1JPST 3U2SB 1KTKE 1ORQA 1KLGB 4WW2F 5B8CB 3JV4B 2P42B 5I71C 4ONFH 4RRPA 2DLEA 3MCG1 4QXTB 3RVVD 3HUJA 3P0VL 3UTSD 2VLRB 5DRWA 1BF8A 15C8L 1CICA 5ABDE 2YD1A 2JB5L 4Y2OA 4Z7VB 1NMAL 1FLRH 1IFHH 4R4NC 4JM2B 1S9WB 3MRMA 1NEZB 2R4SL 4Z7UE 5D71L 4HJJL 5DDHA 3WFDL 4KZDH 2AP2A 2EEDA 3LKSA 3MODH 4I18C 2NW2B 1H15B 3OKDB 4I3SH 4XBEL 3OKEA 1M4KA 2IH1A 2MMXA 4Y2DA 5DK0B 1BFTA 4HKJB 4LSSL 3X13B 2IBZY 1WWBX 5I1LB 1E4WH 5I1IL 1HSBA 5I1GH 4MQXC 1PX4A 4I0KA 4OCSH 2FIRT 3AY4A 5ANME 4W4OA 1KTRL 4JHBA 4DZ8A 1NBYA 2XG4A 1TZIB 3S37X 1E27B 4I1NB 1T21A 2RBLA 3S3PA 1BFOB 2PTVA 5C0JB 1WFTA 2VLLA 4V2CB 3WFCH 3C6LB 5EBLB 1KIUA 4NT6B 2YD3A 4PPTA 1E0OB 4OD3H 1KIPB 1J8KA 1HHIB 5DJ6A 2AK4A 2QSCL 1V5JA 1N0XH 1YEDA 4MGXA 4IOFD 5D7IF 1LEKB 4L4VD 3MUGB 1ADQA 1DL7L 4DN4L 3DVGA 4PGEB 3JXAA 4YDIH 1S78D 4MXVE 3WJLA 3QUZD 3FN3A 5T1LB 3U82B 3T2PA 3KR3L 4V2BA 1WZ1H 3VXTB 1CS6A 2KQNA 2NY5H 3TH2T 1TZGL 4MB3A 5IF0B 4ZUVA 5CILH 2ZUSA 4D9QE 5DQ9A 3P4NB 4RGOH 1HCVA 3H42L 3BKJH 4GBXD 3CK0H 3HFML 2J4WH 3CDGB 2Z93A 1NGYA 1NMBL 1ADQL 3SY0B 1IGIL 5FCSH 4P57B 5A3ID 5DT1H 2EDHA 5BQ7A 1X3DA 5JA9A 2DKMA 1HHGB 4RBPK 4HIHA 3TJHC 5DUPL 4MCZA 1RJYA 1RZGB 5KOMC 3P2TA 5ENWA 4JPIA 3CFCL 1CXLA 1TJGH 1A7QL 3MACL 3DURB 4Y4HD 1G7LB 2PF6A 4QRPD 4ZUTA 4X98B 3OAUL 1RUQL 5ACZA 4QY8B 3HNSL 5I71B 1WTGT 3CXDL 2O5YL 1U8NA 3NACL 4NJAL 5F7YC 1K3IA 5HTSA 4R4BA 4WUUE 1AI1L 2LU4A 2ED7A 3I50H 1MHCB 4WEBH 3T4YA 4KDWA 4OLZH 1CDUA 1YN7A 4K3JL 1NDGB 4PG9B 4NZDA 1TNNA 1Q0YL 5FO7B 4TSAH 1MELA 4FQLH 5JQHC 1YY8B 2VRAA 1G7HB 1X7QB 3QPQC 4XVTH 3HG1A 1JJUA 3QZWA 3O6KH 5INDA 5SWSA 4WFFE 4X0KB 4X4XB 4Y5VC 43CAA 5CP3H 3MUY1 1MHHA 1LO2L 1K2DB 2OP4L 1EO5A 3QJHB 4OV5A 3W2DL 4M4PA 2XKNB 2OI9B 4Q2ZA 2CQVA 1H0DB 2P5WD 1J7VR 1K8IA 4HIEA 5DQDL 3HNVH 4GMTL 1IM3A 3ZSSA 2H32A 3EYFB 4CRPA 1P9MC 4JRXB 4N8VB 4I3RH 1UADC 3SGDH 3HN3A 2PN5A 4P2RB 4NDMA 5DJ0A 1FGVL 2BVQB 4XPFH 2AJYH 1IAII 1MCBA 4AL8H 2ADGA 2NW3A 3AREA 32C2A 1Q9OB 3HC4H 4NQSB 3GMOB 3VWJD 1I1FB 4HS8H 4MAYC 1T1ZB 1OP3K 5IIEB 1AQKH 5CBAB 5HHPA 1KN4L 4YDJB 1JFQL 4U49A 1G0DA 2ZOLA 4I9WE 4XP5H 1OTSC 4HGMA 4X9FA 2BDNL 2EDLA 3TT3H 3IFPA 2P5EA 3MLRL 1I4FB 1NMCB 1UGNA 1AHWC 1DEEA 4D8PB 3RNQB 1JNJA 1P84J 4I0PA 5B21A 1RK0B 3FO2B 5IEHB 3OKNB 2V9RA 3IDXL 4O4YH 2HFGL 4IRSA 2VDNH 1AGFA 4YHML 1KC5L 3H7LA 1I3RB 4R9HA 3KPPB 1WBYB 2Q86B 3KWWB 4QT5A 3QXTA 4MYWB 4FN0A 5HYSB 3DXAE 3T0AA 5DJYA 5FYKL 5IB4A 1A02N 1HI6A 4ZFFA 3PHQA 4GG8A 3DETC 4X6FB 2WUCH 3S4SB 4OM1H 3PQYE 3ELAT 4HWBA 3B2VH 1U91B 1QQDB 4FA8A 4NUJA 1U8LA 2MHAA 1MY5A 2K9UA 1D6EB 5DI8B 1V3MA 5ACLA 3DRQA 2AK1L 1N3NA 3RVTD 5GGVH 3DHMA 4L5FH 4P46D 1KELL 2R56L 5GRUH 1L0XA 2D7TL 1I8IA 5F9JA 3ULVE 4DAGH 4HWBL 1ONQA 3D69B 5DSCB 4OCYH 2F5AH 2YPVL 1K3ZA 1JZ5A 1UWEH 4JY4B 2XFXB 2D7PA 3IJHB 4Y5VB 1YQ2A 3MV9E 5D7LB 1RJZA 4RAVB 5CZXC 3IXAA 1NUNB 2ICWB 3UROR 2D9CA 4IOIA 5L9DL 5ITBH 3S97C 5T3ZL 1YEHH 2YUVA 2DKUA 3QUMA 4JO4L 2BOBB 4HKXA 5SX5H 3V5KA 2EIDA 4P99A 3S7GA 3VXPA 12E8L 1MI5A 2GTWA 3U0TB 3CC5B 1FSKB 3A6BH 4XWOD 5SX4H 1A6AB 2R2HB 3DIFA 3FN0L 5TQ0H 2OYPA 3SDDB 3FQNB 3MXWH 5IVNA 1HHHB 2H2PD 4KPHL 5F96H 2YXFA 5KVGH 1WBXB 3BESR 2ARWA 4HIJB 1I9JL 2B7DT 5E99H 1QRNA 4YAQB 3ETBF 3RY5A 2PXYA 3QUML 1OP9A 1CGWA 4G3YL 4ODUA 2EC9U 2ZCKL 1JPGA 4JREC 1AXTL 1UWXH 1IT9L 1BZ9B 3MV7B 3P9MB 4LKXA 4UMGA 1AY1L 3DX7B 4NO0B 2OTUA 4RA0C 2FYYA 3DBXB 2H41A 2HJKA 5IOPB 2X4NA 2R9HD 2CDEB 1HCFX 4ODVL 4XPTL 4MHHG 1ZA6A 1FAIL 1BZ7A 5CAYB 3MREB 3OG4B 4NNPL 3D3VB 5IM7A 1DSFL 3RUGA 3VXRD 3MBXL 4YHNA 3C60A 4X8JB 1YC7A 5H2BA 2DRUA 5MENA 4UT7H 3DVFA 3RA7L 4G9DB 4U0QB 2FB4H 2G9HA 2FH8A 4K94C 4ODHH 1IEHA 1EZVY 3MJ6A 4KQ4L 4PJDB 3E6FB 3PP3K 4U6XB 1KJ2A 5IG7B 3BRDA 4KKAD 1DLHB 1HQ4B 2PYEA 3GBMH 1OTTC 5EA0H 3W9DA 4FP8H 4UOW1 3RVUD 3O6LL 3WCYA 5JW5A 1VFUA 4PTTA 5HYFA 1HINL 3DYMA 2AXGB 3OWEA 1QA9B 4RGMB 3SKUD 2GSGB 1CD8A 1DFBH 3TWCH 4WCYL 3W11C 4KV5E 2FIKA 4MNHB 3B8YA 5FM5M 1R3HA 5F7FA 5TDNA 1KJ2L 5CSGA 1OCWH 1OSPH 1FNAA 3WKML 3QWRA 1I7ZB 3T8XA 3WO3B 1L0YA 2LU3A 3DSNA 1T89A 3SDAC 3KS0H 2EH7L 3HE7C 4PJ8D 4JHAL 1NC4B 4NWUL 1BJ1J 4OLVH 3ULSA 1S7QA 5L8KB 1F3DH 1OGAE 3DLQR 4N9OB 4K2UL 4UT6L 3GBNL 1AGEA 4UU9A 5H37H 2ERJC 1Z5LA 1JVKA 1HIML 3EO0B 1NC2D 4PD4K 1RUKH 2W60A 1MQ8A 1D9KD 4H8WC 4WFGE 5J57B 1LO4H 5JOFB 1K5NB 3G04A 4POUB 4KTEL 3SN6N 3GI9H 4LOUC 2FX9L 2R2BA 4Z78A 2H3NA 5F7EL 5IHZB 2YN3A 3G6AB 4P3DA 3L95A 4KJWD 4QRPE 3C2AH 1FVCA 3GO1H 1ZT1B 2HJFA 1Q9WA 4ZD3H 3RU8H 1MCKA 5CLTA 3SKJL 1Z9OA 4X6CF 4PRPA 1WSST 2KPNA 3MCLL 3SDXA 1MIEL 3L3JB 1NAKH 2FHCA 1HNGA 2HT4C 5CJXA 4PGJA 2D4DA 1ZLSH 3MLZH 4K3HA 4JRYA 4M93B 1MQKL 4NYLB 3U7AA 5J89A 4S0SD 4OV6F 3QSKB 1HOCB 3ARGD 1H5BA 4IBLT 1NKOA 5JW3L 3PDOB 3MJ9A 2BRRH 2NCMA 4S1DD 3WNKA 4EDWH 1EDQA 4CMMA 5FECB 4OFVA 1EXUA 1LDSA 5D1XC 2DQDH 4PJ7A 3PWPB 4AY0A 3RHWF 4PJCE 5BXFB 1ZGLM 3KPRD 1NDMB 3WS6C 1T5XA 2CRMA 2EKSA 4RNRA 3VU2A 1T66C 4ELME 3MJ9L 4WJ5B 3QDMA 1QP1A 4ZO8A 3ZDYF 2DYPB 2IALA 4LKCA 3V52L 4WHYG 1FNHA 3LOWA 1UEYA 3BPCA 3V4VH 4NNYA 3L3GB 1HXMA 4G6JL 4HK0A 3UCRA 4O2FB 3TZVC 2Q7YA 4Y4KA 1KCVL 1FDLH 2Y07H 5HYEA 1OW0A 3RWDB 5KAQG 1X44A 1WZLA 1N5AA 5IKCA 3OXRB 4A6YA 2C1OB 4L3CA 3STLB 1YPZF 2C3VB 3B8SA 4D0BA 4HUUB 2NY4D 3TBWA 4PJHB 2AW2A 3QQ3B 4G42A 1LK3H 1UM6H 5LG1A 4NN6B 4U3XA 1HN1A 1YMHB 2EDDA 4Y19E 3QAZC 2BSTB 5T1DH 4PJXB 4A6YL 1OP5K 1WBZA 2HFEB 1BVZA 1X5LA 1DJSA 2N56A 4U0RC 5A2JH 3V6FB 1DUZB 1I1YA 4I5BA 3TYFB 5HDBF 2A77L 3GEWB 3D18A 4ZUUB 4XMKH 1DE4A 2YRPA 3WIIL 2VL5A 1WQVT 2V7HB 2XQBL 4HEPG 4OSUH 3JVGA 1KPUB 4E5XA 1ZHBA 4Z18A 1XF3A 3T0BA 4APQA 2CDGA 4XH2A 4HLJA 4X7EC 4QHMA 5DZOA 2QV2A 3AU1B 5CEZL 2LQRA 4OI7A 4HULB 1VFAA 3D0VA 4PFEA 4U3HA 2V5YA 5H94A 4TRPH 5T5NG 4WI2A 3MA7B 3BDBA 3PL6D 5C9JB 4F7TB 4QTHB 3BKCH 1UZ6E 4JQXC 5CIPA 3GNMH 4G7YH 3IT8D 5AAWA 5FKAA 4K55A 2NZ9D 3DX8A 4RFOH 2C26A 3MNZA 5C0IB 4Q58C 4NQDD 4O00A 1Q9LB 3O2VH 5BS0E 5JTWA 5CKGA 1T1XB 3EYVB 1QPPA 2I5YH 1IARB 4N68A 4AT6B 1G7QB 1MFEH 1NCWH 5HY9B 4MDIA 4P5KA 4U1JB 2MNUA 5EU5B 5CGMA 4NRYA 3UPRA 5C0AA 3ULUL 3V6OE 1IGFL 1FH5H 3TZVB 4RWHA 2VQ1B 2ZUQB 5TFSH 1EEYA 5MERA 2APBA 3GKZA 3MRQB 5C07A 4NP4H 1LHZA 3X11A 2YA1A 1JGUL 4PR5A 1CFVH 2I07B 5HHOA 1LO5A 2ZUXA 3VXSA 4NO3B 1QHOA 3D39A 5EIIA 2BHUA 1OF2B 4XNXH 3B2UC 3O9WC 4MAYA 3QDGE 4OB5H 2ICEA 5ID0B 1R3KB 4Z76B 3L5IA 2C5DC 5FGRA 3JTSA 3ECBA 4PJGF 3HZVA 4NQED 3RQ3A 3Q48A 4RMVA 3BAEH 3FO1A 4IIQB 4OD1L 2DIJA 4WI7A 2Q8AH 4MJIA 4I4WA 4WEUD 3LAFA 3RIAF 3VG0H 1QKZL 2V2WA 3K8KA 3PDDA 4UIKH 1AHWA 4C56A 3TM6A 4CNIA 4O02H 1CZ8H 5DR5L 5LXGH 3VA6A 2BNRE 2IBZX 2OJZH 3O3DB 1EV2E 3AXLA 5IK3B 4C57C 1VCAA 4Z8FH 5DEGB 3PF2A 5EIVA 4TSCH 2EXWD 4KDTC 4KZEL 4LPUA 3D2UD 3K2UH 5TQ2L 3Q3GA 4R26L 3QUKB 5D2LA 1PLGH 2DF3A 4ZYKB 3LKPA 3E6HB 3G6DL 2Y36L 1EAPA 3DMMD 4CUCA 1UACH 1SJHA 4XP1H 5DD6A 4TVPE 5DRWB 5C0BA 2PW2A 4OZHA 5IESL 4TUOB 4RGNC 3DO3A 2D31A 4LGRB 1IL1A 5DDHB 3WNOA 4N8CH 1QSVA 1YUHA 2QQNH 3N9GH 4G43B 5EU3A 2X89D 1MLCA 3T1FB 1MCPL 4OIIL 5EU6E 1KJ3L 5KS9B 3ARYA 5JLZA 3OKEB 1DBBH 1PZ5A 1FYTD 4Y2DB 2ADFL 4OCLC 2IAND 1NCCL 3V0VB 1FRGH 3GJEA 1HSBB 3EYUL 1OARL 1FZOA 2VZUA 4DKFL 4G9FE 4DZ8B 4GRWE 1YNKH 4LCWA 4LEXH 5A2IH 1IC5L 4QRRE 2YZ1A 3O0RH 3IU3B 3FQUB 3ARDC 5FUZH 2CKBB 2IQ9H 1FFNA 4XVJL 4K9EH 4OCXL 1MFAH 3C08L 3CJJA 1A64A 5L6YL 3DSFL 2J88H 5L88H 4J6RL 1JGDB 2V9TA 4AG4L 1C7TA 3GI8H 2WNGA 1YEDB 1U3HC 2O5XH 1CT8B 2A9MH 4K8RC 4KY1H 5E4EB 5EDXA 4PJBA 3WJJC 1IRAY 3B9KC 2Y25A 1MHEB 3MJ8B 4UBDC 5FUOH 4NKIH 4MB5A 2VLMD 2QQKL 2P8MB 5FF6A 1ZHKB 4JR9H 3ARFD 3BOVA 3SJVE 4OKDA 4WU7A 2M26A 3QNYA 1UM5H 2FGWH 1RJCA 1BD2D 2KUTA 4L29A 4FG6C 4XPGH 4AIXA 1U8PA 3NA4A 3ILPB 3QIBD 1V7MH 3BP6A 5E9DB 2NY1C 4YXKL 2VXQL 2IGFH 2XWBB 5HD8D 2VH5H 4MCZB 4HKBB 1PJ9A 1IEAA 2NX5D 4MNGB 4R7DA 5DA0B 4AM0A 2DLFH 4YIQB 1RIHL 2X7LA 1P69B 4BUHA 1CQKA 4ZUTB 4LQFL 5HDQH 5ACZB 3K8MA 1U8NB 3OJVC 2DN7A 3QQ9C 5D93B 4R4BB 5HDLA 3HI5H 4MD0B 1XF5A 2NXZD 3O6FD 3RZCD 4B41A 4F37K 1YN7B 2EH8L 1LE5A 3QHTC 4Q9CA 4TN9A 4M1DL 4RGNB 5JHDD 4AENA 2RCSL 4OJFL 4OI9A 3UTOA 5IW3A 5IHLB 5ESQB 3L5JA 3QUXC 3U46B 2FX7L 4YR6B 2AI0H 2YK1H 3HE7A 4U1IA 4N9GA 4D0DB 4OV5B 5BW7A 3OR6A 3MRLA 2XQYK 1Z3GH 5GRJL 1EVTC 2IG2H 2EC8A 1P4BL 4M5ZH 4JHWH 2VDPL 4PBWD 2YD6A 3X3FL 4FQHB 4U6VL 1ZHLA 1ZHNA 5HVWA 1NCBH 4HC1H 3BP7A 1J05B 1MFBL 3M17B 4KGLA 5EBMA 1NL0L 3DV6B 4NDMB 5DJ0B 4X99A 4B7IA 3O41A 3KJ6L 2NW3B 4OZGE 3AREB 32C2B 3ZHLA 4XCNA 2JKXA 3P4OA 3UTQB 2HRPL 4HT1L 4XNYH 3CU1A 4ORGA 4OFYD 3D1MC 4HEME 1TETH 1LP9E 2VLKD 5TE7H 2LAGB 5ERWA 4RAHA 2P5EB 1D5XA 4N0UE 4NPYA 2DTMH 2X70B 1ZVSA 3B9KB 1A1MA 1MJ7L 1CFQA 3PABA 3RY6A 5DXWA 5K9OA 2IAMD 3HR5A 4I0PB 3I85A 1P7QA 1ZANL 2FJHB 4JDVA 3MGTA 4F33B 1ZEAH 3MRHA 3BP5B 3RPIA 3U0WL 2R2EA 1DBAL 5ILTH 4L4TB 2VTFA 3NA9L 1RU9L 3DHJA 1BM3L 2UUDH 3ARRA 1PKOA 2PYFA 1O5DT 1ZT7B 4RA3A 2UZIH 4WHYH 1MCWM 3EJJX 4ZFFB 2HWZH 4GG8B 2NY1B 5CSBA 4PRAA 3PWJB 3GB7A 1CFNB 1I8MA 1MRDL 2E9WA 4QRSA 1JGLH 2FL5B 4NHCH 4JFFA 1YNTA 4O5LH 2XTJB 2WWKT 1B0RA 2NPLX 1JHKH 5F7LB 3MOAH 5E6IB 2GTZA 1KACB 4W70A 3VGAC 1LE9B 3H9YA 5IGXL 5E8DL 1G9ML 3V5HA 1AR1C 2XXCB 4R90L 1FVEA 3DRQB 3CVHA 1N3NB 1J8HD 3DUHA 3DUSA 4FFVD 4LLMB 3EDKA 2VNCA 3HCVA 2Z31D 5EORH 4L8CA 3VH8A 4HUMB 2DQGL 3MRDB 5F9JB 1ONQB 4JO1H 4JFPB 1OAUL 3UPAA 4OQTA 5CKAA 3H9SD 1CR9H 1MJJA 2BOCA 2XN9D 5C08E 1RJZB 3IXAB 4K23H 1FGNL 4Y16A 3CVHL 1GGCL 4OLUH 5HYIA 2FCBA 5IFHL 5M95B 4OZIE 4TUKH 4KROC 4ONGH 3TESA 5SX5K 1IKFL 3JV5A 4UT9H 1MI5B 4HWZB 2GTWB 1YQVH 3MA9H 4OQTL 4GG6B 1Y18B 3GMMB 1AKJD 5DZLA 1I7UA 3RL2B 2F8VA 1D7FA 4OTXH 2GSIA 4XC1H 1OAKH 4LNRB 1EZVX 2X4OA 1L6XA 2BSRA 4NOBA 2ICWI 3BP4A 1IGTA 4F7EA 3HC3L 2BSSB 5IQ9A 3E2HC 3ZDXE 1I85A 2VLJA 3LSOB 1G1CA 1ORSA 1UWXK 3U9PL 3V7AG 3CUPA 3FZUD 2B2XL 3LIZL 2A6DA 1T20A 1CL7I 3P0VH 1GZQB 1Q94B 5HI4D 2YD7A 3MV11 3KYAA 2JLLA 15C8H 2JB5H 1GPOL 1HHKA 1NMAH 1Y6MR 1CGSL 4X80L 2R1YA 3QHFL 3ARQA 2R4SH 1KFAL 5D71H 1WF5A 2X4NB 4P2QD 3OB8A 4HJJH 3NFNB 4CL7A 3WFDH 5JMOC 4QXUL 1ZA6B 1L0QA 1UC6A 4HUXA 3EOTL 4MLIA 4RFNB 4NZJA 4XPAL 5IM7B 3RVWC 3AS0A 4XBEH 5IUSA 2EECA 3EJYC 4LSSH 1FL5B 1C16A 1DQJA 3C60B 3BX7C 1ZA3B 4OLYL 5H2BB 3IDYC 5I1IH 4D2NA 2HKFH 5MENB 1A7NL 4S1RL 3RPKA 2AKRB 5CMAA 4PLNC 3QA3B 3U7WL 2G9HB 3WXWL 1KJ2B 4L3EA 3UTTE 3RVXC 3QYCA 1GIGL 3IJYA 5FGBA 1A6UL 3QUYD 2PCPA 3S8WA 1WAAA 2Q87A 2CLRB 4PJ5B 4WWKC 5KN5B 2V5RA 5JW5B 1R0AL 4PTTB 1QUNA 5A2LH 3VGAB 2N1KA 3I02A 3LV3B 3IF1A 5EUOE 1RHFA 3VXUE 3HPLA 3NIFE 1UCTA 2QSCH 3C5ZA 3UYPA 4F8TA 3MGAA 1R3HB 3EO1A 4LCYB 4J3VA 4J4PC 5TDNB 5T33L 2FECI 1DL7H 3QIUC 3QULB 3T8XB 4UQ2B 4DN4H 4JCMA 1U3ZA 1DQML 3DGCR 1OT1A 5HGBB 5BRZD 5JIIA 4K71C 5HSFA 4RX4A 3HLAB 2F58L 4FTVE 3KR3H 1CFSA 1OAYL 4LF3A 2APVA 1S8DB 4MQTB 1TZGH 2FBOJ 4MXWL 2B8OT 1F58L 2CLVB 4PJFE 4UU9B 1KUMA 1IZKA 1A2YB 1Z5LB 2JK5A 1F6FB 5I17B 1XCTA 3H42H 4KROB 3FQXA 3HFMH 5CD3A 3ZO0A 4KDVA 1NMBH 1GGBL 1ADQH 1U8IA 1IGIH 2X4SA 4KHTL 1P6FA 4J1UA 2R15A 2WBJD 5I16B 4P2OB 1UZ8B 1ZT4B 2R2BB 5DJCB 1JMXA 2H3NB 5DUPH 1RK1A 5KZCD 1U8QA 5D5MA 1DLFL 4X5XA 5KSBF 3OKLB 3CFCH 2DDQL 1A7QH 3MACH 3SO5A 1SJXA 2HJFB 4F7PB 3GSOB 4ELKB 3LS5L 3IXTB 3L7FB 4HZAA 4BK5A 3UTSA 3OAUH 1RUQH 2F53D 2NY3B 7FABL 3E2HB 2AXFA 5IQ7L 3CXDH 2X42A 2O5YH 3FCTB 3NACH 4NJAH 4Y5YC 1PVHA 3SDXB 4YEEA 4ZMAT 1I1CA 4P48A 1AI1H 1FPTL 5HI5D 1JGEB 1QR1B 5GGUB 5E2JA 4K3JH 4O2CA 1Q0YH 4CKVX 5IW6A 3VFGL 3BSZL 3G5YA 1JZ2A 4JY5L 1H5BB 2Y4SA 1RVFL 2A73B 1LO2H 5C3TA 2XZQL 3K2MC 1VENA 2OP4H 2NR6C 5F3HA 4PJ7B 2DD8L 3DROA 1EJOL 2J5LC 3W2DH 3VG9C 3NCYS 4JKKA 1INQA 2YUWA 5SWQA 5DQDH 4YEFA 2EKSB 5DFTA 3TEUA 3INUL 4GMTH 4RNRB 1SYVB 3PWNA 1EBAA 4XCEA 2G5BB 2VZTA 3VD3A 3QDMB 3CX5K 4P3WA 1MFNA 1YMMB 3MTRA 2IADA 2IALB 4LKCB 4XBGA 4JFOA 1FGVH 4L4VA 4NNYB 3N1QC 1TVDA 4WWKB 1HXMB 5C0DA 4Z7WE 4D9RD 5E00B 1ZGLA 1GGYA 3V95A 3M1BA 3QUZA 3FRPG 3BQUC 3GSUB 1RAMA 3CDFA 1KN4H 1BIIA 2E8YA 4MCYB 4HSQA 2H32H 2D4FA 1MCNA 2BDNH 1JN6B 4U1LB 4YFLI 3MLRH 4E0RB 3LS4L 4PP1C 5DVOA 5BZWA 3R4DA 3BIAX 3MFFA 3O11A 1FNEB 4ZNEA 1NANH 3IDXH 2HFGH 4YHMH 1KC5H 4J3WA 1Z9LA 1QFPA 1U3HA 2VZVA 4IJ3B 5ICXA 5LGHL 5DJDB 5DQJA 1T2XA 4IRJC 1WBZB 4GO6B 4XTRD 4Y4HA 1S5HB 5FYKH 3T0EC 2P24A 2B1AL 2EIZB 2IQAB 1XGQA 1W72B 3H7BA 3TBTA 3D18B 5D7JD 3BHBB 4OFKA 1DE4B 4GW5A 4GW1B 2HVJA 4JGUA 3F12B 1CD1B 2VL5B 3V9FA 5EOQL 4QF1B 5C0NC 2JIXB 2AK1H 4Y5YB 1MVFA 1NQBA 2Z91A 4E5XB 1ZHBB 5E8EA 4LPCA 1KELH 2IMNA 2R56H 3AS3A 3H3KA 4Y5XA 1IQDB 2D7TH 3I6LD 5IB2A 4UTBL 4XHQA 1J0ZA 4HWBH 5JDSA 2D7MA 2QBWA 2YPVH 1G7IB 3ZKMC 5E70A 5B4MD 3BGMA 1HYSC 4E42B 3NAAL 3E1F1 4H1LG 2MCPL 2P5WA 3REWA 5D1ZC 5F44A 5J1AA 3GIVA 1NFDA 1JF6A 3I3EA 3QCUL 4JRXE 5L9DH 5T3ZH 1TJHL 4JO4H 2Y6SC 4P2RE 2YD2A 4PG2C 5FKAB 5HHQA 2ICCA 4XI5D 12E8H 3MNZB 3HI1A 2PR4L 4M6AA 5DS8A 3QFDA 4EI5D 1EFXB 1G9NC 3FN0H 3VWJA 3O3AA 3WNMA 2N7AA 4KPHH 1IZJA 4QOKA 4P5KB 1I9JH 1MFCL 3QUMH 1A6TB 5JIHA 2GCYA 4B53A 2C4FU 2BCKB 1OAQL 2VDML 3NCCB 4G3YH 4UV4L 2JJTA 2ZCKH 1AXTH 4XT1C 1IT9H 4XRCA 3BQUB 1S7RA 3G5ZA 4HG4K 3KPOB 1H8SA 5C07B 5HHME 1AY1H 2LVCA 4YDKL 2GITA 4LCCC 1BBJB 1P7HL 1LO5B 3IYLW 3AM8A 4L8DA 2J8OA 3HZKB 1F11A 4NFBA 1AIFB 2YC1B 4ODVH 4XPTH 2ZNWA 1GC1L 5J1TC 1FAIH 3FAXA 4J8RA 3BO8B 5HPMA 1HE7A 4NNPH 1DSFH 4JDZB 3OX8B 3JTSB 3MBXH 3U30C 1URLA 1XGYL 3FL7A 3QIWC 1F45A 2DQHL 4WV1C 4MA1C 1DN0B 1KTLB 1RZFL 3NVQA 5IMKB 5ITFB 4F7MA 3GZKA 2F54D 1P1ZB 1OD7A 4MJIB 5F7KC 4JFYA 1RUML 4I4WB 3U4EA 3RA7H 3RRQA 2D7NA 3KNBB 3N85L 3T0EB 5CEYB 5LJYH 3A6OA 4LRIC 4KQ4H 3KAAA 4PBXA 1JK8B 1L7IL 1R5VA 1CDHA 4C56B 1FFPA 1QFWI 4OF5A 3O6LH 4GKNA 4ZOBA 4P46A 4W6XB 3BKYL 5AAMA 3N1GC 1NH6A 5J6GB 3MFGB 3SE9L 1HINH 2WIIB 4P5TC 3TVMC 2FEEI 2YEZB 5IW1A 4H1LB 4U1MA 3G6JA 2NNAA 4MWFA 4WCYH 5JXEC 3RWJA 5MEOA 1KJ2H 3HAEA 2YS4A 1H8OA 1AO7A 1I7TB 3WKMH 3SCMC 3IAQA 2IJ0C 4EDXA 1EAPB 2EH7H 2HH0L 2GUOA 1D3CA 4JHAH 4NWUH 4BQ8A 2DQFB 4ZPTA 3TCLB 4JY6A 4U6HB 1R3LB 4K2UH 4UT6H 5DD6B 5DJXA 2PW2B 3I75B 3GBNH 2BNQD 1HIMH 2X10A 4AIZB 4XX1G 5GS0D 4OGYL 1YUHB 3F5WA 1MLCB 1WWWX 1CE6A 5EO9A 3U36A 3SGEI 4KTEH 4JN2A 4I2XA 2FX9H 1PZ5B 5F7EH 2RFXA 3VFSB 3MV7E 1FLTX 5BV7C 2DM2A 4P9HC 4HCRA 1EAJA 3FO0L 1EH9A 5FA3A 4Z7QF 3SKJH 1BOYA 3VFMB 4A2LA 5L2KD 2OJEB 4G5ZL 3LB6D 3MCLH 4PRNA 4ZAKC 3TN0C 4NQVB 1MIEH 3MLWL 4WTWA 4LBEA 4P23B 5DRNA 3IRPX 4KK9C 3FQWA 5DJAB 4YE4L 3DO7A 2VMFA 3TFKD 1MQKH 3RTQC 2KH2B 4LCCB 4MXQC 2Y5TA 4Q6IC 3VXRA 1CDBA 5IVOA 2KQMA 4PYHA 1CDIA 4HCRL 4TULL 5DVMA 4UINL 5JW3H 5LGJA 1SBBA 3WLWC 3MV8B 4QLRA 3TBYB 3FJTA 4WENB 4PJIE 4ZPVB 3MLXL 3ZLQC 5FKPA 3O4LD 3TIDA 1NGPL 4U1GC 4WV1B 3QI9C 1FNLA 4PRIB 1VEOA 1GOHA 1VACB 3RP1A 5F21B 1YEGL 2Z35A 4ETQB 4CBPA 4KKCD 1J11A 5D6DA 2W07A 3LKNB 2UWEF 1QO3B 1ZMYA 2VQTA 5ADOL 2BRQA 3QJFB 4BFBD 2K7PA 3MJ9H 3VRLF 2DWDA 1WZMA 3ZZ1A 3V52H 2YPLD 4NZRL 1AD9B 4U7MA 4G6JH 4Y4FD 5FOBB 3PWVB 4F15B 3FB5A 5BOZG 4HZLA 1IEAB 1UJ3C 1CGXA 3U4BL 1KCVH 4PJ8A 2CSPA 5JO5B 1GZPB 4WWID 3PNWA 3TT1L 4JLRB 1A1OB 4J23A 3MQIA 1DQTA 1D5IL 2ENSA 5L0QB 3SCMB 5TGBA 2HT3C 3QO0B 4QHNB 4G8FB 1UB5B 1N6QL 1NC2A 5DF0A 1A8JH 1D9KA 1M7DA 2P48B 3RKDC 4ZFGL 1UENA 4Z7UB 2D2OA 3CFDA 4UIMB 3TIEA 2E9IA 1T3FA 4X6DA 2IWGA 5C0CE 2ZUWA 3WD5L 2HLAB 4FQXC 3GSNA 4X7CC 2ITCB 2VDRL 5FAAA 4X7SL 1DQQA 1FL3A 4HPOL 4A6YH 3X3GL 1DZBA 5CUSL 3OJDA 3MRCB 4DKAA 4JQVA 5FYLD 4P59L 1LQSR 4PJ9C 3WUWB 3OR6B 4NBXB 2A77H 3ZDZF 2FHBA 5TDPA 4ONOA 4NCC1 5JMRA 4P5MA 1BQHA 2ORBL 1KEML 1A1NB 1S9XA 3HRZA 2F5BL 3SDCC 3WIIH 3GSNL 2AS5M 2A83B 2XQBH 3QDJD 2DLTA 1H3TA 2Z8WC 4P4KC 3SOBL 4ZAKB 2C9AA 2QHLA 3U7YH 3O41B 3WDHA 2V2TB 1AGBA 3EFDL 4AJ0A 1QBAA 4RCAA 4XCNB 2XIDA 4MMZC 1B90A 5EC2A 1U36A 4BZYA 4Q6IB 5CEZH 4WI4A 4NCC2 4YHYB 5F72S 4M7LL 3S96A 2E7LC 4KUCF 1GVIA 2FJFA 2J6EA 3KPRA 3ZKNC 4X6BB 4JAMA 5ERWB 4EJ1C 1G9EA 2I9TA 3L3DB 4NPYB 1QLFA 3GJFA 4LFHG 5GS3A 3PABB 3QI9B 2QADC 2WWMC 4GUPB 5C8JB 4RZCA 2HT2D 3RPIB 4G8IA 5L2JA 5H35B 4ALAL 2ESVD 2WW8A 2J6EL 5ISZE 2UUDK 2DS4A 2X1XR 3GSXB 3ULUH 5CIPH 3TBVA 1X5GA 3HZYB 1KXTB 4HS6A 3CSYA 1EUTA 1IGFH 3CMOL 4PJHE 5IHUH 2NMSA 1VSCA 2PTTA 1UJ3B 1KG0B 1G6VK 2B4CC 1B0RB 4M5YL 5CEXB 1NCNA 1H3WM 2QJDA 2V5MA 3GDBA 3L5HA 4HQQL 4ENEC 2A74A 2HN7A 4PD4J 5TF1L 3LPFA 4WUUB 4HHAB 3MROB 1JGUH 4KJQD 3DTXB 5D2LF 1D5MB 3DUSB 5FDWB 1FG9C 3HG1D 4TSBL 4UDTA 4WIQA 3U48A 4M62L 3FOLA 5E94B 3TO4D 3VFRA 1H3VA 4DKDC 4OZHF 2F54E 3P73B 2H6PA 5C0RL 3FO9B 4FQXB 1XGUB 1MJJB 5IWLC 3BPOC 1LMKA 3O8XC 4OD1H 1U3YA 4KGJA 2EDRA 3IDNA 1KJVA 5KVMC 1QKZH 4HV8B 1HILA 4QXGL 4PJ9B 4HDIA 5F1KC 1BVKB 5DR5H 1KIQB 1PKQE 1ZKAA 2OS7A 2QEJA 3F7VA 1OB1A 4ZFZB 2FR4A 4W4NA 3PGCB 5IBUG 3SDCB 4NGHL 3IGAA 1ITBB 35C8L 1IAIM 5AD0A 5E8NB 4KZEH 4P4KB 4V1DE 4D3CL 5TQ2H 2VUYA 4YHIB 1SEBA 1JTTA 1IGTB 3D85D 5LCVL 5IQ9B 3OPZL 4R26H 4HBQA 3VXNA 3ET9F 3PL6A 4ISVB 4O9HL 3ES6A 1ORSB 1CCZA 3G6DH 7CGTA 3HE6D 5DMGC 5FYKD 2Y36H 3CUPB 4AIOA 1RZ7L 4MD5A 3JV0A 5DD3L 1NGWA 3FB6B 1LEGA 1JF1B 5I0DA 5I74C 1UYWL 4NQDA 5E7BA 5IESH 1I1AC 5E56A 4GLRH 4NQXA 1SJEA 4NKDB 1JWMA 4PJBF 1AR2A 3LN9A 4ZSOE 4HUXB 1CFBA 5DYOA 4Y1AD 2QADB 2AJ3A 3NIGE 4OIIH 3FKUS 1KJ3H 5EC1B 1WTLA 1QLRA 3DVNA 4TNVF 3PJSA 4KTDL 4R0LA 2ADFH 3DXAB 3FT2A 1C16B 1NCCH 1DQJB 1VFOA 4UDUA 1HH6B 3Q2CA 4HH9A 3S5LA 3CDCA 3AROA 5D7IA 3EYUH 1OARH 2UY6A 3QXDB 4YFEA 3C6SB 3IDGA 3CFJA 4DKFH 5J9PA 1MREL 4DN3L 1LILA 5DMYA 5FUCC 1IC5H 4XNQA 4BA8A 4MLSA 2FH6A 4ZOEA 3U1SL 1KT2A 3MLVL 2NTFA 2JJSC 3FMGL 4XVJH 4OCXH 4P9ML 4JANB 3KXFD 2ITDB 5EU4B 5L6YH 3DSFH 1T0MB 3SE3A 3RGHA 4ZO6A 4YFLF 4J6RH 1FNGA 1MIML 4CAGA 2VISB 4M7ZC 4AG4H 4NQEA 1MAML 2DQUL 3EO1B 3JWNC 5DUML 5GZND 3D6GA 4OFPA 2X1PA 5I1HL 1DN2A 5CJ5A 1N6VA 2WANA 1Z0NA 1VGKA 3BZEA 1CIDA 3CFKA 1V8HA 1G9NL 4RIRB 4PJAE 4KI1A 2QQKH 4P3CL 3MR9B 3QFJB 3PGFL 3BISA 3CFIC 3MJGX 3BKML 1F5WA 4XXCA 1AFVL 3FQXB 3LDBB 1WIOA 1B4JL 1U8IB 5EOTA 3D2UA 1J87A 3LQMA 3RGVC 4JO2L 1U8JA 2C7UB 4HS3A 1QRND 1RZ8A 4YXKH 3QIWA 2VXQH 5GGRA 1G0YR 4XZUB 1A0QL 3FT4A 3HUJE 5D5MB 3OKOA 1RIHH 2VAAA 2WQRA 3DMMA 1XT5A 4ODXB 3TO2B 3ZL4L 3AB0C 4LRIA 3UTSB 4LQFH 3MYJA 4WO4D 1C5DA 2YD8A 3FFDA 1MCRA 3QEHA 2MPAL 4ZOAA 3VFUA 2X89A 2EH8H 2ZP0T 4NZTL 1A9BA 2NXYC 2VDLL 4NBYB 5BJTA 4M1DH 5I9QB 1FYTA 1CLOL 2OK0H 2RCSH 2IANA 2DM4A 3G5YB 3GUTA 1OWRM 4K7PY 4ZUSA 2VLRD 3KPMA 4HAFA 4H20L 4XGZA 2FX7H 3Q1SL 3WNNA 4H26A 2FDBP 1FCCA 1G7JA 3G5XB 3TA3C 4EIGB 4FMKA 4CADA 1WISA 5C71A 5GRJH 3GMQA 1INQB 2ZSWA 1P4BH 4H0HB 1RIUL 5SWQB 2VDPH 5JQ6L 3X3FH 4U6VH 2AK4E 4XCEB 5HGGS 1ZAGA 1P4LA 1MFBH 1TCRB 4XBGB 1NL0H 4QHKI 2I27N 4OD2A 4S1QL 3X14A 3W82A 3DWTA 3KJ6H 4MA3A 3WMSA 4JFHE 5FYKU 3L3IA 4GRLC 3WIFA 2HRPH 4NRZA 4YHKL 4HT1H 3JWDC 2DBLL 1VERA 1K4CA 1EMTL 4XXDB 1BIIB 1H9VA 3C6LD 1A4KA 2EYSA 4XCYA 4B50A 4DK6A 3BUYA 3ARFA 4FQ2L 5F9DC 3ARPA 4NM8L 3OKMA 5MEQA 3DUUA 3BPLB 1OGAB 3TBSB 3HPJA 3DX9B 5A2KH 1BD2A 2XZZA 4GBXB 5GJTL 4TOYL 5BZWB 1MJ7H 3SGJA 5E9DE 1HHJA 5ESAB 4X4YA 1QACA 3QIBA 4NO5B 4D94A 1QR4A 3RTQA 5E8OA 3GMNA 1ZANH 1FQ9C 3U0WH 1DBAH 2NX5A 1N64L 3NA9H 1RU9H 4GH7B 5DQJB 3ROLA 1BM3H 4JG1L 4Z0BL 3RGVB 5MI0C 4LASL 3LKRB 4QRPB 5I18L 4KRPD 1YEFL 3RX8A 5HVFB 3PWUA 1XGQB 4PRPD 1MRDH 2CLZB 2NY0C 2LAAA 1FO0A 3VDBA 4G6AD 3CH1A 3O6FA 1BP3B 3RZCA 1E4XL 2HVJB 3BXNB 5IGXH 5E8DH 1G9MH 3HG1E 1G6RB 5SWSE 3ZE0E 5JHDA 3LQAL 4R90H 2Y72A 3QDHA 1LDPL 4OFIA 4PP2B 4KRNA 2X1WL 4CDHA 2BC4A 4P2YA 3V6ZA 1FFOB 4Y5XB 1EPFA 2R69L 2DQGH 2BNUA 3C87A 1JNNL 3K4DA 1FO0L 5I76A 3X12A 1EX0A 1OAUH 3V79C 4FXKA 5TPWL 3BRFA 5FO8A 4PRBA 1X6NA 2P5WB 3REWB 1FGNH 3V8OA 3CVHH 2WAHA 1A14L 4R4ND 1GGCH 5IFHH 1NFDB 1I8KA 1FIGL 1K8DA 1OY3B 3HAEG 4IOSD 3RKPA 1IKFH 1UXSA 1SHMA 1FNSL 3FONA 1RD6A 1J12A 2IH3B 3BWAB 5F1NA 1AD0A 1A7OL 4LMQI 5IVZB 3HI1B 5KSUA 2GJZA 3BDYL 3OBAA 4ELMB 2VDQL 4WTZA 4FRWA 1VADB 3QFDB 1F8TH 2UVEA 4OQTH 3LD8C 1U8MA 1ZSDB 3VWJB 5FO9B 3O3AB 3V6OC 1QSZA 3K4AA 4MQXD 4MSWA 1BX2B 3NPSC 4OFYA 1RQ5A 1JHTA 1PFCA 2OQJA 2VLKA 5KS9F 5FYKE 2P5EE 3ROOA 4NHUA 2GCYB 5HHNA 4GRLB 1E4JA 4OF8A 1IAOB 3U9PH 5ICZA 4XRCB 1S7RB 2B2XH 3FN9A 3LIZH 3ZT5A 4CN4A 1RI8A 5CWSA 2IAMA 1DVFC 1OPGL 5BMFL 2CIIB 2GITB 1BEYL 5C6WH 3O3EB 1GPOH 3KYKL 5JXAL 1CGSH 4X80H 2GI7A 3QHFH 1KFAH 1WC7A 4QXUH 4HGWB 3EOTH 4J8RB 2OZ4A 3KGRA 43C9B 4Y19B 1GHFL 4YFDB 5HPMB 1ZV5A 4XPAH 4F9LC 3SPVB 3RFZC 2XTJE 4JZNA 5GGSA 4EN3C 1KCKA 4OLYH 3VXOB 1JL8A 1A7NH 2XRAL 3BZFB 4R7NA 4S1RH 4JFYB 1MH5A 4FXGA 4PGZA 3U7WH 1DEDA 4YBLB 1MVUB 2Q20A 3WXWH 5FK9A 5C92A 5DJZA 4BK4A 2NY7L 3M8OL 5T3ZE 1JYXA 1GIGH 2SEBB 4GS7C 4WGVB 1A6UH 2OZ4L 1J8HA 2NY0B 3KPQA 3LH2L 4GKNB 3UX9B 4HUVB 2Z31A 3KYNB 1R0AH 4ZO9A 1JP5A 1NUDA 3TJHD 3EW3B 3UJJL 1T1WB 1S9VB 1U58A 4POYA 1CK0L 2NY6C 3NGBB 3QEUA 4O51A 1G7MB 3H9SA 4KI5C 1FORL 4XAKD 5EFIA 5MEOB 2CH8A 1BFVL 2XN9A 5T33H 2C3GA 9CGTA 3HAEB 1FZMA 4PV8A 1Z2KA 4MZ3A 5JOPD 4XMPL 5FGCE 1DQMH 2ZSVA 4UQ3A 4CJ0A 3FQRA 1XR9A 4S10A 2GUOB 1CXFA 5DWUL 1MI5E 2ZCLL 1NGQL 3T04D 2F58H 3KPNB 1OAYH 4ZPTB 4LLDB 1MCEA 1SYSB 5DD1L 2VDKL 4LLVA 1XAUA 4MXWH 1R5WA 1F58H 4NBZB 4OZ4A 4X6CA 3QPQD 4U7KA 3B5TA 3HZMB 1R3JA 5B3JF 4M6ML 5D72H 3RI5F 5C70A 1EO8L 3L1OL 1GGBH 5D7LD 3JTTB 4KHTH 2F74A 2WZPD 5BS0B 3CXHK 4M7KL 1BJ1H 3R1GL 4JN2B 4FFYL 4I2XB 2D0FA 4ZQKB 1NJ9A 5J3HC 3FTGB 2RFXB 3N1FC 1B2WL 1DLFH 5IWLA 3S35X 3O8XA 2GAZA 2DDQH 3QQNA 3LS5H 4OAWA 4WFEE 3MJ7A 1KJMA 1T5WA 7FABH 3T2NL 5IQ7H 1J5OL 4PRNB 3BD3A 4N0RA 1XZ0A 4Z77A 5C0EB 1FPTH 4PJEF 4KUCD 5DRNB 3D39D 3RUGE 1VFMA 1QD0A 1CIUA 4LLWB 1T2JA 2DQTL 1NCUA 3BIBX 5ALBL 5EZLB 4ZS6C 2Y5TB 4JQIL 3VXRB 3VFGH 5J12C 1BQHG 2DI8A 5MENE 3BSZH 4JB9L 4JY5H 4MJ5B 4LHJB 1PX3A 1D5BB 3RWGB 2GYSA 2X4RA 1RVFH 1OTSD 2UZXB 2XZQH 2HFFB 3EO9L 2PYEE 3OJ2C 2DD8H 5FKPB 1EJOH 2GFBB 1S7TB 3BE1L 3D0LA 4MQSB 4CU7A 3QUYA 4LSDA 3BW9B 5MEPA 5D2NA 3D3VD 1CG9A 1I1AA 1CD9B 1RZKL 5KSAC 5E6ZA 3BD4A 3INUH 1T80A 1YPZA 4JFED 2BNRB 4GS7B 3TPUA 4L9LB 4R97C 1DTUA 3DETD 3DNKA 4JEGB 4OFDA 2BVOB 3QRFM 4LDLB 4YQXL 3MNVA 1EERB 1ZWIA 2FO4A 4JGJA 2EKJA 2NY6B 2PO6C 4YGVA 1CBVL 3GM0A 2APFA 4U33A 4QYOA 2P7TB 2GIYA 2RAMA 3VFWA 3OR7A 4EBQL 4BFIB 2H9GA 3TF7C 1QBLL 4AMKL 2YD9A 4QHUA 1NC2B 3LS4H 4PBVC 5EZJB 1D9KB 4IMKC 3V7AE 2Y23A 3ZE1F 4BQCA 3BD5A 1SBSL 1YN6B 3T0DA 2VXTL 1Q38A 4PGCA 4LEOB 3TIEB 4OZFB 3CFEB 2GJ6D 2AJXL 4FQIL 1T3FB 1P7KB 3MPCA 4AZ8A 4UAOC 5AYQA 4N1HB 5LGHH 1FL3B 5CZXD 5C0GB 2E6PA 5CJQL 1T1YB 3ZT6A 4PRPE 5IVXF 1YECL 2XV6B 2B1AH 5H8DA 5E2TL 2EXYC 2F53A 4LLYA 3SDXE 1CLYL 2NY5C 6CGTA 4UTAL 4G9FB 5GJSL 5EO1A 1U3JA 4MX7A 4QRRB 4JRYE 4P5MB 5E6YA 5B39A 1BQHB 4YC2B 4BSJA 2OSLA 4ODWA 3SBWA 2Y7QA 4CVZA 2X4QA 3IVKA 3LN4A 3H3PL 5EOQH 4MA8L 4PRHA 2JB6B 1S7UA 1WT5C 3B3IA 3ARGB 4WU5B 1K4DA 3Q5OA 3O4OC 1IC7L 3MRRA 5IBLC 4PJ7E 4RFEA 4UTBH 1VFBA 1IQWL 2QQQA 5DEFA 5F89B 2AXJA 2MCG1 5J12B 3NBNA 4OGZA 4POZC 1KCRL 3DRTB 3SKMA 3NAAH 3S96B 2FWOA 2MCPH 3KPRB 2VDOL 2ZPKL 3PWLB 3BEVA 2IPTL 5BVPL 2XYCA 4YLQT 4XPHL 3QDME 2I9TB 3QCUH 1AXSA 1TJHH 1QLFB 3CU7A 3HB3C 4Z7QE 3L3HB 4EEEA 5HHXL 1A7RL 2PR4H 3QNXA 2KKQA 4JE4B 5HDOA 3PWPD 5IMLB 4G8GD 5GIRB 3L7EA 5I15L 4XPBL 5J0BA 4KFZC 5K9KA 1MFCH 4EUPA 4M8QA 5KANG 4R97B 4HS6B 3CSYB 4NN7C 2Z92A 2VDMH 4UV4H 1OAQH 1OTTD 4PJGA 1U0QA 2DYPD 1W0WA 1S3KL 2PO6B 1PDKA 1XGPA 4H25A 1IGYB 3VD7A 1HSAA 4PRDA 1KF9B 2A74B 3IRZA 2HN7B 4YDKH 4QHLB 3S5LG 4EIZC 1PD6A 5I6XB 2R8SL 3V4PL 5B22A 5GGQL 1UCBL 1U2HA 3W11D 1ERNA 3VW3L 3WE6B 1N4XL 3KYOB 1C08A 4M6NL 3H9HB 3P4MA 1GC1H 2P49B 4URTB 2ZG2A 3SKOA 2VXVL 3SDAD 1E4KC 4F9PC 3V5DA 3HE7D 1X5HA 3RBGA 3NN8A 1XGYH 5IT2L 5EWIL 1TVBA 2DQHH 3RWIA 5CEZE 1HEZB 2KZ1B 1RZFH 2DWEA 3OKYA 4F58L 4WW2B 4BH7A 1ZLVK 4LPXA 1RUMH 3GIZL 3MRKB 3N85H 3IDNB 3KLDA 4KK6C 5F8QC 5I1DB 4Y8AA 3QWQB 5T1KD 1HILB 4UNUA 4HDIB 1J10A 1L7IH 2HTLC 3K81A 3VRJB 4FQ1L 2PUQT 2F15A 2A1WL 3F7VB 1XF4A 3BKYH 4LOUD 1M6OB 2BXYA 2FR4B 3BJLA 3SE9H 4LVEA 5IFAL 1DBML 2VITA 3IGAB 1ETZB 4XAKE 3VFPB 2EIBA 5HGAA 3I2CL 1SEBB 3KPLA 5F7DB 3O4OB 2FJGA 4WW1B 5BZDB 3ULUE 2VWEE 2HH0H 3K1DA 1MCHA 2HT4D 2PTUA 4YO0A 4N90E 4MD5B 3FB7A 1M05A 1NGWB 3FOMA 4NM4L 4N0UB 1LEGB 5M7QA 4RAUA 3EKCA 4LQ1A 3ZSTA 2OX5A 5K9JL 3CZJA 4XHJC 4NQDB 3CX5J 4EI5A 2XPGA 4YDLC 3FRUA 1SJEB 4OGYH 3HAEH 3G9AB 5C0AE 4EVNB 4ZUWB 5DYOB 4PTUB 2AJ3B 2VR9A 4L8SC 1SJVA 4LGPB 1QLRB 3RWEB 5D1XD 4EXPX 5A2FA 2HJLB 4N8PA 3DVNB 4R0LB 4NQUA 1HKLL 1IAIL 4RMQA 5CBEA 3PDGA 4HH9B 1U8OA 5C07E 4C83B 4HWEL 1IILE 3MLTB 2LU7A 3FO0H 3IDGB 3IFOA 2HYMA 2EYTA 5HHOE 4QEGA 4X6EA 1NBZB 1EFQA 1T66D 3VXSE 1FP5A 5CGYC 2H2SC 2P4AB 1D5ZA 3D39E 4G5ZH 4ETYA 2NTFB 3EDDA 3MLWH 1BQSA 1AP2A 3S98A 1J0JA 3CSBA 3TZVD 4YE4H 1FNGB 4QRQB 1FFRA 1S5IL 4HCRH 5IV2A 4MJIE 2W1NA 4TULH 3VRIA 2XWJA 5EG6C 3GHEL 4U6YB 4ZXBC 1KB5A 2VAJA 5DVKA 3MLXH 1UWGL 3T09A 4C56E 4QNPE 1UJTA 3ISWA 4OUOA 3WHE0 1L7TL 1XH3A 1NGPH 5DC4B 1DVFA 1WWAX 4OZIB 1RZJL 4YHLL 1YEGH 4NRXB 4N0FB 1X5XA 4K7PX 4L4JA 1KCLA 4Q97A 1HDMB 2L7JA 5ADOH 3RIFK 3QEQD 3A6CL 1KB5L 3D2UB 4YUEL 3BN9C 4BQ9A 3WYRA 3I6GB 2ZUYA 4NZRH 2DQIL 1U8JB 3CZFA 4HS3B 4NO2A 2XNAB 2EE6A 3GSRA 1R24B 3MRIB 1CDGA 1FBIL 1GSMA 4EN3A 1AGCA 1QPXA 4YBHA 3FT4B 3HMXA 4JM2C 3U4BH 2WP3T 1KB9J 4E41D 5E2UL 3VD5A 2AQ1A 3BH9A 5C0BE 3TT1H 2HTKC 4OZHE 1MLBA 1D5IH 3MBEC 2BNQA 5K9QG 1CGUA 2AV1B 1N6QH 3T2QA 3WN5A 3V7MA 5E5MA 5AZEL 3T77A 3U0PB 3F7YA 4ZFGH 3EOAA 1XIWC 5IEKA 1X5IA 2EE2A 3CD4A 3HMXL 4EI6A 2UV3A 3G08A 1B3JA 1MCSA 2ICWJ 5BJTB 1KV3A 2DB8A 4RMUA 3WD5H 5BVJA 1UM4L 2J8UA 2L7UA 3QB7C 3KPMB 2VDRH 4X7SH 4HPOH 3X3GH 4JFDD 5CUSH 4LCWE 4XB7A 1NFIA 3VI4F 3QDAA 5GS0L 3ZT7A 5HYJD 5A40E 4P59H 1H3XA 1JWUA 5L2KA 4HIXL 2DLIA 4QWWC 1GL4B 5SV3A 2GJJA 5EO0B 5FYJD 3HC0B 1LD9A 1DUYA 5C9KA 4Q9QL 2ORBH 1KEMH 5EU6A 4FQQA 2F5BH 2NY2C 3CDYA 3BN3B 2G60L 1C5CL 3GSNH 2VJXA 4Y8DC 3LN5A 3SOBH 4R2GC 1R5IA 5ID1B 5GSRB 4WFHD 4OD2B 1OAZH 3AUVA 5FA4A 3X14B 5F9OL 3EFDH 4PJBE 1WCBA 3L3IB 3WIFB 5H37G 5J06A 3WLBA 3P4LA 3STZA 1RPQA 4WTZG 5T3XE 3O4LA 4ONHB 4RX4D 4XCYB 4M7LH 3BUYB 3B5HA 3O3UN 1MFDL 3NIDE 3ARFB 4AEIL 4ZXBB 5C09A 1FHGA 3PIQB 3VGDA 4BFEA 4JFQA 5C0FA 5DMJB 1BD2B 1RHHA 1V05A 4PJFB 1MJUL 1FZKA 2H1PL 1PG7W 3G5VA 3EIFA 4LHUB 3B2UD 3QIBB 3O9WD 2YPLA 2W65A 1J0KA 3MRFA 3BZ4A 4S2SB 5E8OB 4YZFF 2CKNA 4Y4FA 4HUWA 5EN2B 4ALAH 2NX5B 3BIKB 2J6EH 4LGSB 4XX1E 5AWNL 5JPMA 5D9SA 4EXKA 4U31A 5CP7A 1Q9KA 4JJ5B 3GJFH 4FFZL 2HFTA 1P84K 3CMOH 5KJRL 4OIBA 3PUCA 1T0NA 5AUMB 4M5YH 4HH8A 1N8ZB 5KSAA 2BP3A 3MCKB 4HQQH 2IBBA 2NXZB 3O6FB 5ELIA 5LWYL 5TF1H 3MBEB 1VPOL 4NCDA 2Q6WA 3BH8A 4K3GA 2VE6B 1U2CA 2XA3A 4HIIA 4TPRH 5F6HI 4TSBH 2OI9C 5IMMA 1S7WA 4LARL 4M62H 1XIWB 4MMXC 4U1SB 1BWWA 3VXMD 2AV7B 5FHBL 1KTDA 2P45B 5D96C 4DW2L 5C0RH 4ZO7A 1W8OA 4BSVB 1A6WL 4RGND 1XGTB 1SY6A 1K8DB 3KLHC 4QXGH 3QDJA 2ADIB 3S9DB 1UXSB 2JF1A 3MRJA 1DP0A 5F1NB 1S9YB 1UT9A 5K59E 5FYLL 2J1KA 1UH2A 3QG7L 5SWZA 3UDWA 4KKBC 2NY2B 3W5MA 2R1XA 4DVBA 3ABZA 4NGHH 35C8H 3C8KB 4R2GB 4Z7WB 1NMCC 4D3CH 4MSWB 3REVA 4KJYA 1SY6L 1RURL 1IKNA 2VLKB 4OUUA 4LLUA 2HG5B 5LCVH 1YY9C 1F4YL 3ROOB 4RDQF 3F7QA 3OPZH 4O9HH 3ARDD 3MOBL 3IDUA 5CLWA 5KG9A 1FL6B 2A6IA 3OAZH 3EFFA 5CCKL 1RZ7H 4GRMB 5DVLA 2Y9RT 1T04A 5DD3H 2H45A 3GSVA 2IAMB 2P43B 2CMRL 1UYWH 2G75A 4NFCA 1YJDC 4BYHA 2AAVA 2JCCF 2ADJB 1U3HD 2ESVA 4YHPA 4LDEB 3KLAA 1WFNA 4IS6A 5AZ2L 1GOFA 1BPVA 4X5WB 4K8RD 1QSED 3V0WL 4P4RA 3B9KD 4JFFE 4KTDH 4MA7L 3JWOL 4JZNB 3L5XL 2XWTA 4UBDD 2D0HA 2HA1A 3WL9A 5GS2H 1UB6B 4G80B 4ZDHA 4CN6A 4FXGB 3VMOA 4FNLL 1MREH 5HGDA 3QO1B 4DN3H 5FK9B 4YX2L 1BBDL 4L4TD 3I6KA 5ICYB 4NNXA 4FG6D 5E1AB 1J8HB 3U1SH 3MLVH 4OF7A 3FMGH 4P9MH 3WFEL 2Z31B 4YDVA 2NY1D 1HH9A 2BVTA 1IBGL 3TO4A 3FFCA 1LO3L 3DECA 3L3OA 4HXBL 2E6JA 1MIMH 5GS1A 3QEUB 5BOPA 1UFUA 3Q6GL 3H9SB 3Q6FA 1MAMH 2DQUH 2XN9B 5DUMH 4PV8B 1CN4A 5EPMB 4XB8A 1U8HA 2OL3A 1FSKC 5I1HH 2O26U 1T4KA 3QQ9D 5D96B 3SDDC 2H8PA 5KSBA 4NQCD 1EEZA 1F2XK 1G9NH 4YBQC 4P3CH 3AAZB 4LLVB 3PGFH 4OZ4B 1HQRA 3IU4L 1AKJB 3BKMH 1R3JB 1AFVH 5B38G 3AMKA 1B4JH 4MDJB 3ARXA 2R39A 3D25A 1OL0A 2F74B 2OL3L 4QOKD 5GZOC 2VLJE 3QUXD 4JO2H 1E4KA 3MMEB 5F1IA 3D85A 3DX6A 4MD4A 1Y0LA 1NJ9B 1BAFL 4QTIL 5IROC 1A0QH 3WNPA 1XR8B 3HE6A 3IDJA 1JNHB 4ZFOA 2GAZB 2GKIA 1CFTB 3VFVA 2IMMA 4OAWB 3ZL4H 5GHWL 3CVIL 2P8PA 1MCCA 2BMKA 3K8LA 2VXSL 4YJZL 1NFKA 5HHMB 2MPAH 4NKOB 5DHVA 4P2QB 3ARBC 5D7KD 3R06A 4Y1AA 4BKLB 4NZTH 5DTFA 1KN2L 1N26A 4X7TB 4PGBB 5LVEA 2VDLH 4ZFOL 3L6FA 4CMHB 1CLOH 5B39G 3O2WL 1U93A 4PY7B 3EGSA 1IGJB 3BEWB 4LSPL 4RQQA 5C6PB 2VABA 5GISL 1S7VB 5J56B 4L3EE 3KYMA 3O3BA 1VKXA 3Q1SH 2R0ZL 4J3TA 5TJWK 3TJEL 3MUHL 3CCHA 1WAAE 4G8EA 1A3RL 3D0LB 4RGMC 3QUYB 2GK0A 4MXVF 2ARJA 5ECJE 5MEPB 3KXFA 2E9BA 2V7NB 1RIUH 3LKOA 3MRNA 4TNWK 5JQ6H 1YPZB 1QFWM 3WIHA 4WDIB 2W0FA 1IGML 4NC0B 4NOFA 5I75C 3TPUB 1RIVL 3O2DA 4L8SA 4S1QH 3RI5K 1LO0L 1JWSA 4QRTA 1QTYT 1XGRB 3WHXB 1AO7D 2JJVA 1XCQA 4YHKH 5BRZB 2DBLH 4JZOA 3VWKC 5DURB 4U1KA 2X4UA 3QFJE 1BVLA 1EMTH 1LK2A 4PJ5D 1NCDL 4QYOB 3RNKA 5HBBA 3N50A 3VFWB 1C1EL 3WIHL 1A6PA 4U2ZA 3OR7B 5B38B 5I1JL 4FQ2H 1AR1D 2H9GB 4NM8H 4K9EC 1VB9A 1T83A 1FV1A 3O2DL 4QHUB 1LGVA 4KXZH 5HGHA 3T3PF 3KPSA 3WXVL 4EUPG 5IJVA 4CW1A 2FRGP 1II4E 5GJTH 4TOYH 1EO7A 3C5SA 4YHOL 2WBJB 4PGCB 3GMLB 3WS3A 5D5ME 4GW4B 5D1QC 5LKNA 2ED8A 2WK2A 1OGTB 1N64H 2DL9A 1WZKA 2GHWB 2EDQA 2I60L 1P5UA 3UTSE 4JG1H 4FTVA 1J86A 4Z0BH 1IEBB 5CD5C 2YWYA 4LASH 4JZJA 5I18H 4WO4A 1YEFH 4KROD 1T22A 3CNKA 4M93C 2IPKA 4YNYB 4BFGA 2K3TA 1NAMA 4G6FB 3LEXA 3VGBA 5EO1B 1KLGA 2X1OA 5B8CA 3JV4A 3SEPA 2R1WB 1E4XH 2UYLB 2X4QB 2E7CA 4KHXL 1W8NA 4OLEA 4ZTPL 3LN4B 3SE4C 5LQBL 4JG0L 1EIBA 3SDYH 3LQAH 3FB8B 4FFWC 3ARBB 1K4DB 2VKWA 4JN1L 2VLRA 4LAJH 4C4KT 2R69H 5FDYA 4RFEB 1VFBB 5DEFB 4Z7VA 1JNNH 5JR1L 1NAML 4JM2A 5JPNA 1NEZA 1FO0H 3ARWA 2CUMA 3QEGL 3QXAB 5TPWH 4PJIB 3SKMB 4GAYB 1JUFB 4ACPA 5HJ3B 1H15A 4OCRL 1HXYB 1I8LC 5DK0A 1A14H 4LSRL 3WV0A 3U4AA 1FIGH 3TNNB 1A6ZB 4OGAC 1H8NA 5I1LA 4L4VE 2CJUL 1FNSH 2BXZA 4Z7OE 3CAFA 1A7OH 1KLUA 3BDYH 3DPBA 4K7FA 1NLDL 1JRHI 2VDQH 3E0GA 1TZIA 3RVWD 3K4ZA 5LAXB 1ULVA 3EJYD 1TLKA 1E27A 3VXQB 1F02I 2CIKA 4CJ1A 3L7EB 4NFDA 3AC0A 3OKKA 5I75B 2WLYA 1BFOA 5C0JA 1X5JA 2WBWB 5K9KB 5KSVB 3C6LA 5ESVB 4EUPB 5EBLA 4HFWA 1FN4B 5DFVC 4NT6A 4CGTA 1KIPA 3RX7A 3RVXD 3NCYP 1WITA 4PJGB 5I2IB 4NN6C 1YMMD 3QG6A 4N0CC 3VWKB 2ID5A 4HMCA 4LCIL 1LEKA 4OBRA 4H25B 1HSAB 4WWKD 1MOEA 4ZNEE 3R0NA 1QSFD 5F9WB 1NUFA 1OPGH 1J0IA 5BMFH 4PGEA 5DUBB 1BEYH 1M71B 5HYQB 3KYKH 4KQ3L 5T1LA 5JXAH 1MUJA 2XI9A 4CDGC 1O7VA 2RJMA 4JPKL 4J4PD 1JZ8A 3EHBC 1JYNA 5IF0A 2YWZA 3QIUD 5C0CB 2ILLA 2QR0A 4F2MA 2D03L 2AJVL 1GHFH 5SV4A 3P4NA 3V5DB 1RUKL 2WWKO 3CDGA 1P4IL 5D1QB 3R8QA 3SY0A 3ALXA 4UNTA 4P57A 1TTGA 3V6BR 1MRFL 5E08L 3UTPD 2C1PB 1X9QA 1IAKA 4BH7B 2XRAH 3ZKXB 5D7JB 1HHGA 3CFBA 2B20A 1RZGA 2NY7H 3M8OH 2VZ3A 2YUZA 3ZTJG 4PLJC 3DURA 2OZ4H 1W2KT 5E95B 3LH2H 1CF8L 1FG2A 1XF4B 4X98A 2QHRL 4QY8A 1JV5B 2G2RB 3BFOA 1JHLL 3ZE1E 3UJJH 2OXHA 1CK0H 2DBJA 5C1MB 2P5WE 5HGAB 1MHCA 2HMIC 4UUJB 1AGDB 4F80A 1BFVH 1NFDE 2YHGA 1NDGA 3IJSB 4PG9A 1ND0B 1YY8A 4XMPH 1X7QA 4KK8C 4TQEL 5FB8B 4X4XA 5DWUH 2ZCLH 1NGQH 4NIKB 5EUKA 3FOMB 1K2DA 2B5IC 4RAUB 5DD1H 2VDKH 3EAKA 4I18A 2P8LB 2GT9A 3WDIA 5FV1L 3QJHA 5IMOB 2XPGB 4X4ZA 4NN5B 2XKNA 4QOKE 4RMSA 4WNQB 4DUWA 1CU4L 1NPUA 4M6MH 1EO8H 3L1OH 3MLUL 1JNLL 1H0DA 4X7DC 2ZUQC 4M7KH 3Q5TA 4HJGA 3UJTL 3R1GH 4FFYH 4R6UA 1OVZA 2NR6D 5ISZB 3EYFA 5LBSL 5A16A 5J13B 4N8VA 3QISA 1B2WH 1U8OB 4P2RA 5LGKA 2BVQA 4I77L 4ODTL 2CK0L 3PGDB 1DDHB 3HS0A 1EFXD 2EYTB 1Q9OA 1GGIH 4NQSA 3FQTA 4X6EB 1I1FA 3T2NH 4X8XA 1T1ZA 5IIEA 1J5OH 1G0XA 3QNZA 5CBAA 4TUJB 4MJ4A 2KBGA 4FZEL 3NH7L 4IIQC 3T4AB 3W0WD 2DQTH 1TENA 2UWEA 5ALBH 4XVSL 1I4FA 4JQIH 3BQUD 1RULL 5J6HB 3OXSB 4JB9H 4PLKC 5IV2B 4WHTB 1OT2A 1PEWA 6FABL 3RDTC 5IEHA 1RK0A 2P44B 2F54B 3FHQA 3EO9H 4KV5F 1CGTA 4DK3A 1BOGB 1I3RA 3CLEL 3KPPA 1WBYA 2Q86A 1CLZL 4OI8A 4PP1D 1XH3B 3BE1H 2YPKA 5HYSA 3H6JA 4X6FA 1QOKA 1RZKH 3S4SA 3G6JE 4PB9L 3SGDI 3F7RA 4DCQB 1PKQB 3IS1X 4TTDC 1PYWB 3MLPA 4IRJD 4MNQD 1AO7E 1OLZA 3T0ED 4NO2B 4V1DB 1A3LL 2YN5A 5DI8A 2WV3A 1CICC 4YQXH 5BO1L 2CRYA 2UZYB 4G6ML 1YJDL 1CBVH 2JE8A 5MP6L 2ARJQ 1MLBB 1Z6JT 4RRPG 4EBQH 5DSCA 3D69A 5GS2D 1QBLH 4AMKH 5C0ND 2BNQB 1KENL 2YXMA 4Y2DC 2XFXA 2ICES 3WN5B 4LIQL 3T77B 3VGFA 3S3JA 3IJHA 4Y5VA 2JJWA 1B4RA 4I2XE 5D7LA 4RAVA 5GSVB 2ICWA 1SBSH 5INCA 3S88L 2B5IB 2VXTH 4XBPA 5EZOL 3H8NA 4D0CA 3AY4C 4ZSOB 4W4OC 4WHCA 2AJXH 2OR7A 4FQIH 1K9TA 3ZKMD 1HYSD 3NTCL 5BVJB 2QSVA 3TNMB 3U0TA 3GKWL 3CC5A 5CJQH 5D1ZD 4H5SB 2EIEA 1A6AA 1YECH 2R2HA 3UAJC 5E2TH 4QRUA 4GQPH 3SDDA 3FQNA 1CLYH 2Y6SD 2EDWA 4AK1A 1P9MA 3OF6D 4UTAH 3RWFA 5GJSH 4DZBB 5T5FL 3ALWA 4HIJA 4HD9A 4ERSL 1LD9B 2NQCA 3VFTA 4YAQA 1DUYB 5AEAA 3VXRE 1F90L 4FQQB 4PJCF 1J0YA 2FNBA 3H3PH 1CL7L 4MA8H 1YYML 3WJLC 3NZ8B 5E4EC 1JI2A 4LK4A 3LRSB 4N0YL 1P6AB 3HKFA 3VE0A 1BZ9A 4M7JL 1D6VL 3P9MA 2APWA 3DX7A 1IC7H 4ELMF 5HVHB 4XMLL 3DBXA 3L3KB 5FXCH 1IQWH 1TITA 4TYUA 2CDEA 1V7NL 2VN4A 3O4LB 3GSQB 5ADPL 1KIRA 1U95B 3ZKQD 1KCRH 3J8F7 2A6KB 3MREA 3D3VA 2VDOH 2ZPKH 3RDTB 3UBXI 2IPTH 3PE9A 4MVBC 5BVPH 1UQSB 4PJAB 4R3SB 4XPHH 2CDFA 4CVUA 4XVUC 1VESA 5IFJA 4JFEA 2DLHA 5SX4I 1FZKB 2BHZA 3MV8D 4MJ6B 3LQZB 5GRVL 4G9DA 2OMNA 5HHXH 2YPLB 1Q72L 1A7RH 1ORQB 1MCDA 4J3XA 4PJDA 3E6FA 3PP3H 3QIWD 1DLHA 1HQ4A 4UI2A 4HUWB 4LLQA 1KXVC 1AE6L 4PRID 5I15H 4XPBH 5D93C 1J1XL 3HUJB 1X6LA 3J7HA 4HJ0C 2KDGA 1QA9A 1CICB 1BQUA 2GSGA 3K2UL 2FECL 4HLZG 3MRMB 1S3KH 4RWYL 5C6TL 3G9VA 3LKSB 3RY4A 1I7ZA 2WQ8A 4DGVL 4X6DE 4P5TD 3TVMD 2R8SH 3V4PH 2Q6WB 2GJ6A 5GGQH 1UCBH 3T0WA 3GSWA 3BH8B 1NC4A 2IH1B 3OQ3B 1CD0A 4EUPH 3VW3H 1N4XH 3VI3F 4M6NH 5JXED 3UYRL 5K9QI 1QRKA 1S7WB 4JPVL 3SCMD 2VXVH 3QZWG 3EO0A 1NBYB 2YRZA 1KTDB 5IT2H 1DBKL 5EWIH 2CUIA 4B0MM 1BZQK 1T21B 4F58H 3KLSA 2GQHA 3GIZH 2VLLB 3NFPA 1JPSL 3AREC 3G6AA 2W9DL 1RV6X 3SO3B 1ZT1A 5DJ6B 4MZ2A 2JELL 2AK4B 4FQ1H 5GGVY 3IETA 1TQCC 1TIUA 2A1WH 1L9MA 3KHQA 2FBJL 5IFAH 3HI6L 1DBMH 3DVGB 1MCWW 3TLRA 3KPRE 3I2CH 1SM3L 3Q0HA 3LMJL 4N5EC 4Y88A 2ZJSH 4NYLA 4ZUVB