3VI4F

Crystal structure of alpha5beta1 integrin headpiece in complex with rgd peptide
Total Genus 38
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
38
sequence length
218
structure length
218
Chain Sequence
QVHLQQSGAELMKPGASVKISCKATGYTFTSYWIEWVKQRPGHGLEWLGEILPGSGYIHYNEKFKGKATFTTDTSSNTAYMQLSSLTSEDSAVYYCSRALALYAMDYWGQGTSVTVSSAKTTPPSVYPLAPGSAAQTNSMVTLGCLVKGYFPEPVTVTWNSGSLSSGVHTFPAVLQSDLYTLSSSVTVPSSTWPSETVTCNVAHPASSTKVDKKIVPR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Cell adhesion/immune system
molecule keywords Integrin alpha-5
publication title Crystal structure of alpha5beta1 integrin ectodomain: Atomic details of the fibronectin receptor
pubmed doi rcsb
source organism Homo sapiens
total genus 38
structure length 218
sequence length 218
chains with identical sequence H
ec nomenclature
pdb deposition date 2011-09-21
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3vi4F01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3vi4F02
4JO2L 3MUGB 4FFVC 1Q9OB 1S7RA 5CZKA 1X3DA 5EU6E 4Q9RH 3AS2A 2EECA 3UJIH 2G75A 5E8OA 4N68A 3TT3L 3S88H 4NQCD 2CH8A 4XXDB 2BDNL 4KV5E 1G7MB 3FQUA 1YNTB 2P49B 3LZFL 1J86A 1R3HB 3IDIB 4PGEA 4DZBB 5IESH 1CLOH 3HS0B 1NGQH 1S5IH 4I0PD 5C6PB 4KTDL 1OSPL 1AKJD 1NDMA 1KJMA 3GUTB 1UQSB 3ARUA 3M17A 2OYPA 5FO7B 1TZGL 3LSOB 2YUXA 3IFLH 4LSSL 4HMDA 3W9EA 3JWDC 1KEML 3SO3C 5BS0A 1A4KA 4FZ8H 5CILH 4QOKB 3T77A 4G6KL 3LRSB 4GAGL 3V95A 1IGMH 2QSCH 4R0LA 2A2QT 3FAWA 2G75B 4J3WA 4HUKB 1MHPL 5EN2A 2BJMH 3W81A 4QNPF 3RY6A 5T1LD 4ZS7L 5FDWB 3HE7A 4J12A 1FLRH 2M1KA 2NY6B 4KWUA 5JOFA 2MPAH 2J8HA 4U0QB 3TIDB 5KZCD 2JCCF 4DZ8A 2P8PB 2HA1A 4LLAA 3VXSE 3GDBA 1WBZA 2VRAA 5DUPL 3UTQA 1S3KH 1S9YB 1NFDE 2GT9A 3HMXA 1NLBH 1KTRL 1NBZA 3SDDA 4E41B 4XC3L 2QL1A 3OAUL 3PL6C 2NQCA 5I1CH 2FGWH 3U48A 4DZ8B 4IRJA 3DUUB 1MCWW 2X05A 4LPUA 4XPGH 1WBZB 4BH7A 3TYGL 4UV4H 1PG7X 5IB2A 4UZGA 5IVZA 2GT9B 1F4WL 3NZ8A 2PYFB 1ZVSA 2MQCA 4QXGL 4IIQC 4J3UA 3JVGA 1AR1C 3HPLB 3MPCA 4LLDA 1X5ZA 3BGFC 1OAXH 5FK9B 3HNTL 3TO2B 3MA7B 4GT7A 4OQTH 4JPWL 1FAIH 4OUUA 4NCC1 1KNOA 1QLRB 5SWSA 4I0KA 1FRGL 4LHJB 2QADD 2HKHL 3B5TA 2R0LL 3QWRA 1QA9A 4X6CB 2GI7A 3UO1H 4ELMB 3OHXA 4MQ7B 1SVZA 1JNHA 4P5KB 1JZ5A 3RTQB 2XA8L 3NAAL 3QEQA 4HFWA 1A3LH 3VG0L 3NZHH 1ZEAH 5DMJB 5FA4B 2PTUA 5F1KC 1FH5H 1CL7L 1OAZL 3H3PL 3DHJA 4LIQL 1LP9E 3BRFA 4Y4HC 4JKPH 2EEAA 5D5MB 4LHQB 4R4FL 2H6PA 3JWOC 5HGDA 1A9BA 2XKNA 4YDLB 2DIJA 1BOGA 1HXMB 3MV8E 4P4KC 4V1DA 4Y4FA 4EVNB 3HB3D 4HUWB 3BEWB 2ZG2A 2E7MA 4AYFA 2FR4A 4K2UL 4YO0B 3QNZA 2J6EL 1AXTH 3MLYH 3DO3A 4DFHA 5CGYC 4NKIH 1HSBB 1QVOA 3L3KB 2F53B 3S37H 5E6ID 3UTZA 3GIZH 3DROA 1YEJH 4TVPD 1MREH 2VE6B 32C2B 3OZ9L 4ODSH 3BMWA 5JXAH 3S34L 3KDMB 12E8H 2Y7QA 4D0CB 1BEYH 2ICCA 2WM0A 3L5HA 4ERSL 2DQHH 1MIMH 1UB5A 5B3JE 4PJDA 2RCSL 2FR4B 5GRXG 5C0RH 2ZUQC 5EO1B 3QNZB 4JFFE 4ZO9A 3HA0A 3WL9A 2AJYL 3QIBB 4YHOL 3BPCA 4BKLA 4XCCH 4P48A 5JLZA 3PJSB 4BUGA 4C83A 4K23H 3UTZB 3NCEB 3G5ZA 3CH8A 3KPMA 4M9OA 4F37F 3X3FL 4HUVA 3WUWA 1CE1H 5JPNB 3FQWA 2YEZA 5IJKA 4PJDB 4PRIB 4IRSD 3V8OA 1X6LA 1N6QH 2JK5B 4NM8H 4L9LB 1D5XB 4KY1H 1KIRA 4JZOA 3CXHJ 3BZFB 5B39G 5JLZB 5D2LF 2IAMC 3MR9B 4W68A 2CDFA 1PGRB 3KPMB 4KK5D 1I1AC 2QSQA 3VGAB 3QNYB 4N1HB 1P4BH 2FEEL 5DUMH 3KLAA 3KWWB 4HUVB 5HGGS 1NC4B 1ZSDB 3RWHA 5DO2D 3ULSB 3MNVA 5A2KH 2DQTL 5E8DL 1MCPL 1UM6L 1RY7B 2P8LA 3SCMB 1CLYL 4M6OH 4LASL 4YHKH 2B1AL 5I73C 1RUAL 2VISA 4IJ3C 5C2BL 3KJ6H 1T1WA 1KJ2B 3DMMC 1K4DB 4QRPD 1X5KA 4ZUVB 2Y6SC 4WNQA 4GMTH 1Y0LA 4NFCA 1LEIB 5D1XA 2UWEA 5I1LA 1NCAL 1IAII 2FX7H 3AU1B 4UNVA 2P8LB 1FAKT 1BLNA 5TGBA 5JDJA 3LHPL 4U1IA 1GAFL 4X98B 5IG7A 4UUJA 4JN2B 5C09B 2NY7L 4KJQD 1EGJA 2GW5A 1ZS8A 3KJ4C 4YR6B 3TWCL 4WI9A 1ZT4B 3X17A 4MS8D 5E2WL 2L7UA 5DT1H 1MAKA 4LPXA 5TDPB 1P7QD 3TH4T 4NSKA 3L7EB 5D1XB 3BKMH 3O9WD 4POZD 5J06A 1SVCP 3KPOB 2XWJB 3FB7B 1WT5A 2YRPA 3IDUA 3BMVA 1YJDC 1UM4H 4LCIH 1TDQA 5KVEH 4PGBA 4XVTH 4QOKE 3VXME 1BFOB 3DX7A 4P23C 1AJ7H 4ZNEE 1HDMA 4Y89A 1ZA3B 1LE5A 5GS0D 4Y19D 4TUJA 3SO5A 4M1DL 4JPKL 4BFIB 1D9KC 1AGBA 2RJMA 3QCTL 1PEWA 3KLHC 3NPSC 3NFNB 4M7JH 4EDXA 2R56H 3TH3T 3WUWG 4YNYB 1ZVYA 1H8SA 4BQBA 3M8OL 3QDAA 1IBGH 3V5DB 3MRGB 3N1MC 4HK3J 2VDPL 4WHDA 3ILQD 2CK0L 4HKXA 1NCNA 3BYYA 3GRWL 3HHRB 5SWZB 3ZTNH 1UZ6F 2WV3A 1FFNB 2VERN 4L29A 1AY1L 4E41E 2D0FA 3RDTD 1PG7H 2JIXD 4TOYH 4GO6B 1A3RL 5T3ZE 1B0GB 1U2CA 3BISA 5CWSB 1AXSA 4UIMA 4CUCA 5TQ2H 1OSZB 4C4KO 4OCLC 4XVUD 3NBNA 3HCVB 3IDYB 1JZ7A 2NY3D 5KAQG 2G9HA 3BSZH 3CMGA 4WU5A 4YHZH 3O81A 4GQ9H 2EH8H 4PD4K 4KRPC 1HINH 1NEZB 5LJYH 1PZ5B 3H7BA 5FXCH 1S7VB 2BNUA 1KN4H 2EKSB 1KBGL 2QQLL 4XNQB 1J18A 5F3BA 1P9MA 4MZ3A 1HHHB 3F7VA 1I9JL 4U31A 5J12B 4APQA 3QJFB 2FHFA 4ZFOL 1OAKL 1A7NL 1SM3L 4L3EA 4QHUB 5KVDL 4X6CE 3IS1X 1KIPA 3LQZB 2YSSB 1MH5B 2G9HB 2UWEF 2QR0B 4UQ3B 2EDNA 3BIKA 1NFKA 1TVDA 3WDJA 3MA9H 1I8MB 2FX8L 4XC1L 4I2XA 4N0FB 2BNUB 1EXUB 5F3BB 1YZZA 1X5GA 1FORH 1I7RB 2BVQB 3FB5A 1GL4B 1T7VA 1QYGL 4P4RA 3E6HA 4KJWD 1D6VH 5D5ME 1ZHKB 5GZOD 3O6FC 1N64H 2Y36L 5C0CB 5LQBH 1XIWD 3GSNL 3MLZL 3GSWA 4Z7OF 3SPVA 5C3LD 2BMKB 3VFVB 5F88B 1FIEA 5FKPB 2X1WL 1ACZA 2BY2A 5KW9L 1YDPB 5EU4B 4OIIL 4KXZH 4HC1L 4CVUA 1BQHB 3T2OA 4Y1AE 4YPGB 2CKBL 2P5WD 3QIUD 1A6TB 4Q9QH 4NO0D 5B8CC 3E6HB 4MA8L 3O4LD 4N8VB 2QQKL 1IGCH 1CCZA 1JZ4A 1A8JH 4TQEH 1ND0A 2BVPA 3LRGA 3SDCA 4JRXA 4JKLA 3RZCD 2WBJC 4OLVH 1FZMA 4Z95L 1N59B 3WUZA 3C5SB 1FVCA 3IRZA 3EFFA 1LDSA 4NC0B 1X4ZA 1J1OL 1JGVH 3GHEH 2W07A 5FUOL 3EJZD 5CEZE 4PB9H 3Q6FA 5J0BA 3UYRH 4P46A 3T2QA 3IFOA 3X14A 2Q8AL 1CT8A 2YMXH 5GRZA 3D0LA 3LDBC 3KXFA 1QR1B 1ONQB 2BOCA 3EOAB 4PG2C 4FXKB 3ULUD 1LO0H 4YWGL 5JUEH 3RPIA 3QDGA 3AM8A 1IZJA 3MRMB 1I3GH 4G3YH 4X7EC 4N9GB 5F89A 1FFPB 4ODVH 3L3HB 1WVZA 1EAJA 4WUUA 4FQIH 5DJYB 4RQQB 1NBQA 2JTDA 1HWHB 2GK2A 3RQ3A 4J2XA 2DM3A 4O58L 1MFAL 5TF1L 3SQBA 4P46B 1RIVL 3QZWA 3L1OL 3GMRA 5DHVB 5I16B 1DQMH 1K9TA 1C12A 3GNML 4WO4A 5EBMA 2XWTA 1XEDA 2XXCB 3HC0A 5CSZA 3SE3A 5IW6B 3EHBD 4PJEF 3JTSA 4HX1B 4NQXA 5DJZB 4QGTA 1XGRB 4LLVB 3VXSD 1WAAF 2GEEA 4YBQD 4HIXH 4HWBH 1MCLA 1AO7D 4X7SH 4F57L 4UV7H 2KL6A 5DJ8A 3GMRB 4KGLA 3FN0L 2W9EL 4TVPH 3VDAA 3FOLA 4AMKH 3AREB 4CBPA 3OXSB 2XWTB 1RD6A 2HMID 3NACH 3GJEB 3LVEA 3BDYH 3O4OB 3JTSB 3H6JA 4MDIA 4Z8FL 4LPVA 4ZUWA 4MJ6A 4QGYA 4ONGL 1CGUA 3HE6C 3WN5C 2VDRH 3LPWA 2GJ6B 4HUNB 1E6OH 2HJFB 2VIRB 5C09E 3W2DH 1X6NA 5CSBA 5C08E 1JUFB 1IARB 4TRPH 4FQPA 5IM7A 5SX5H 3SDAC 3LKOB 1C8PA 4FQHA 3QFJA 3MUZ1 1UXSB 5JIKA 5TE7L 4X7DC 1QFPA 2YS4A 5C07A 1ITCA 4MJ6B 3FFDA 2FEDD 2VZ3A 3AS3A 5J8OA 3BUYA 1XR9A 3K74B 1QPXA 5D1ZA 3D0VA 3LS5L 5IMLB 5LGKA 5MEPB 1BX2B 3GI8H 5DJCA 2GITB 4GRLD 2FBJL 4LCWB 3K81A 5IM7B 2HWZH 5F93C 3BP5B 5ILTL 4X4XB 1EFXA 4LEOB 4KHTL 1VFOA 4Y4KA 1LE9A 4PJCA 3GJFB 1BD2B 5JPMB 2FH6A 1WCBB 5FYLE 1HHJA 1X5YA 4D3CH 3BVNA 1KGCE 4M7ZC 4XWOD 4S2SA 1E27B 1T89A 5I8OH 3D0VB 1DBAL 4F7TB 3RA7H 3ZE0E 2IFFH 2X4PB 3C6LA 1O5DT 3QZWG 1TQCC 3KHQA 5HHQA 4QHKI 4UQ2A 1C5CH 4Y4KB 5EDXA 1DQLL 1OARL 4CKVX 2D3VA 3ZHKA 4WHYH 4PJFA 2C1OB 5T33H 1J1XL 4GAJL 4AG4H 1JIBA 3L3IB 1CN4A 1SBBA 3FQNA 2JJSA 1YY8B 5JIHA 1UH4A 4H5SB 4JQXA 3QIWC 3VCLB 1X5IA 2NW2A 4XBGA 4JFFD 2DYPA 4QRUB 4MGXA 3L6FB 1XF2A 1CGYA 4XNYH 3HI6L 1V8HA 4U1KA 1EEUA 4U6VL 1QHOA 1VFBB 3GSXA 3LQAH 3QPXL 2ITDA 1HYSC 3FO0H 3L3OB 2IH3B 4HKBA 4HGWA 4XAKD 1OP5K 3FOMA 2YA0A 4OGYL 4PRBA 3ZLQC 5E08L 4G8GE 3Q5TA 2HVKA 1RHHA 5KS9F 5DJ2A 3S35L 1W8OA 5E2UH 1ED3A 3IJYB 4X4ZA 5EO9A 3BXNA 1UH2A 3O45B 4YDJA 4OFKA 5GS0H 4QXUH 1BIIA 5BOPA 2NXYD 3UEZA 5I6XB 2R2BA 1MUJA 1NC2D 2DLFL 3HZKA 3B9KD 3U6RA 2F19H 3QCVH 4LKCB 1Q1JL 1TPXC 4G5ZL 4TUKL 43C9B 1V05A 1EEYB 5F7WC 4PRBB 4Z77A 3KYNB 5E5UB 5TE4L 3RWIB 3BZEA 1LO2L 4N5ED 3D3VB 2WK2A 1Z3GL 4I4WA 1ED3B 3C60D 4U1NA 3TO4B 5EZOH 5ICZB 2DLIA 1BIIB 4DEPB 3MOBH 1KIQA 3O8XA 4R6UA 1MUJB 3HZKB 1A1NB 5GGUB 3HFMH 2CUHA 2W0PA 3H9ZA 3UTSB 3KPNB 1BWWA 3EYFA 4XWGL 4CGTA 3FCTA 2HT4D 4Z77B 1I3RA 4UT6H 4QXTB 3VXNA 4IMLA 4NRZA 1NCDL 2EDBA 3TN0D 4U7KA 4U1NB 1CL7I 2A73B 3MYJB 4R9HA 2I60H 2O93L 3AB0C 3SO3B 2V17L 3HPJB 4AENB 5C0JA 4K7FA 5HGBA 4X6DA 2HFEA 4UT7L 3DVFA 1JYXA 4AIZB 1RUQL 1MLBB 1ZTXH 2VXSL 3DIFB 3IF1A 2ZPKL 2IQ9L 3MJ9L 4L4VA 2VN7A 4IMLB 3R0NA 1SBSH 5C7XL 4LP4A 4WHTA 3FHAA 3EDFA 4PIRF 4HXAL 1WFOA 3GO1H 4HCRL 3UYPA 3RVUD 1A6PA 3K2UL 4JRYA 2AXFB 2AAVA 2P7TB 2VKXA 3OV6A 4MSWA 3B9AA 1H9VA 4QOKD 2G60L 2HFEB 1CGSH 1CZ8L 4DK6A 4XMPH 5EUOA 1UACL 1M7DA 2XTJE 3IF1B 3V52L 1RULL 3MZGB 1CXKA 1T20B 3PL6B 2BVOA 1T2QL 5BW7C 1M71A 4M4PA 1KB9K 5D7LE 5J6HB 3C6SB 4WGVB 4ALAH 3O3DA 2CO6B 4BFEA 5D2NE 1QSEA 3AMLA 2A1WH 1LO5A 4U3HA 4N8CL 5EC1A 1FN4B 1WZ1L 4OZHF 4LEXH 1ZA6A 1OQOA 1E4XI 4IIQB 2NR6D 5GGRB 3JV4B 5TE6L 4E41D 3QDJA 1MOEA 4WI5A 2APXA 3FN9A 3KPPA 3C8KB 4ZPVB 4ETQA 3ROLB 5TFSH 5KTEL 1M71B 1YC8A 5GGRY 1OL0A 4KMLB 1V7MH 5I76A 4NO5A 4P2RA 1LO5B 1QTYT 2PYEA 5HHVL 2FECI 4YXKL 3HNVH 3ZKMD 4PREB 2A9ML 5E24E 2FEEI 2NPLX 4PJHB 4MCZA 5DR5H 4D0DA 2XZAH 4HZLB 4TSCL 4JB9H 1JK8B 4LOUC 4Q9CA 2EIEA 5DD1L 1M7XA 1IAKA 3JUZA 2O5ZH 3VXUE 3W9DA 4Y4HB 3PWJB 2CK2A 1N2RB 3L5JA 1TJHL 1JPTH 4WFED 1FSKC 2ED9A 4LSTL 5ITBH 4LCYA 5HVWA 2NY4C 4P4KB 1AGFA 4P2RB 3D1MC 4YHLL 1N7ML 4C56B 4HT1H 3X12A 1L7IL 4POUB 3KPRE 3RTQD 4D0DB 1LO4H 1CS6A 4Y5XA 4R96A 5ACMA 4UIKH 4LCWE 1IAKB 3BN9C 1MFNA 1K4CA 2HLFD 1FQ9C 2DD8L 2YK1H 4X80L 1BD2E 3G04A 5IMKA 4KPHH 4GS7C 5E2VL 3NIDF 1IKNC 5E0QA 2AS5M 3MV7E 2ZUQB 4XB7A 3HN3A 4J4PC 4Q6IC 5E1AB 5IBUG 5L9DH 4PJXA 4LSUH 1FGNH 1Q0XL 1MCIA 3VXPB 2B4CH 3ARFA 5ENWA 3O3UN 4LFHD 1TZHA 1AXIB 5JORB 2F53D 1ETZA 3GMQB 2UYLA 1I1AA 1D5MB 2EZ0C 1JTPA 4M6MH 5ISZA 2E7LC 3Q48A 4Q9RL 5FYJL 3UC0H 4OZIB 4LAQH 4KK8D 3DETC 1XGTA 3RL1A 4KZEH 3S88L 4JVWA 1IT9H 5F6HJ 2YPKB 4XRCA 3M45A 5L2JB 4FTVE 1T7WA 1QFWH 1CLOL 3TJEH 1NGQL 2YZ1A 1L7TH 5E94A 3U2SA 1NFIA 1MQKH 3WIHH 5ACZA 1KPVA 3QIBD 2IAMB 4FP8H 5L2KE 4M5YH 1F11A 2X4NA 3TGXA 1TITA 2BXYA 3IFLL 5K9QG 4LNVA 2UYLB 1I1AB 1JPFA 5GJTL 1T03H 5CILL 4AH2B 2ED8A 5GSRB 1KFAH 2DQUH 4RAHA 2BJML 3P4NB 2CDEB 2X4UA 2H2SC 3HMWL 1AQKL 4JO3H 2Q7NA 3C8HA 3C9NB 1ZHBB 4PRID 3MZTA 1FIGH 5E94B 2IPUK 1F13A 2V2XA 5GSVB 5I73B 4DCQB 3SKNB 5EB9A 2X4QB 1BJ1H 4IJ3B 3GRWA 5JO5A 2LV4A 5AWNL 4X7CC 3DMMB 4HDIB 4NCC2 1O7VA 2CSPA 1ZGLA 5E9DA 1NLBL 2X4UB 3LEYH 3TBTA 1OAYL 2C7UB 1NC4D 2AEQH 3MSPA 3D3VE 5CBEA 4CJ1A 1NAMA 5GZND 2R15A 3E6FB 5C3TA 1IAIM 1BHGA 1DQJA 1VPOH 4MLIA 5F9DC 3SCMD 2DM2A 1YEIL 2FGWL 1GGCH 1I3UA 2FHBA 2V2XB 3SKMA 2EXWC 1CDHA 2R4RL 2VL4A 4P23A 4XPGL 2QHLA 3GMPB 3KJ4B 4UNUA 2EDWA 5F1NB 3B9DA 2BNQA 3DYPA 3REWA 1SMOA 3KPLB 3RRQA 3EO0B 3CSPA 3P9MA 2ZSVB 2X7LA 4RAUB 1JRHI 2JCCB 4G80B 4YC2C 1TLKA 2Y23A 4QLRA 1HOCA 3I3DA 1S5HA 4DWHA 5GJSH 3DXAA 1NAMB 5IJVA 1OAXL 3AXLA 1DBBH 4CNIA 5GIRA 4ZOEA 1FAIL 5F96H 5KSUB 4OBSA 4ONHA 2VLRE 3D48R 4G8EB 5ABDE 3SKMB 4KKAD 2XQBL 5F9JA 3LV3A 1KTLA 2YBRB 5DEFA 4OF5A 5C09D 3UO1L 2H2PD 4PJ9C 1RZJL 5HHNA 1D9KB 1UXWB 4Q74A 3O11B 3NPSB 2P5EB 1A3LL 1QFUH 1U3HC 3DX8A 3ARQA 4P9MH 1HOCB 3NZHL 1S5HB 1ZEAL 1V7NL 3O0RH 1FH5L 3DXAB 3KYKH 4AY0A 5D1XD 1P4IH 2AJXL 3D2UA 5CCKH 2VAAB 3VWKD 1HCFX 3B5HA 1U8MA 4C57C 3SHSA 3MRIB 4ZFGL 4JKPL 5ID1A 4D2NA 4E9LA 4RMQA 3BWAB 3DSFL 3UTTB 4JG0H 2P4AB 3WFDH 1HXYB 1U8KA 4I1NB 4BM7A 4G42A 1WBYA 4G6FB 4K3JH 3CFKA 4NZJA 2J88H 4OZGF 2R1XB 4HC1A 1CDBA 5ALCH 2CKBA 4TTGA 1K6QL 1AXTL 15C8L 5KVGL 2DMKA 4LLUA 4NKIL 5EU3A 1LO3H 5JQ6L 1XZ0B 1YN7A 1FL3A 3B8YA 1U8MB 5FYLD 1KGCD 3GIZL 4KRPB 4MJIA 5HYQB 2KUTA 1MREL 3B2UD 3IKCA 4ODSL 4DGVL 5D7IA 3NVQA 1NDGA 4L4JA 3DI3B 5SX4I 3RWDB 1PSKH 2VXUH 5SWZD 4QHLA 5D71H 3OAZH 4NZUL 4DUWA 5C0RL 3UBXI 1CR9H 3SBWA 3MRQB 4RMVA 3SGEI 4KGJA 5C6TH 1XCQB 1YN7B 2W9LA 3LPFA 3STLA 3QUZC 4L1HA 3QEUA 4Y16A 5C9JB 2WIMA 3C08H 2UVFA 3KPSE 2FD6L 4N0YL 5D7JA 2IG2H 1QQDA 3IKCB 3NCMA 4Z76A 3TA3C 5IF0A 5D7IB 4XNXH 3UBXA 3VFMB 4R90L 1CE1L 2ITCA 4UB0L 2EYTB 2QQNL 4HWEH 5B38A 3QI9C 1D5ZA 1ZWIB 1BFVL 2YPLE 3PWUB 4KKLD 3RVVD 3THMH 3ZDYF 5ELIA 3VRIA 2I26N 4PYHA 3O6FB 1J0JA 1JNNL 3NIGE 1EV2E 3VXQB 5DVOA 3OGCA 1CICA 4IOIA 1TCRB 5JHDB 1WFNA 1RURH 1IQDB 3S4SA 5JW4N 4XMLH 1S8DA 4LSPH 4C56E 4Z76B 4EEEA 1J7VR 1P4BL 1EUTA 2Z31A 5DUML 4L8BA 3GSVA 1I85A 2H26A 2EXYD 5SV3A 4NHUB 1D5ZB 3OKDB 3TYFB 1FHGA 2BHYA 5D96C 2HH0H 5EBWB 1Q9WB 1U9KA 2R9HC 1RMFH 3BEVA 4PLKD 4QY8B 3REVA 3SJVB 4HBCL 3VRIB 5B8CB 3OBAA 1XGPB 3RWEA 3MXVH 3H0TB 3OGCB 3SKJH 4IOIB 1FNEA 4YHKL 5D9SA 5C0CD 3H9SB 4OCNC 2NW3B 1GIGH 4W6WB 5EPMB 4PPTA 4Z6AT 3W39B 1JWMB 2WBJB 1JN6A 4GMTL 2OR9L 4U49A 1CDIA 1OP9A 2Q86A 2FX7L 1CLCA 5T3ZH 5HYJA 4L9DA 4TTDD 3ZHDA 3LDBB 1ZLUH 3V2AR 2NY5C 1ZANH 1F4HA 5D9SB 4OZFH 2P24B 4QTIH 1IEBA 3SY0A 2CR6A 3IDMA 1CDUA 4I13B 1EAPB 4M4RA 5DT1L 3K4DA 2PTTB 5IW1B 1XF5A 3UZQA 3EKCA 1L6ZA 1OM3H 2VABB 3QULA 4M7LT 5IT2H 3W0WB 4OV5B 1KLFA 1I8IB 1RK1A 3WYRA 4ZUUA 2OQJB 1L9MA 4ODXB 4X5WB 1IM9B 4JM2A 4U7MA 3RNQA 1ZKAA 5I2IA 1FJ1B 4LCIL 5KVEL 3MV9E 4IOFC 4KDWA 4Z18A 4M62L 2ZSWA 3BZ4B 2E5EA 2DOCA 4LKXA 5E8EA 1UEYA 3G08B 4LBEB 2AJ3A 3WFCH 4NKDA 1QBMH 1P7KA 5DQJB 3QULB 2KZWA 3UBXG 3WN5A 2A0LD 3WE6A 3DPBA 2HKFH 4KK6D 5DFVD 5B38G 4LRIA 2H32A 1UCTA 4P46D 5C0AB 4UINL 1GHFL 4AQOA 2YPVH 3V4PH 3PXJA 3QG6A 2XTJD 1URLA 5DRXA 4CAGA 4OI8A 3SDAA 2ZUSA 4LKXB 5J11C 4C55A 3TZVA 5E8EB 3ZYOA 4FQQA 3U7WH 2W0FB 1OWWA 3V6FA 3S4SG 1FNLA 4OLUH 5J1SC 4NQTA 1VESA 3HE6B 5FOBB 1A5FH 4IMKA 3WN5B 2DLEA 2AEIT 4S1QH 1H3WM 4QNPE 4BSVB 4OI9A 2ZUTA 4NQDA 4LQFH 5E8PB 1MY7A 3SGDI 2F54B 3BSZL 4S1RL 4YE4H 4GRWF 4OZ4A 4YHZL 4X99A 4GQ9L 2EH8L 3ARED 1MWAA 1B90A 1HINL 5HI3C 3CFEA 4RDQF 4P2CG 5IV2B 4FFWD 3P73A 2JCCE 4K55A 5AAWA 5BVJA 1MRFH 8FABA 5D72H 3V6FB 4KMQA 3CAFA 5TH2A 3JV6B 4F33A 3L3DA 1T2XA 4JDVB 5IQ9B 1MF2L 4LLQB 5L0QB 3CIQA 3DUSB 3EZ8A 2GJ6D 5CEZH 1A2YA 5ESVA 2VITA 2AQ3A 3ARGC 4NQDB 2BSSB 4CVZA 5JW3H 3R8QA 4PRAB 1T5XA 3AVEA 1WIUA 3V5HB 5B4MC 2DJSA 4X99B 2A6DB 2XZCL 1MWAB 1KPUA 4KQ3L 4KZDH 4X8JB 1Q38A 4BFBD 5IFHL 3QUYA 4Y0GA 3MRCB 4NQEA 2GUOA 5E2TL 1S7XA 5EC2B 4WV1C 3L3DB 4NWTL 2IGFL 4M7ZB 4OV6F 4OM1H 1QBBA 4N1CA 4OI7A 5C0FA 4TN9A 1MFCH 1D6VL 1MRCL 4OCRH 4F3FA 1A2YB 2ZJSH 2VITB 3IXTA 2KH2B 4ZPTB 4K3DH 4CVZB 5LCVH 5IR1B 4MJ5A 1MPAL 2XA3A 1TQCB 3IYLW 4KJPD 2OJZH 4LCWD 2HFTA 4EBQH 1R5IB 5DJ0A 3LKQA 4MA7H 3CJJA 4FFYL 5D7KD 4X4YB 3HKFA 5TDOB 1BD2D 2EDJA 3DV6A 4CN1A 1JGUL 1MJ7H 5IMOB 1L4IA 4FHBD 4JFEA 4HIJA 1M1SA 3T0EE 4LF3A 1W0WA 3IXTB 2JJWA 3QIWB 3GEWB 5H37H 2Q76A 3P0GB 1HQ4A 4TQEL 5BRZA 1YEDB 3HB3C 1CFVL 2ENYA 1KUMA 2GIYA 2VDKH 2H8PB 3B4NA 4Y8DC 3OJDA 4U1JA 3MRJA 3HZVB 1YEHL 4U0RC 5J56B 4GKNA 2ILLA 1UM5H 4ZO8A 1ZHLA 3EBAA 5BZDA 4MNQA 5HHOA 3FO1A 1NMAH 3MJ9A 3BE1H 1W0WB 1B2WH 3LKRA 4KKBC 3CSYA 5C8JA 3GSRA 1GCFA 3CC5A 4HCRA 3NCCB 4JM4L 5JUEL 1NCTA 2GFBB 3OTTA 3TLRA 3RAJL 1I3GL 1XT5A 5IB3B 4WW1B 4ODVL 3IDGB 4GKNB 5DJ6A 5C1MB 4FQIL 5BJTA 5FO9A 3GMOA 4KQ4L 2ZCKH 2FWOA 3KG5A 4JY6B 5IEKB 5FOJA 4L3CA 5JHDE 5LGHH 2GQHA 1I1RA 1Y6NR 2K7QA 1NKRA 2HFGL 4R26H 1F42A 3GSRB 3MLSH 1DQML 2VZVA 3GHBL 4M48L 3NCFB 4OIBA 3MCKB 1FO0B 3KVQA 4JZNB 4WENB 4YK4C 5EBGA 3SJVE 5AUMB 1K8DA 5FB8A 3MJ6A 3GMOB 5I1HH 1G1CA 1NH6A 2FB4H 4QRQB 5FYLH 1FBIH 4L8CA 4W6YB 4HWBL 2E8YA 2BVUA 4S1SL 1E28A 4KK5C 1OB1A 5EH1A 3WHE1 4CDHA 3MO1A 1AC6A 4TVPL 1A9EA 1I7UA 3D3VD 2YKLH 3JTTA 1UG9A 1CGWA 4XPBH 3AB0B 5IHBA 1GXEA 2AABL 2HRPH 3TO4D 1I7TB 1KELH 1XF3A 5D2LE 1MY5A 1FP5A 1K5NB 3BDYL 2FHCA 2EDHA 1NGZB 4PY8I 2FO4B 5GGQH 1K8DB 5FB8B 4OCSL 4QTHA 4BQCA 3QJHB 1OGAA 3U46B 2VDRL 3UTSD 2XPGB 3GIVA 4ONOA 3BKYL 1NLDH 5SWSE 3OX8A 1DVFA 4QT5A 3W2DL 5H8DA 4PJEB 3FAXA 1VEOA 4MNHA 1LMKA 3CK0H 1Y6MR 2FDBP 2XNAB 4MQSB 4TRPL 5IHUH 4BA8A 3ARBA 3U36A 1ADQH 2DLHA 5M7QA 3QEQE 2CXGA 2A74B 1L0QA 2OSLA 4U7SA 1IGIH 2B20A 3HAEB 2Z92A 3HRZA 3MGTA 1BECA 3U4EA 1OGAB 1G9EA 3GIVB 3LKPA 4Z7QF 2ADJB 4JJ5A 6CGTA 3BN3B 3GI8L 4MS8C 3OAYH 1JHTB 4GW5B 1YPZA 2C1PA 1HWGB 2HWZL 4FQXA 4LGPB 3LN4B 5F70A 5D93C 4LHUA 3O9WC 3LQAC 3VE0B 2VQ1B 4I77H 2ZOKB 5FGBC 3GB7A 5SWQB 4DGIH 1NGWB 5I71C 5C0AE 5DA4A 1YEKH 5DSCB 5A3ID 5I8OL 1NBVH 2GCYA 3RA7L 4MX7A 1MVFA 2IFFL 5I18H 1CFNA 2C1PB 1CIUA 3PL6D 4TUOA 4G7VH 4GW1B 3OKNB 5CUSL 3H9HA 3O3EB 5HDBF 4ZFFA 4WDIA 1IGJA 4OJFH 3QNXA 3O41A 5DI8B 4DQOH 2YD9A 2W9DH 3PGCA 3BP4B 2IANB 3FONB 1HSAB 4DOHB 1T04A 3UMTA 1AR1D 1FCCA 3ILQC 4GXVH 4XHQA 1CD9B 1AD9B 1GC1L 1YYMH 5T5FH 1IC7H 1GPOH 4M3JA 4NBYB 3RL2B 4G7YH 1FSKB 3RKDC 1JZ2A 5F7LB 4L4TB 5GRWA 2PCPA 4WDIB 2NY4B 3BIAX 4Z7NF 3ALPA 2J8UA 4JFYB 4XBPA 5IW3A 3F5WA 1Q9LA 1MHEA 1UZ6E 4J4PA 1B4RA 4FZEH 1P7HL 4BK5A 3HLAA 4FQ2H 1FFOA 3WXWL 4ODWA 5E2UL 5EIQA 2HFFB 3CU1A 1BQLL 4YFLI 3WO3B 2EYRA 4Y4HD 5GS0L 3VRJB 2DMCA 3EW3B 3L9RB 3T8XA 4PRDA 5JNYB 4GS7B 3K1DA 2F19L 3QCVL 4FQJL 2BX5A 4P4KD 3PHSA 2VH5H 2VN4A 4N9OB 3RIAK 2DQGH 4F58L 2NY2B 4S0TD 4C56D 2GK0B 4Q6IB 1JJUA 3RNKB 4FMKA 1TETH 1JMXA 3C09C 1U58A 3WD5H 1VDGA 5F7NC 5GPRA 3CDYA 4RCAA 3G6AA 4ZO6A 3QUMH 4EIGB 3ECBB 4AT6B 3MLTB 1JTTA 3MOBL 1ZLVH 1BBJA 2DWEA 4ZNCD 1U93B 2UWEE 5KS9B 3GGWA 3HFML 2I9TA 4ZXBC 3TC9A 5DD6B 4NYLA 1LEGB 3MRNB 4LHUG 4UT6L 1A6ZB 4NRXA 1FYTA 5DQDL 4OQTA 4ONFH 1WC7B 3W82A 5DRZA 5J9PB 4GG6F 1IM3A 2DAVA 2X9XA 1BBDH 1FLTX 5FHBH 4E0RA 1ZT1A 5I8CA 5IIEB 5H2BA 4JFOA 5H35B 4OGAC 5I15H 2IALA 1VGEH 2XFXB 4O5LH 4I0CC 4Z7OE 2I9TB 3QIUC 1G7PB 4YDVB 1KCRH 1YN6B 5DK0B 2GSIA 2DKMA 3CDGA 3D18A 1GJIA 3UJTL 3MTRA 4HH8A 3SGKC 1ZTXL 3LN5B 5GRJH 2D7NA 4EI6B 2XRAH 1AQDB 1ZGLM 5I1IH 2MHAA 1OPGH 4NO2A 5FO8B 1W8NA 2X1OA 3RZCC 1RZ8B 2IAMD 3GO1L 2CGRH 4HIEA 5K93A 4KUCF 5K9KA 3IDNA 2R69H 5KG9B 1ACYL 3E1F1 3FQTA 4HPOH 3BH8B 2R2EA 1FCGA 2X4TB 3EJZC 2JE8A 4PJ7A 1Y6KR 1CGSL 4YAQA 2GSIB 2AJSL 4MDJA 4H0HB 1KLGB 5A16A 4XMPL 4YXLH 4NQVB 2YD4A 3KS0J 3ZKNC 3VDCA 1AP2B 1FE8H 1H15A 4R7DA 3ILPA 2F5AH 5IBLC 2E7BA 1K85A 3TBWA 5DGQA 3I9GH 4OLWH 4F7MB 3FQTB 2A1WL 4HSQA 1T0PB 1UYWH 4LEXL 3DMMD 1KT2A 3FT3A 5DYOB 4Q2ZB 2BFVL 2Y6SD 2Q8BL 4YC2B 1N5AA 1N0XH 4JPVH 1DLHA 5I19H 4Z7UA 3UPRB 4CW1A 2EDTA 1CF8H 3BWUC 4K3EH 4PRHA 3UP1A 1RUPH 1IC1A 1LWRA 2R29H 5TFSL 2WWMD 1EEZB 1NMBL 2ZCHH 5J57B 4PG9B 4YFLF 1KSRA 2FCBA 2QSTA 5BO1L 4HH9B 5HHXH 1YEGH 4FABH 4PJ9B 1TJIL 5CP7A 2F74B 3FT3B 2QBWA 2CIIB 2A6IB 1U3HB 2DBLH 4E42A 3VFGL 4PJEE 3BH9B 4WW2F 4X9FA 3MJ7A 1I1YB 4CW1B 4JB9L 4M5ZL 2E8ZA 1A7PH 3ELAT 3ULUL 4PRHB 1INQA 4ODBD 1WAAE 2O5ZL 4PJGA 2B4CC 3CH1B 1L6XA 1P5UA 2NNAB 4MAYB 4I2XE 5IVXA 1J0IA 1RZIB 1T21B 5HGHB 2KQNA 1OP5H 5ITBL 1G0XA 4XCNA 5LBSL 4HLZH 2MCPH 4WWID 3VFWB 3MLWL 4L8SA 3FTGA 2ZCLH 1F4XH 1D9KD 4ZUSA 2NX5B 1FZKB 4JR9H 1U41A 3OMZA 5KVMC 2P5ED 1LO4L 3P30L 4BZ1H 1WFTA 3VJ6B 1KOAA 4ZAKA 3T65B 1Z5LA 3DXAD 1N6UA 3ZKSD 5MEOA 1OGTB 4H26A 3VWJA 3O6LL 5D7SH 5E00A 3WNOA 1QRNA 1J0KA 3FB6A 3ARDC 3UTTD 2H1PL 4KPHL 1N5YH 1S9WB 4OFIA 2GJJA 3ROOB 2BSTA 4G6FD 3BOVA 5D6DA 4PJIF 5HTSA 2XZQH 3QI9A 4N0UB 2DWDB 1CFTA 3Q2CA 4RNRB 1FV1A 5L9DL 4MJ2A 5HDQL 1FGNL 3L5WA 5I1JH 1OTSC 1C5BL 1L0YA 3QUZB 4JRXE 3QRFM 5ID0A 4IDJH 3HR5B 4L8DB 2F8XC 2EE2A 3MLUH 2YRLA 4M6ML 4YHIB 5MENB 3TA3B 3IVKB 4KRPD 3UC0L 5C0DA 3QI9B 1IT9L 2IH1B 2X10A 1SEQL 3VA2C 1GZQA 3MRDB 3KXFE 1BWMA 3TJEL 4J1UB 2BVTA 3CLEL 2OL3B 4EIZC 4PJAF 4G8FA 1L7TL 2JJVA 5ANMB 3WIHL 1KIUA 3QDGE 4F9LA 4L4TE 1CTNA 4M5YL 2DL9A 1MJJA 4OF0A 4Z7UF 5FKAB 3EOBA 4OKVB 4R8WH 4JHAH 2X2YA 2HG5B 3OR6A 4DTGH 1Q94A 1EMTL 4U6YA 3PQYA 3TBVA 1KFAL 4OTXH 2DQUL 1T83A 3HG1A 1VHPA 3ZL4H 4KJYA 4JO3L 2Z8RA 5D96B 1A6AB 4EUPH 1AGCA 3RJQB 3I75B 3MGOA 2E3VA 3FQRA 4RISH 5GQBA 4I5BA 3O6FD 2OCFD 1I1FB 1MFEH 2AJVH 3QXDB 4JREC 3WFBL 1MJJB 2A6KB 3MLRH 5JHDD 1EO8H 4YDIH 3RGVC 3OR6B 3BKJH 1RZ7H 2J3SA 4XX1E 4JKWA 4U6YB 2V2TB 4ISVB 4UOJA 1MCCA 1S7TA 4MVBD 4NDMB 3BP7A 5DWUL 3LEYL 1FZOB 2ESVB 1INEH 2DQCL 3BESR 3FO9A 4UOW1 1K8IB 5F1IB 2Z91B 1CD8A 2IJ0C 1AGCB 2VLJB 3SJVD 3A6CL 5CAYB 1AGEB 3FQRB 1QD0A 4LMQI 4G6AC 5J6GA 2GJZA 4WY7L 1BF8A 5KS9E 5D6CA 3H9SD 1H5BA 4NQCA 2ZUUA 1DLFH 3WKNA 1DDHB 1G9NC 4MD0B 2WBJD 1A7OH 1OT2A 1X44A 5IBTH 1RZGA 2D31B 4HFUL 2ATKA 2LU3A 1AKJA 3FO9B 2VWEE 4JCLA 1ZXQA 4LVOC 5GJSL 1J87A 2ADFH 3PWLB 2XT1B 1DBBL 3BQUD 5DEGB 4JY5L 1CD1A 5F96L 1LDPH 2R1WB 3QFJE 4NQUA 5F6IC 3ZTJH 4RX4D 4NN5C 2MQ3A 4XPHH 5KVFH 1IGYB 3U7YH 3DLQR 5T1LA 1NUFA 4YDKL 3T2NH 2EYSB 1AKJB 1TZIA 1EX0A 1UJ3C 3KHOA 4HMEA 4P9ML 3ZT5A 5HGAA 3O0RL 5LAXA 3IU3A 4OGZA 1BAFH 3QFDA 1HQRA 5CCKL 3W0WD 1CE6B 1NUDA 1JL8A 5DFWH 3VFUA 1K2DB 1IM9D 4H1LA 4NO3A 3WFDL 1MHCA 1BVKB 5J11B 4Y2DC 2ZKHH 4K3JL 5CIPH 3SE8H 1DJSA 4KVCH 3L7FB 4N1EA 5J3HD 3V6ZB 2J88L 1DQDH 4W6XB 1TZIB 3QUXC 5ALCL 5E5MA 2IPKB 3WHE0 4KK9C 5HGAB 5A2JH 5AD0A 3D39B 3QFDB 2F5BL 1HZHH 1KENH 1J12A 2Z0BA 3SKUD 3TNNB 1LNUA 3EYSL 1DFBH 3G9AB 4NO3B 2V6HA 5C0AD 4NHCH 3BYTA 4WW2C 3WEXA 4WU7A 1NGXA 2XWBB 1GGIH 1M7IA 1PSKL 4NNYA 1GZPB 4WWKD 5D71L 5C9KA 4UT9H 2DQFB 5D70L 3WNPA 4ZO7A 1H3TA 1ZMYA 4M8QA 2MOVA 2D4FA 4GG8A 5HYFA 4XNZC 1MCBA 2LU7A 3VFOA 3HE6D 5C6TL 1DBMH 3K3QA 3ARGB 2DRUA 3B6SB 4OZGB 4XP4H 1A4JA 2G5BB 4LCCA 3HZMA 3PHOB 2F54D 1JGDB 3K4ZA 4XNXL 4XGZB 4NT6B 1A1MA 4YX2H 1KJ3L 1M7IB 3D9AH 4LARL 4WCYH 5ADPH 1FG2B 1NANH 2XY1A 4CMHB 4WV1B 5DHYA 3TF7C 1REIA 4U6HB 1RUKH 4GG8B 1G7HB 4OZHE 4RFEA 3IJHB 1KLUB 1U8JA 1A4JB 2R2HB 2BNRB 3SKOB 1RURL 3I6LE 5L88L 4XMLL 5GRYA 2E7CA 1CLZL 5F7YC 4HF5H 2NX5E 4FQCH 3FO2A 1PEZA 3BKCH 3CVIL 3C2AH 4JFPA 1A1OB 2NYYC 4UAOC 3P4OB 3TM6A 5DHYB 4I48B 3N85L 4QRRB 1MVUB 4HWBA 5ETUA 1S7QA 4MWFB 5E6IA 5JW5A 1QACA 5INDB 1DL7L 5MERA 4JRWA 4GLRH 1E4WL 2H9GA 4R97C 4TULL 5EULV 2VXTH 3EO1B 1L0XA 2VXQH 1B6UA 3E3QE 4MYWB 4N0UE 4H1LG 1EJ6A 4U0RB 4M02A 4ZQKA 1ORSA 3INUL 5M94B 3C5ZC 3RVXC 3V4VH 1ORQB 4G6JH 4XNMB 5FUZH 3MRPA 4PB0L 3VGGA 1FNSL 3F7YA 5HXMA 3QIWD 4Q0XL 5T1KB 5I0ZA 5F9AC 3L3JB 4NFDA 5IMMA 4IRSA 1U8NA 4PJ8B 4BK4A 4QCIB 3CSBA 4Y8AA 2OR7A 1NCWL 4L4VE 2WWKO 2Y5TB 3O2VL 1HYSD 1DQTA 5ANME 5IEHB 4HS6B 3FB8A 4U3XA 1CG9A 2GTWA 3MRBB 3NIDE 4XVJH 1CTOA 1YJDH 2VSDA 1RJYB 2CRZA 2H3NA 5I17A 1FL5B 5EWIH 3SDXF 3NFSH 1NGYB 4YK4B 5DJAB 2Q87A 3V4UH 2WIIB 5EUOE 3WFCL 5K9OA 5AAMA 3HUJF 1DE4A 3A0OA 1QSFB 1G9MH 3QXVA 2HKFL 2X4RA 4AL8L 2VB5A 1TVBA 1QSEE 1J8HB 4QRPA 2OBGA 3DX6B 4OD3H 5DZNA 3VW3L 3FMGL 5CJQH 1WTLA 1CDCA 2O26U 1AIFB 2BP3A 2ESVE 4MQXC 4X0KB 3U7WL 4YHNB 5CEXB 5JA9A 5EORH 2AP2A 5K9OB 5EA0H 2BY3A 1QKZL 3NFPB 2AV1A 3QDJE 3RIFK 1A5FL 1DBKH 5EFIB 4S1QL 1JF5A 3G5VB 4CL7A 4B53A 4JJHA 2L4OA 2NLJA 4LQFL 1EJOH 2DI7A 4HWUA 3U0PB 1Z9LA 1R0AL 1P7QA 2NZ9C 4OF6A 4YEFA 1A0QH 2GAZB 5IOPA 2AQ2A 3O9WA 3K2MC 1NCCH 2BZDA 5D72L 4CVXA 1KN2L 1H3UA 4OLYH 2Z4QB 4Z0XB 1CFQA 4HXBH 2AV7A 4D0BA 4KUZH 5BV7H 2GSGB 5HPOA 4ELKA 4XXCC 5JW3L 3O2DH 4Y19A 1KULA 4K07A 3RX8A 4NKOA 2VZOA 5CD3A 2AK4B 3MACH 4Q7DA 3O9WB 3DURA 1NBYA 1S9VA 3T0VA 4GRWB 4GW4B 4JN1H 4TPRH 4U1SB 3DVGB 1RZFH 5I71B 4G9FB 1MFCL 4KKAC 4OCRL 3MRLA 3QISA 5CHNA 4K3DL 4ELKB 2H2PC 4PJBF 5LXGH 5LCVL 5J1TC 4Y19B 4X9IA 4RMUA 2JELL 4XNUL 4ZD3L 3X3GH 2OJZL 3RDTA 5CD3B 4UDTB 2JIXA 4EBQL 4LCUB 4K9EH 3PIQA 4RA0C 3V6OE 4N0CC 4L1DA 1TXKA 1NBYB 3PDOA 4NUJB 1OW0C 3EYVB 4HS3A 3D39E 1R24A 5DD3H 3VWKC 3L5XH 1MJ7L 2AEPL 3B3IA 4FMFA 1I4FA 3H3KA 5IB5B 4BH8B 4HUXA 1EFQA 1NCBH 3BT2L 3VXOA 1FL6B 1UKQA 5FYKE 3MRLB 2YHGA 1YNKH 4KVNL 3QT2A 5DDHB 5DHXB 2Q6WA 1XR8B 1F90L 1LEKB 3LKNA 3CVHB 1KJ2L 2VDKL 3FKUS 4IS6A 3WXVL 4G43A 1PKQA 3WIIH 2V5MA 5DVNA 4BQ6A 5DK2A 1XGQA 3T0WA 3NN8B 3ARWA 4LSRH 1R3IL 3GBLA 2IAND 4UTAH 2C9AA 1VACB 1NMAL 4OZGE 4ZOAA 3BE1L 4XVSH 3EOTH 5GISH 4LOUD 4Y7MA 3DRTA 3B2UC 3QO0B 5JXEC 2LAGB 3KGRA 5J89A 5ADOH 2V7HB 4IS6B 3O6MH 2FH8A 4L4TD 1KPRA 2BSRB 4NIKB 2N7AA 2NY4D 5EO0B 3TCXA 4HJGA 1OP3K 2EH7H 2ZCKL 3P4MA 4U2ZA 2JLLA 4PS4H 3C09B 1XIWA 4P3DA 2BNRE 3HC4H 2FJFA 3P9LA 4F9PC 3P77A 4HIIB 1G7QA 5E99H 4R26L 1XAUA 3BN9D 4FQ1L 4OM0H 1JPGA 4Z7WA 3J7HA 3DTXB 4Y2OA 2GY5A 5CGTA 2M26A 2M2DA 5HD8D 4HGMA 2P5WA 3QIUA 4ZXBB 4P5MB 4QRRE 3V0VA 1Q8MA 3T4YB 3RVVC 5DRNB 4NO0A 4DKEL 1CGXA 2EDFA 3O4LA 2FB4L 3NIFE 5FYLL 1FBIL 1EHXA 2NY2D 4P3DB 4XAWH 4J4PD 3IDXL 4LSQL 1EERB 1R5VB 2DKUA 5T1DH 1DTUA 3RZCA 2XQYK 1JPGB 3CDFA 4Z7WB 4Y5VA 4XPBL 3MRHB 2HRPL 1KELL 1ERNA 4HS8L 1QLFB 1KTDB 4XPTL 5L6YL 5K9JL 3UZEA 2V9TA 1S7WB 3QIUB 2JJTC 1MJ8L 2I5YL 3PWPE 3IETA 4JE4B 4PLKC 2VDLH 3BD5A 3DSNA 5GGQL 4H8WL 4MXWH 2XTLA 3DETD 1OD7A 3GK8H 3VXRB 1D5BA 1NLDL 1U8PB 1UWXK 2Q7YA 3IFPA 3S36L 4GRMA 1C5DA 2EC8A 5IROC 3LAFA 1WK0A 3VG9B 2UVEA 4WUKH 3RZCB 1T6VN 1I9IL 3PE9A 5IHUL 2JB6B 4UTBH 1ADQL 3RKPA 2BCKA 3O6KL 1P84J 3MLPA 5SV4A 1IGIL 5EU6B 1Z0NA 3PGFH 2UY6A 2BC4A 2H2SD 1AHWA 3EZJB 5C0ND 2Q7YB 4F7PA 4QKXB 2LE9A 3RUGF 1UT9A 1MLCB 1T0MA 4W4OC 1DUYB 1T6WA 1ZT7B 4JEGB 3W5MA 4JFQB 1BZ7A 3O3BB 4UOW0 1FZJB 3VXSA 5ESQB 2FL5B 4TNVK 2R1YA 1NFDA 1QRKA 5C0EA 3PXHA 4Y5YC 4NOFA 5FM8A 1P69B 2AVGA 1AO7A 1RQ5A 3SOBH 4DGIL 3QQ9C 5J13B 2Z93B 2UZYB 1J8HE 3ZYZA 3LY6A 1OAUL 5CD5D 5KSBF 4GXUN 5IFJB 4W4NA 4MJIE 3X13A 4WEUD 3QH3B 3HTLX 3I84A 1NMCB 5I18L 5FGCB 1QOKA 2OXGA 3LCYA 2AXGB 3LB6C 4G7VL 1F6AA 2CDGA 3LEVH 4GAYA 2EXWD 5EUKA 3ZE2F 4DW2L 1XMWA 2HT3D 4ORGB 1I7ZB 4OJFL 3V7AG 4MD4A 3VGHA 4F7EA 4CU8A 3WLBA 2R1YB 1NFDB 5B22A 1T0NA 1KC5H 5DFVC 1KCVH 1MEXL 4OCWH 5F7HA 5EOCH 3WIHA 2XTJC 2J4WL 5B3NA 1PQZA 2F58L 1EGJH 4IHOB 1IC7L 3DGGA 1MRDL 3CCHB 4G6MH 1CQKA 1UKSA 2DI9A 5DD5H 4U1MB 1IAIH 4RSVA 3U9UB 4OGXH 5D2NC 4CN6A 4EJ1C 4PJ9D 5HHPB 1HHIB 2W91A 2OTUA 1U8OA 5MHSE 3LEXB 43CAB 1U3HD 3OF6D 4GRLA 1LK2A 3DX9B 1OF2A 4O2FB 1R6VA 3VFTB 3LH2H 3TPUB 2PKDA 3QHFH 5I8EB 1X5AA 2B7DT 1LP9A 1J9CT 2DQDH 3DGGB 4D8PA 4PRPB 3WNNA 2AK4E 1RUML 4MAYD 3FHQA 2FJGA 3QXAA 4YPJA 4OFYD 1GYAA 3ARDB 4QO1A 3ULUF 2V2WA 4HWZB 4GRWE 3K7UA 3A67H 1U6AL 3I6LD 3MREA 3PABA 2EIZB 3GMLA 2OTUB 1FYHB 2FYYB 2NX5D 3NABL 4RMTA 3F12A 3VFNA 3D69A 1TMCB 1JF1A 1GGTA 1FVEB 1T4KB 4DUXA 1MSPA 1A02N 4KHXH 2Y4SA 3BPOC 4F2MB 1FO0H 3OKMA 4JHWH 4XI5D 3M07A 1JGEB 3HC3H 3QCUH 2DS4A 1RK0A 1CVSC 3MV8B 3BD4A 4RZCA 4HKJB 3GKZA 5EZJA 2HVJB 1JCKA 4XT1C 3GMLB 1JP5A 2BXZA 4JFFA 4P2QB 4NKMA 4OF7A 1C16A 4X5XB 4ONFL 4DN3L 3QUZD 4KTEH 4AK1A 2QHRL 4X6BB 5TF0A 3OKMB 3BHBB 4O5LL 2QKIB 1TJGH 3ULVF 3MRRA 3WHXA 5MEND 4LPCA 2DLTA 3TA3D 3EDJA 2E6PA 1SJEA 4GAFB 5BMFL 4X9BA 3FT4A 2A77H 5GRJL 1F8TH 2FX9H 5ITFB 1R3JA 4JAMB 5DVLA 1EO5A 3WJLC 2CRIA 4NM4L 2HYMA 3IDJA 1M05B 7CGTA 1NC2A 4JREB 3B9KA 3RGVB 4K8RD 3N50A 1CBVH 5I66B 2D03H 5CJOL 3MRRB 5C71A 3HAEH 4GG6B 1AFVL 1DUZB 1AE6H 1NJ9B 2AJZB 2R23B 2GYSA 2WZPD 1T3FB 3C60A 2C5DC 4U6TA 2R9HD 1DSFL 3TESA 3IDJB 1FE8L 2KQMA 4MD5A 4ZOBA 3I9GL 4OLWL 4YGVB 4HJJH 5E7BA 5JMRA 5EIIB 3KR3H 2VL5B 3HNSH 4XCYA 2HLAB 4QRSB 2VLME 1UJ3A 2RB8A 4JPVL 2VZUA 4LVOB 2ESVD 2CQVA 5I19L 3TN0A 3T3PF 5IKCB 1G7IA 3F8UB 5INCA 2R29L 2VLJD 5F6IB 1XH3A 5F8QC 4HIHA 2W0LA 3OPZH 4NN5B 1Q9OA 1N26A 1YEGL 4FABL 5IQ7H 2ERJC 3NCJH 4XXDA 3PUCA 4HULB 1G7MA 1YNTA 1R3HA 3IDIA 1INDL 4DZBA 1JHLH 1UJ3B 1FPTL 2P47B 4OUOA 4EXPX 5EBLB 1N6VA 3UTOA 1A7PL 1UQSA 2KBGA 5JHLH 3MFFB 4LVEA 3D87B 5FA3B 2DDQH 3GI9H 4JQVC 4YUEH 3LSOA 4PV8B 3VI4F 1H3PH 2PF6A 5J1AB 1G84A 1G7JB 1XH3B 5ALBH 2VJXA 1FDLL 4IOFD 4NQEE 3QQ3A 1C1EH 4QOKA 3LRSA 3BGMB 4Y2DB 1NL0L 4XPFH 5TQ0H 4ZNEA 5MP6H 1UZ8B 4QHMB 1G7LA 4MNGB 5FDWA 4PP1D 3QUXB 1JWUA 3R06A 4X6EB 3TIDA 3QP3A 1OQXA 4NZTH 2P8PA 1F4AA 1Y18A 3MNWA 5D7SL 4K94H 3BI9X 3CFJA 4HQQH 3QQ3B 2YA1A 4WW2B 3VXMB 1S9YA 1X5FA 4Y88A 2V7NB 4K71C 1Q9KB 5DMIL 5I75C 3DRQA 1G7LB 2PO6C 4E41A 5DVMA 1JWUB 3I50H 3R06B 1LQSR 4X4ME 2WBKA 4XNZB 2EE6A 4A2LA 3AY4A 2YD6A 5FGCE 4DJMA 1CXFA 5I1JL 2ZG3A 2OZ4L 1K3ZA 1Y18B 3D39D 3DUUA 4I3GA 2ATPB 3MNWB 2B2XH 4IDJL 1UJTA 2YXFA 2DQIH 4Z7QE 3WFEL 3CFJB 5FYKD 2ORBL 2PYFA 2KDGA 4MNQE 5HI3D 3D85D 1W72H 1OLLA 3DRQB 4RGMB 1MFDL 2XKSA 4FG6C 5A3IC 3QHTC 3HPLA 5EZLB 3G6JF 4AEHH 1U92B 4HLJA 5FK9A 1M4KA 3TO2A 3MA7A 2PR4H 2VMFA 1A14H 3NMEA 1TNNA 3PP4L 1QLRA 3H42H 4XP6H 4ZUTB 3BAEH 4OZFB 1MNUH 3CMOL 3QQNA 3ARGD 1EHLH 4X6CA 3RWGB 3JWDL 3WJJC 3WIFA 4ELMA 5B4MD 4JHAL 5ERWB 4MQ7A 4P5KA 3RTQA 4MJ4A 4Z7VF 1H3XA 4OTXL 4UAOB 5HDBE 2XZZA 3ZL4L 5FA4A 2EDQA 3A6BH 4D9LL 2P8MA 1CXEA 4PRPE 5MEQA 4JO1H 3GFUA 5D5MA 1WZKA 4R97B 1MFEL 1GGBH 4JPIB 2VLLB 4MXQC 1EO8L 3K46A 3WIFB 2BNRD 1HXMA 4BFGA 4EVNA 1E0OB 3BKJL 4HUWA 3BEWA 1HE7A 2GTZA 3QDME 4YO0A 2BRRL 4NC2B 4QF1B 5F7FA 2VDOH 4Z7NE 3C5ZB 1HSBA 2B5IC 4QRRD 3L3KA 2P8MB 3S5LB 5MEQB 2F53A 4ODTL 4O02H 4U3CA 1HILB 3S8WA 1JWSB 1FFQA 3LN9A 5A40E 32C2A 2VE6A 4JO2H 3RVTC 3KDMA 4D0CA 3I2CL 1KJVA 2GTZB 2BDNH 3LZFH 1MQ8A 5EO1A 5IBTL 5F3HB 3L95B 4P2QE 3U30C 2QLVB 4Y1AB 3QIBA 2ADFL 4S0SD 2CO7B 3PWPD 3PJSA 3S6CA 1TZGH 2AERT 1U95B 4LSSH 3L3GB 1NUNB 4MB3A 1UVQB 4KKBD 1IILE 4G6KH 4GAGH 4XPHL 5KVFL 2UZIL 2D7TL 4LPWA 5CZXC 5JPNA 1U8HB 5T1KD 1MHPH 4P3CH 1SJXA 5FECB 1KJVB 1NAKL 4ZS7H 3U79A 4PRIA 4ZTOL 3IFNL 3CX5J 2JK5A 4LVHC 1P5VA 4PJ8D 1W0YT 2WLZA 4L9LA 1D5XA 5CBAB 1MCKA 3BZFA 1KB5B 2A83B 4RFOH 1Q72L 3MR9A 2W60B 5JOPD 3SE9L 3BUTA 3QNYA 3JWOL 4GG6E 3G5YB 3KWWA 3QPQD 5F6HI 2ZKHL 4IRZH 1NC4A 1ZSDA 3SE8L 1IL1B 4KVCL 3ULSA 4HBQA 5DTFB 4OSUL 4XC3H 1WWBX 2QTEA 4ELMF 3S96B 3DI2B 3SCMA 3CUPB 3OAUH 4KDTA 1QSFD 4Q97A 4UILL 4B50A 1D7FA 3OKYA 1NPUA 4O2EB 1ES0B 5FYJE 1EDQA 1J8HD 1KJ2A 4NHCL 1K4DA 2XYCA 1JFQH 4ZUVA 1F4WH 3PDDA 3OKKB 3TVMC 1GGIL 3VXTB 4QXGH 4DN4L 4HG4K 1LEIA 2HJLB 2IC2A 2APVA 3T1FA 3AU1A 5C0BB 5BZWB 2C3VB 4OCXH 2CMRL 2C3WA 2HTKD 5FF6B 5JW4Q 4X98A 1D3CA 1DBML 4R4BA 4JN2A 1FRGH 3FL7A 5C09A 5CSGA 2HKHH 2R0LH 4XP4L 1T5WA 4I18C 4NPYB 4YR6A 1ZT4A 4LFHG 3E2HC 2C3XA 5DURD 1BMGA 1X7QB 4G8IA 1U91B 5F8RC 4XCFH 2XA8H 3NAAH 4YX2L 5TDPA 2WUCL 4W81A 3D9AL 3VG0H 5EU7C 4JZJC 1OW0A 3L7EA 3T1FB 3VWKA 3KPOA 1CL7H 2EDEA 2AXHA 1OAZH 3H3PH 2XWJA 3FB7A 2OL3H 2WWMC 4R4BB 4K8RH 4R4FH 1BFOA 1T5WB 4PBXA 5MHSD 5C08B 1ZA3A 4G8IB 4LPTA 4MNGE 2WQ8A 1U3ZA 4H20H 4BFIA 1VFAA 4FQCL 4CADB 3NFNA 3BKCL 4K2UH 2UZXB 3C2AL 4E5XA 3O3AB 4GBXB 2AK4D 5AEAA 2J6EH 4RAVB 1AC0A 3VWKB 2EDYA 4YNYA 3OXRA 5CMAB 3V5DA 3MRGA 5B21A 4Z5RA 3WNLA 3EGSB 4G9FD 4PJDF 3VGFA 3AGVA 4NUGH 4PV9B 3OZ9H 2VXTL 1EIBA 5SWZA 4ENEC 4JFZL 3V0WH 2VDQH 1FFNA 4QRTB 1VFAB 2Q1EA 4BYHA 4ERSH 2O61B 2RCSH 5I1GL 4E5XB 1FYTE 4XCEB 1B0GA 5CWSA 2R4SL 1T66D 1G6RB 4H0IA 1YUHB 1OSZA 3OXRB 1F2QA 1G9MC 4V2CB 3V4VL 5FYKU 2Z8SA 2RAMA 5FUZL 4Z5RB 3L5IA 3HCVA 5F7DB 2NY5H 5EOTB 3EFDL 2GHWB 1NEZA 1E4XH 1ADQA 5FIEA 1PZ5A 2JB5H 3SDYH 1S7VA 1YY9D 4BUHA 5ACLA 1R3LB 2EKSA 5H37G 5CZVL 3RKDD 5JQHC 1HN1A 4XNQA 4PGDA 1HHHA 2XKUA 1E4KC 4J7RA 5DS8B 4LAJH 1A6WL 4NZDA 3QJFA 4J8RA 1NAML 1Q0YL 4PJIE 4QHUA 4XVJL 1YJDL 3V6BR 3T0EC 3LQZA 2YSSA 1MH5A 2QR0A 4UQ3A 5F9OH 3WSQL 2P43B 5KAQF 3MRKB 3QDHA 1B0RA 1I8MA 4N0FA 3QEGL 2E27L 5EWIL 1BZ9B 1SYVB 3EJJX 1EXUA 4ODUB 3V79C 3ZSSA 5DJDA 2DQTH 1MJUL 1I7RA 2BVQA 1UM6H 4PGDB 4NNXB 1I8LC 2XV6B 1L9NA 4LASH 4J8RB 1ZHKA 5C0CA 3MBED 4UI2A 5HI4C 5GHWH 5GGSY 5BV7C 3GMNA 3F58L 2B0SL 2B1AH 5IROA 4G8GB 1N3NA 2DTML 2WLYA 2BHZA 2BMKA 3VFVA 1B0RB 4PJAE 5F88A 5FKPA 1EO7A 1YMHA 4R0LC 1JNLL 3CFIC 3QUKB 1YDPA 5EU4A 5TDNB 5DJDB 1BQHA 4Z7UE 3LMJL 4YPGA 1CGTA 3HE7C 5EA0L 3J8F7 1NCAH 4GKSB 4MAUH 1A6TA 4WI8A 4ZXBD 3T0DA 3V9FA 2F9BT 1ZHNA 3QXWA 3LHPH 2B1HH 4N8VA 3SDXB 1GAFH 3BFOA 3GMNB 2UY7A 1FNFA 1N3NB 1TTUA 4X6FB 5FYKH 3TWCH 1KF9B 3DV4B 4KI5E 3T0XA 5E2WH 3HUJB 4YHPB 4BSWB 4MVBC 1YMHB 3BP6B 1N59A 4K9EC 3C5SA 3BW9B 3BJ91 4OGAD 1A0QL 1NCCL 1MCFA 3P0VL 3SDDC 1S7UB 2IBBA 4PY7B 1ZHNB 3D6GA 3HRPA 4HXBL 3P0YH 3MXWH 1QR1A 4U1LB 1ONQA 3VXRD 3EOAA 4IRJC 4FXKA 4CU6A 4B5EA 1A21A 3O2DL 2D0GA 3MRMA 2ED7A 2LVCA 2DF3A 4N9GA 1FFPA 3LKSB 4UDUB 3L3HA 3OKEB 3STZB 3T4AB 1NEZG 5DJYA 5IB4B 4RQQA 4Y5YB 3JVGC 1MCWM 3BQUC 4JN1L 5EU6D 5KN5A 1KEGH 2O5YH 1A47A 3P2TA 1C08B 1QRNE 4K7PY 2GKIA 3ZKND 5DHVA 5I16A 5LXGL 5BXFB 5IBLD 5IW6A 2ZUXA 4HX1A 5F1SA 5DJZA 3IGAB 4YHMH 1XGRA 1A3RH 4LLVA 1EZVX 5JMOC 5I8KL 3L5XL 2W0KA 5KN5B 4PLJD 1NCBL 2XTJB 4OD2B 1YNLH 3AREA 1YNKL 3OXSA 3QUMB 1NSNH 3GJEA 5J3HC 5D7LB 3KS0H 1F3DJ 5D2NB 5SX5K 3WS3B 1ZGLP 4LQ1A 5C0BE 3ES6B 4HIHB 4LSRL 2GJ6A 1BJ1J 1I9JH 1MI5E 3T08A 2HJFA 2VIRA 1A7NH 3QA3B 4PJ5B 1BQHG 1U3YA 2E9BA 5KVDH 5D4QA 3EOTL 1JUFA 5GISL 2IMNA 3Q3GB 4KKCD 5AZEL 1PAMA 1JRHH 3LKOA 3N0PB 3PQYE 4N8VG 4XC1H 4WWKC 3M1BA 3QHZL 3WS6C 3W5NA 5ADOL 3PWVB 4PR5B 3HG1E 1UXSA 1QPPA 3MODH 2YRZA 4M6AA 4U6XB 4WIQA 2IPTH 2NXZC 1QYGH 3S35X 5DMYA 2EH7L 3KPRA 3OKOB 4PS4L 5DMKB 2Y36H 1FNHA 5IMLA 1MFBH 1RU9H 5F72S 5MEPA 5KSAD 1BX2A 3GSNH 2X4OB 2GITA 3CDCA 3MLZH 5E99L 4U05A 4LCWA 3VXUB 3FT2B 3BP5A 2MMXA 4X4XA 4LEOA 3M1BB 3JBG7 4PRPD 3BPOB 3QEHB 5JDSB 3CX5K 1BD2A 3GJFA 4OIIH 5JPMA 3ARDD 4HC1H 5IJKC 1WCBA 1T80A 2OS7A 4O51B 2CKBH 1A7QL 3ETBF 4OLXH 3TFKC 3KPRB 1E27A 5L0QC 2X40A 4MA8H 1HEZB 3G5XA 4F7TA 2ZOLA 4GKZB 3QDMD 1ZK9A 2I24N 3WJLA 2X4PA 4WJ5A 2HRLA 5T1DL 4NQCE 4WFGE 1OTSD 1VKXB 1VCAA 5F97E 3PP3K 1X5LA 4Z95H 4X7FC 1FVDB 1JE6A 3OL2A 5I1DB 1RVFH 1DN0A 1GH7A 3CXHK 1J1OH 2X1PA 2HT2D 2G2RA 4LMQE 2C1OA 2VDLL 3MV8D 3L3IA 3GK8L 1KG0A 4KH2A 3MV7B 3G5XB 2FIKB 1YY8A 2ZOLB 4H5SA 3VCLA 4TSAH 4EKXA 4LPYA 4WJ5B 4QRUA 4P2QD 5SX4H 3L6FA 4KDVA 4PTTB 5DLMH 1BF2A 5L2KA 1DBJH 3G6DL 4U1HB 4UTBL 1X4YA 1MCDA 1VFBA 4XHJC 3U7AA 3SGEH 4M7LL 1DN0B 3L3OA 2IH3A 3STBA 2G2RB 1IQWL 3MCLL 3AAZA 1MFAH 1KG0B 2EO9A 3GBMH 5TF1H 3RIAF 4CU7A 3L1OH 4FTVB 1VADA 3VU2A 1DN2A 1NQBA 3KPQB 4XTRD 3IJYA 2OLDA 3ZT6A 3O45A 2IFGA 1VSCA 3GNMH 2HN7B 1MCJA 5L2KB 1MWAL 4FXGB 1QZ1A 2HP4A 2W59A 1LK3H 5LWYH 4J6RL 3OG6B 2CXKA 3MBXL 3RGVD 4LKCA 43C9A 5AYUL 4JY4B 4P57B 1EEYA 3PGDB 4AJ0A 2FZ3B 1XF4B 4GRWH 3JV0A 3AAZB 4JDZB 4WTWA 3ZDXF 3D5OF 3KYNA 5KSVA 5K59F 1WT5C 3SOBL 2XN9B 3RWIA 3Q5YA 1VADB 4F57H 3D3VA 3FN0H 2W9EH 4EQ3A 3GMMB 2OZ4A 4BQ8A 1UA6L 3TO4A 5ICZA 1RPQA 2W1NA 3S3JA 4I9WE 4JGUA 3F7RA 4G6AD 3LEVL 5CKGA 1A1NA 5GGUA 6FABL 2HAZA 1MHHB 3MNZB 5CEYB 2VDML 2ERJB 4ONGH 3RUGB 3UTSA 1WWWX 3KPNA 3PDGA 4S1DC 5KSVB 3SDXE 4QXTA 5EOCL 3TIEB 3B8SA 4KUCD 1EPFA 3HUJE 2HJKA 2A73A 3MYJA 3ZYIA 2DQEH 3HPJA 4G6ML 3CVHH 2JF1A 4AENA 3UAJD 1XCTB 5DD5L 1WCQA 5TE7H 1SJHB 3QRGH 4OGXL 2UV3A 5KSBB 3CX2A 1XF1A 1IGFH 1FNGB 3W11C 4AIZA 1MLBA 2VLKB 3LRHA 2PO6A 5DEZA 3DIFA 4HAFA 2Y07H 3LS5H 4PJCF 3K1KC 5GGVY 2X70B 4ZTPL 4NP4L 3TH2T 3C8DA 5AYQA 3LH2L 2HJKB 4LVNC 1EHNA 4GMSH 2XY2A 5ILTH 2VLRB 4X7TA 2AXFA 3N1GC 2P7TA 2DL2A 3F62A 1UKTA 2OTPA 4K71B 5I75B 4Y2DD 3OG4B 4NZRH 3RVWC 3A67L 4FFZH 5FCUH 3OSKA 2PO6B 2XACC 2BSED 4NJ9H 4HLZG 3RWJB 4APQC 4EUPB 3QUXD 2OTWB 4OBRA 5F7EH 4KK9D 1T20A 3P11H 3PL6A 4OKDA 4PJFF 5FHAL 4EXKA 5J6HA 3C6SA 1PYWB 3NA9H 2OI9C 4X7TB 4XH2B 1OARH 4W70A 1FO0L 4JHWL 1FN4A 2X9WA 5HJ3B 3VXMD 1OTTC 4IIQA 5AZ2H 1YC7A 1DEEB 1JYWA 5GGRA 3JV4A 3C8KA 4ZPVA 2NCMA 3ROLA 1CIDA 5K9QI 1LVEA 1RJZA 4YZFE 1VA9A 3LQMA 4LLWA 5GRVL 1YEFL 5JW4R 2CLRA 3OKLB 2FLBT 3QPXH 4PJBE 1D5IH 4PREA 5DD0L 1MCEA 4PJHA 2B8OT 1B88A 1OCWH 4OGYH 4PJ5E 3EO9H 2R0KL 4HZLA 1T22A 1JK8A 5IK3B 3SGDH 3SQOH 1F8TL 4YGAB 3S35H 3UCRA 5JR1L 4Y4HA 5T3ZD 5HDLA 3PWJA 1S7SB 1A22B 1N2RA 3SDCC 1RJZB 4LLWB 2DLFH 1QUNA 4P4KA 2CLRB 3CNKA 5CIPA 3KPSB 1Q1JH 4C56A 1I9EA 1HHKB 5ESAB 3QG7H 4JDTL 3ARSA 3FQXA 4PGCA 3T2PA 4ZODA 1T22B 2ICWA 2NYYD 2ADIB 2YPLB 2B5IB 4OAWB 1Z3GH 5L8LB 5I1KL 1YMMB 1X5JA 1N0LA 4PUBL 2IMMA 2V9RA 3CFCH 3AM8C 4HD9A 4NRYA 2APBA 2WINB 2PXYD 1FC1A 5CIPB 5F7KC 1UC6A 1RIHL 1ROWA 2ZG1A 2X4SB 4OFDA 4BSJA 4XWGH 3QQ4A 4QYOB 3FQXB 4PGCB 4YBLC 2JKXA 3U30B 5E1AA 2ICWB 1MAMH 3AS1A 4X6DF 1NCDH 3C5ZD 3VXPA 3RVXD 1WEJH 5JORA 2XOTA 3GMQA 4WO4C 4K94C 2V17H 1D5MA 4NRYB 5HD8C 4LSDA 3QO1B 3OPZL 4NBXB 1QNZL 4OIAA 1KXQE 4JFDB 4JO4H 5IQ7L 4OZIA 4UT7H 4H88H 2I27N 1RUQH 3IJSB 2YPKA 2NY2C 1ZV5A 5L2JA 3QQ4B 2K3TA 2VXSH 4LVHB 2X41A 3HZYB 5E5RB 5GS1C 4EI5B 2ZPKH 2IQ9H 1BVLB 4JFXB 5C7XH 3TCLB 5JHLL 3VGDA 4Y1AD 2AGJL 2IBGA 1M6OB 2IAMA 1IJ9A 3BJLA 2EEBA 4YUEL 1NUGA 2W65B 2BOBA 4HCRH 1JPST 2E6JA 3K2UH 5EUOF 3WDHA 1J5OH 3DO7B 3I6GB 4AH2A 1C1EL 5GSRA 5TQ0L 5HPMB 1HKLH 3UJIL 2G60H 5MP6L 3P4NA 2CDEA 1CZ8H 5CFHA 1I1CA 1UACH 4QHNA 3DHMA 5IESL 3C9NA 1RZKC 1ZHBA 1S5IL 3D25B 4ZFZB 1TTGA 2VWEC 4NZTL 3LD8C 4YLQT 5GSVA 5ICXB 2BOBB 5CEZD 4RWYH 2VKWA 4DCQA 3SKNA 4JGJA 2X4QA 2H41A 3MV9B 4FZ8L 3TNMB 4HQQL 3DMMA 3MJ8B 4HDIA 1IGML 1WZ1H 2QSCL 4JQIH 3TVMB 4Q58C 2C7UA 4MQXD 2P46B 2DMBA 2XN9E 5C0NC 4GJTB 4WFFE 4QHNB 1FLRL 1P4LB 3I50L 2MPAL 5FCSH 3E6FA 1DANU 8CGTA 5F7MC 2OM5A 1KCLA 1I8KB 3TBSA 1HIMH 1R3KB 3GMPA 4I18B 5FYJU 1JNJA 5F1NA 1BZQK 1PW3A 3E2HB 1S3KL 3CFDB 3RUGE 5DZLA 4PGJA 3EJYC 3KPLA 5HHVH 3EO0A 4YXKH 2ZSVA 3NPZB 2A9MH 4RAUA 2NZ9D 2JCCA 4G80A 4JZJB 1SQ2N 4XZUB 5CD5C 4TSCH 1T89C 5DD1H 4CMMB 5C0BD 2PR4L 1A14L 1T1YA 5I1CL 4J23A 5KSUA 3C6LC 2N7BA 1TJHH 4G8EA 1AD0B 3H42L 3TBSB 2HT3C 1SEBB 3BAEL 1MI5D 2YBRA 4DGYH 5KSBE 4UV4L 4YHLH 1N7MH 2EIBA 1D9KA 2VLKE 1UXWA 1L7IH 3O11A 2P5EA 2CLVB 4YEEA 3ZE2E 1A3QA 3MX0A 1C7TA 5EZIH 1GOGA 2JJSC 3I02B 2VAAA 4JQXC 4OQTL 1T1YB 2FJHB 3MRIA 2LQRA 4JVUA 2DD8H 3BWAA 1J05B 3QB7C 3UTTA 4EDWH 3U4BH 1HXYA 3K0WA 1GGBL 4PJXF 3CLFH 4ZSOB 3G6JB 5C08D 2ZNWA 5E8NB 5FV2A 1CK0H 3O4LE 2R1XA 1HH9B 1IAOA 1NGPH 4N0CD 3X11B 1E4KA 1DZBA 4GBXD 4CRPA 1XZ0A 5IHZB 25C8H 1PFCA 1QO3B 4A6YH 4YBHA 2YC1A 3QAZB 4HUUB 4MAYC 4O02L 2ARJB 4Z7VB 1T7ZA 3VFSB 2MCG1 5HYQA 2YWZA 2YWYA 4DKAA 5GS2H 3OB0H 5FYJH 3RWDA 2YUWA 1G9NH 4NN6B 1IAOB 4WFGD 4HHAB 3MRQA 4R3SB 3MLYL 3ULUE 5HVGB 1I8LA 1TVHA 1XCQA 4WTZA 2BVYA 3T3MF 4PFEA 5C0IB 2YC1B 3S37L 3T0EB 5C9JA 5IP4A 3O2DA 4XI5C 3PHQB 1YEJL 5GJTH 3NOIA 3O8XC 2YD5A 5JXAL 4HEPG 3VFMA 1S7RB 5JXED 12E8L 1BEYL 3CGTA 4P59H 5E8OB 4P3CL 3GBNH 2EYTA 2DQHL 1MIML 3E3QC 1RIUH 3FQUB 4XBEH 3HMWH 1MCOH 1AQKH 2V5SA 1ZWIA 4PGEB 1CD0A 3PWUA 4LP5A 1J1PH 4B7IA 5E56A 1TVHB 4MXVF 1NDMB 1KJMB 3ALWA 3O6FA 4XCCL 3ABZA 3M17B 3VXQA 5BV7B 1TCRA 5JHDA 4RFOL 3ARPA 4K23L 1IQDA 3W9EB 5BS0B 2WP3O 5AWNH 1A4KB 4HKZA 3T77B 3VFPA 1MELA 4R0LB 3NIFF 4IRZL 5EN2B 5GRUH 1CDJA 1AO7E 3NCBB 4NHUA 1OAYH 3HE7B 3OKDA 3TYFA 1N6QL 4NM8L 5EBWA 1Q9WA 4QY8A 3SJVA 3WFZA 4KY1L 1YMME 4J3SA 5B8CA 5JOFB 3ULVE 4I3SH 1XGPA 4O9HH 4NFBA 1YEIH 3H0TA 5EU5A 4K8RC 3H9SA 3IU4H 2R4RH 2NW3A 5EPMA 4G8GD 3W39A 3UTQB 4S10A 4HKZB 1JWMA 1ZLUK 1EA9C 2WBJA 3LS4H 3VFPB 1JFQL 2EE3A 2WMPA 5D2LA 5B39A 4I9WD 1NBZB 2VZSA 3SDDB 5E1HB 1OTUD 2PETA 3KYAA 5IHLB 3BQUA 1F02I 4OCXL 4M6OL 1D6EA 4NJAH 3WMSA 1IC5H 5EU5B 3CU7A 4RX4A 4IRJB 4WTXA 2XQBH 4PG2A 2P24A 4JFDE 4BH7B 3KJ6L 5IB2B 1EAPA 4M00A 1RZJH 5IVZB 3VGEA 2PTTA 3NZ8B 5IW1A 4XCFL 1ZVSB 5D2LB 5B39B 4H25A 2VABA 4LLDB 1V7NH 3CZJA 3W0WA 3BQUB 4OV5A 1I8IA 2AJXH 2OL3L 2OQJA 1D6EB 4FNLH 4ODXA 4X5WA 1IM9A 4OUUB 2R39A 4ZFGH 1KNOB 1FJ1A 2O5XH 3I85A 5SWSB 3DSFH 2YUVA 4K8RL 1F97A 1QA9B 3T3PE 3BZ4A 4WTZG 3OHXB 2HTLC 3RBGA 3G08A 1JNHB 4H20L 4LBEA 4L3AA 3QEQB 4HFWB 2V5TA 4H25B 1K6QH 5DQJA 3BKML 15C8H 5KVGH 4CJ0A 5L8KB 5D7IF 1CYGA 3VH8A 3ARXA 3I3BA 2VOTA 5JQ6H 3RIFF 1S9KC 3QQ9D 5C0AA 1UM4L 4WI2A 5FFLA 1BPVA 4XVTL 4NUGL 3S97C 3U1SH 1AJ7L 2H6PB 1A6UH 4RBPK 4DGVH 5HGDB 1A9BB 2XKNB 4WWKA 4Y4FB 1BOGB 3WS6A 3BPNC 3FFCE 4V1DB 3V0WL 3LB6D 3VI4E 4PP1C 2VDQL 2W0FA 5JTWA 5CKAA 4NZUH 5EIVA 4M7JL 2WUBH 2R56L 3HE6A 3KYMA 2Z8WC 5DJXA 3MOAH 5FOBA 4Y5XC 3VH8B 5JW4M 1QVOB 1IBGL 1HKFA 4BSVA 4RGOH 1YQVH 5E8PA 2NY5L 2F54A 3DROB 2VSCA 2FD6H 4N0YH 4O2CA 4XAKE 5C2UB 1E4XL 4WWKB 2JB5L 3ZTNL 5IV2A 3SDYL 4R90H 2Y7QB 1JBJA 5EU7E 5FDYA 4UB0H 5D7LD 2QQNH 1UB5B 5IGXH 1PG7L 3V6OC 4TOYL 2IWGA 2NXZB 3JV6A 1BFVH 3KYMB 5DJXB 4JDVA 5IQ9A 3WL9B 2MSPA 5TQ2L 4LLQA 3BPCB 5HDOA 5I74C 3DUSA 4BKLB 1JYVA 1JNNH 4C83B 3ARFC 2BSSA 1OY3B 1T7XA 4PJ5D 4PRAA 3G5ZB 3V5HA 5F9OL 2A6DA 4O2CB 2FECL 4HK3N 4X8JA 2DKSA 3WUWB 1N8ZA 4OD1H 1KN4L 3FQWB 3MRCA 2YEZB 1CDGA 5EC2A 5CP3H 5CLTA 1KIRB 4JZOB 4HBCH 1KB5H 4MZ2A 2EDRA 1II4E 3VRLE 4M1GH 1CU4H 3U0WH 4ZPTA 2CRYA 5GHWL 3P4LA 2CDFB 4ZSOE 5IR1A 3G6JE 2IQAA 4HJ0C 4KRLB 3MA9L 3VXUD 1R5IA 1UGNA 3KLAB 1N8ZB 4NN7C 1LHZA 4LGSB 1PX3A 3RWHB 4K7PX 2OR9H 3MNVB 4X4YA 3KLDA 5TDOA 4CMHC 1FORL 3TBYA 4MAUL 1UH3A 5IMOA 5L8JB 2K1MA 2AK1H 4Z7VE 1N64L 3KPRD 2B1HL 3PG2A 3QIWA 5BOZG 5LQBL 5T3XE 1Z9SA 3Q0HA 2VISB 1LILA 5FYKL 4S11A 3VH8G 1YEDA 2IQAB 2APWA 1T1WB 1QSZA 2H8PA 4JM2F 4WNQB 3N1QC 3HZVA 5ICYA 1QFOA 1Y0LB 5CJ5A 4NQSA 2UWEB 5I1LB 1CQYA 3BO8A 3TBYB 2DJ4A 4ZYKA 4Q9QL 1BLNB 5TGBB 5EOQH 2MTPA 3P0YL 1KCUH 4U1IB 3MXWL 3MV7D 1IGCL 5IG7B 4UUJB 2EC9U 4M62H 4BQ9A 1ZS8B 2GFBA 3F65A 3MUJA 3NGBC 2QV2A 4OLVL 5IB3A 4X8XA 4WW1A 3IDGA 5ICYB 4JANA 1SY6H 4NSKB 4NQSB 3T09A 1JGVL 3CD4A 3GHEL 3BO8B 1BGXH 4ZYKB 4JY6A 4PB9L 4CVWA 5IEKA 5HI5D 3T04D 3UYRL 2Y25A 1KEGL 2O5YL 2YMXL 5BS0E 4UINH 1GHFH 4PGBB 3F7QA 4FTVD 1BQUA 1LO0L 3DX7B 2FBOJ 1HDMB 2XQYG 1LE5B 1Z6JT 4G3YL 3MCKA 2DM4A 4TUJB 1FO0A 5L2KD 1AGBB 4JZNA 4JANB 1A7RH 4PJ8C 4YHML 2PW2A 5AUMA 4EDXB 1CVRA 4QRQA 2CIKA 1MIEH 1OVZA 2XN9D 5L7XH 2NTSP 1YNLL 4NGHH 4WFFD 4S1RH 3QPQC 2CRMA 4HKXB 3VDBA 1O0VA 4BZYA 1Z0MA 1I7TA 2ZZUT 1NSNL 1EEQA 1K5NA 2D4DA 4L29B 4YQXH 1BIHA 2VR9A 1NGZA 2FO4A 2PW2B 4FS0A 1TTFA 1WICA 1AXSB 3QJHA 2IBZY 1G6RH 4UIMB 2F8OA 4WFEE 3U46A 2CIKB 1MF2H 2XPGA 3P40A 4HIXL 4X7SL 4PJEA 4UV7L 1PLGH 5H94A 4LVNB 4NNPH 4AMKL 4ELME 4WU5B 2XNAA 2XZCH 1WAAA 4KQ3H 1JRHL 3B83A 3H7BB 3NACL 1KB9J 3WBDA 5IFHH 3OAYK 2A74A 1SJVA 1FC2D 4EN3D 3MODL 4JVPA 4P99A 1X5HA 2R0ZH 3HAEA 1JHKH 5E2TH 4AIXA 2IPTL 1HYRC 3SBWC 2HTKC 4NWTH 1CXHA 4TNVF 2IGFH 3F7VB 4APQB 2VLKD 1MRCH 1E6OL 4R4NC 2ADJA 4L3EB 1MFBL 1RU9L 3ZSTA 5C6WH 5H94B 2A38A 5CJBA 1KIPB 1JHTA 5BW7A 4Y16C 4GW5A 3BIKB 1MPAH 4H1LH 5D7JC 3VA6A 2OI9B 2RIKA 3LN4A 4I2XB 4KROC 1V3KA 2WW8A 2VLRD 3VE0A 4FFYH 2VQ1A 3PV6A 4X9GA 1GOFA 2ZOKA 3FB5B 1JGUH 5SWQA 4OLXL 1NGWA 3DWTA 4P4RB 2F53E 5DSCA 2PO6D 4EZMA 3MLVH 3FRUA 3DECA 1CICC 3GSWB 3SPVB 4V1DE 4GW1A 4ZG1A 1CFVH 3OKNA 4HWNA 3O3EA 2Z31C 2QEJA 1I9RH 4IBLT 1YEHH 5DI8A 1I85C 4DKDC 1RVFL 3PV6B 4M43H 3BP4A 5A2LH 4D3CL 1DQQA 2IANA 3FONA 3JV5A 1HSAA