3WEXA

Crystal structure of hla-dp5 in complex with cry j 1-derived peptide (residues 214-222)
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
181
structure length
181
Chain Sequence
IKADHVSTYAMFVQTHRPTGEFMFEFDEDEQFYVDLDKKETVWHLEEFGRAFSFEAQGGLANIAILNNNLNTLIQRSNHTQAANDPPEVTVFPKEPVELGQPNTLICHIDRFFPPVLNVTWLCNGEPVTEGVAESLFLPRTDYSFHKFHYLTFVPSAEDVYDCRVEHWGLDQPLLKHWEAQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Immune system
molecule keywords MHC class II antigen
publication title Structural basis for the specific recognition of the major antigenic peptide from the Japanese cedar pollen allergen Cry j 1 by HLA-DP5
pubmed doi rcsb
source organism Homo sapiens
total genus 32
structure length 181
sequence length 181
chains with identical sequence C, E, G
ec nomenclature
pdb deposition date 2013-07-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00993 MHC_II_alpha Class II histocompatibility antigen, alpha domain
A PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3wexA02
3.10.320.10 Alpha Beta Roll Class II Histocompatibility Antigen, M Beta Chain; Chain B, domain 1 Class II Histocompatibility Antigen, M Beta Chain; Chain B, domain 1 3wexA01
4KAQH 5JW5B 1S9YA 3RHWF 1W0VB 1RZGA 3SJVA 4KDTA 3AMKA 1UZ6E 4NNYA 2KQMA 1AO7E 4KWUA 3PABA 4XGZB 2VN7A 3GK8H 2A6DA 1QVOB 3B9AA 5EC2A 4K3JH 3QG7H 2NXYD 4JDTL 5I6XB 3KPRB 5I17A 4E41D 2PXYC 4YNYB 3O4LE 4NNPH 1OGAA 2E3VA 4PGZA 1MCFA 4RMUA 2X9WA 5EUOA 1IVLA 1OPGH 5A3IC 2OL3L 3OG6B 4OFDA 4JDVB 2OJZL 2VC2L 1GRWA 4QXTA 4DGVH 4OCLC 4G3YL 4OIIH 4OQTH 1FZOB 5IKCA 1NKRA 1NBVL 3QEUB 2YSSB 3EZJB 5L88L 2PYEE 4ODUA 1A4JA 1MHEA 1HSBB 4AENB 4TNWF 5JUEH 2D03H 5E9DB 5DURD 2EEAA 5DVMA 1FLRL 5EZOL 5I9QB 4FTVE 3IXTB 1T04B 4XWGL 2CQVA 4U1HB 5I2IA 3SQBA 4G7VH 3QFJE 3LMJL 3KXFD 3QWOB 4IRJC 3WXVH 5CFHA 3PDDA 3T4AB 3VFNB 5CSBA 2APXA 2ESVB 5TGBA 4OZHF 1IGTB 1FGNL 4JRYD 1RY7B 3VXQA 3ZL4L 1CQYA 2H3NA 4HQQH 4MD0B 4PYHA 2NW2B 1OSZB 1BZ7A 5FXCH 3D48R 2FL5B 2A38A 4P2YA 3SKMB 2VLJA 2AXJA 2VLME 1PGRB 3IDYB 5JA9A 4U6HA 4HLZH 4OCSL 2UWEB 4XPBH 5EU4B 1XF4A 1V05A 5EO9A 2FATH 1LEKA 2FR4A 2BXZA 1KXVC 2OQJA 3DX8A 4HG4K 4JEGB 1Z5LA 1I7TB 3VFMA 3QO0B 4UT6L 4U6VH 2NXYB 3QUZB 1TJIL 1FIGL 5F88A 3PXJA 2R1XB 1YMHB 2AQ3A 5HYQA 5HGDA 3T2NH 4M5YH 4N9GA 3K4ZA 5IROC 1LO4L 3B3IA 2DDQH 1KN4L 1JMXA 4LPCA 2W91A 4U0QB 1IAKA 4FNLH 1KPVB 1MFDL 1RJYA 1CLZH 4ZAKA 5HHXL 2HP4A 1CN4A 5SV4A 1KCRL 5GQBA 1YJDC 4NQDB 1RJLB 3LQAC 1LO5A 1A9EB 4AYFA 1HXMB 4EQ2A 2AS5M 4NDMA 1QSVA 2X7LA 4KTEH 5HHVL 2MQCA 3BDYH 4C55A 1F4WH 2BVOB 2NY3C 2A6IB 4HJ0D 1X44A 5T3XH 4R90H 4PPTA 5FHBH 2B0SL 5FA4A 1MRDL 2LTQC 4DGIH 5LGHH 4L29B 4OLVH 2CK0H 4LAQH 5HHNB 3BW9A 1E4XL 4YDIL 2AQ2A 4HKXB 3EOYG 1DL7L 3LB6D 4M1GH 4DZ8B 4XCCH 3BGFB 4KXZI 1N3NA 2X6MA 4DQOL 2EYTA 3VGFA 4JRYB 2VXUH 1P5VA 1TJHL 2AJVL 4JANA 3IDUA 3GMLB 5HYEA 3LKRA 4PJDF 1ZA6B 1FZJA 5GS0C 2VLJE 5E95B 4BKLA 4AIZA 1HKLH 1T2QH 5DEFB 3HAEB 2M8XA 3D85A 3MJ9A 2Z4QA 2CLRA 3ECBB 4KKAD 3AREA 4X83A 1GCFA 1K3IA 3UXFA 1FDLL 4N0FA 3W82A 4TSAH 3OKOA 4P57A 1JZ2A 1WVZA 2MKWA 3CFDA 3C09B 2DLEA 3GSRB 3IDGB 3MOAL 3U30B 3BO8A 2V2XB 4RA0C 4NQSA 2VJXA 1A7BA 1UJTA 4YHPB 2CGRL 4MA3A 3PHSA 3EFDH 4UU9A 1S78D 1KB5L 1KSRA 3KHQA 3SDCB 1A6TA 1M05B 2AJUL 1RMFH 3P0VL 4MD4B 4FQIH 5DJZA 3QG6B 4PY8I 5I1EH 4OD2A 2PETA 5F1NB 1MEXL 3ZE2E 1J8HD 4HF5L 2BC4A 3LQAH 4RZCB 4ERSH 1IMHC 3VD5A 4EOWL 2AK4B 1N0XH 5DFTA 4XCNB 4OCYH 4LPWA 3BKMH 4NPYB 4K3GA 2CKBB 2EH7L 2X09A 3U83A 5ESAB 4X4ZA 4X6BA 1WZMA 1J8KA 5KN5A 3GHBL 3WCYA 1JUFB 5EFIB 3ARBD 5K93A 5DGQA 3BPNB 5E08L 3X11A 4J3TA 2VAAA 2ZOLA 4H26B 3RTQC 1FFPB 1RZJL 1YEHH 2YR3A 1P84K 3KS0J 3TBWB 3QHTC 2UZIH 5JPMA 2VKXA 2ADFH 1AP2A 2NY1B 5T1MB 1H0DB 1SBSH 2FRGP 3DVFA 1INEL 3H9SA 3C60A 1NL0L 1R3JA 1XF3B 4XCEA 1WTLA 5A40E 5AD0B 2X4PA 3MRRA 5K59F 5I73B 4ODTL 5E5RB 1OP3K 1CLCA 3W0WD 2HT4C 4JFXB 4WFGE 4W6WB 4NZTL 4OF8A 3VRJB 1CFQB 4YHLL 3G08A 3RWEB 3QJHA 4JRWA 3MNWB 5KSBA 3S35H 1A7OL 4NQUA 3DUHA 1V7NH 4F80A 2A6KB 2E27L 2W9LA 5KVDL 1ZSDB 2O61A 3A6BL 1WBZA 3LS4L 3ILPB 1YPZA 2DLFL 5D2LF 2MSPA 5IM7A 1EK3A 1SMAA 1CDCA 4ZXBA 4TTDC 4HD9A 1Z3GH 4LPXA 1T1XB 1X4ZA 1HHIB 4P5TC 4AT6A 2FYYB 1D5XA 2APBA 3STLA 4OKVB 2JJSC 2IPTH 4M1DH 4M7JL 1IAII 2P49B 3QISA 4JREC 4N0UA 3ARQA 1BD2A 4LFHD 3OKNB 1T83C 1Q9LA 1BGXL 5EO1A 3ILQC 3WEXB 4TUKH 1DBBH 4KRLB 1SVCP 2X4QB 4WV1B 3MRBA 5CJBA 2A6JB 4TOYH 3ARBB 4JFYA 1CFVL 2J3SA 3RA7L 1C5BH 5FKPA 4PJEA 2Y7QA 4LSPL 4QHMA 4UIKH 3KPPB 1MUJB 2C3XA 1A7RL 3QPQC 3MV7A 3H9SE 1S7SB 4QGTA 1D5ZB 3O9WB 2GFBA 5FYLE 2DTMH 1IM9D 3HFML 2NY2B 3MBXL 1QSFD 2HVKB 3UTPE 1L9NA 4OV5B 2BNUB 3D69A 2W59A 1XCQB 5TDOB 2HWZL 3NFNA 3HG1A 1SEQH 3DX9B 5IT2L 1JI2A 1FVCA 5AZ2L 1TZIB 2PTVA 2RAMA 5TPWL 3T1FB 2J6EL 3W0WB 5KSBE 3WDIA 5L2KE 5D93C 5FYJE 4JN2A 4H8WC 3LDBB 3C6LB 2C3HA 1AKJA 1DBMH 2XRAL 4KTDL 1YECL 3BXNB 5GSVB 2W38A 1OTSD 4RWHA 1QRND 3ROLA 2XOTA 1JCKA 2OM5A 4X6EA 1F5WA 3H7LA 4O00A 5DD5H 3TFKC 2XV6B 4GKNB 3ZKMD 4HPOL 1OD7A 3SOBH 1CG9B 5JW4M 1FYTA 1NDMB 3RWHB 1W72B 1OQXA 4NKOB 1KIUA 2UYLA 4O9HH 1MIEH 3TH3T 1LK2B 4LASL 1KUMA 1YJDL 5IQ9B 3QO1B 2WIMA 4V2BA 2EDQA 2R1WA 2XACC 1AD9B 1UXSA 2MHAB 2P8MB 4PGBB 2Q3AA 4X9HA 1FGVH 4N0UE 3CVHA 2VLRA 2XY2A 2FZ3A 3WUWA 3FT2B 4LCUA 4MAUH 3ARGD 4PJHB 1A7PH 5IB5B 4ZODA 3FOMB 3VDBA 1OLLA 2DQEL 4HWBH 4PJEE 3FQTB 4OB5H 2OI9C 4EDWH 2XY1A 2ICWB 3MUY1 4AEHH 1DQTA 5EN2A 1JYVA 2VZSA 3BD4A 3UJIH 5I66B 3U48A 4WWID 3O4OC 1EMTL 4Y5VC 2WP3T 3I2CL 3AGVA 4PJ9A 5GS0L 1KIPB 3BWAB 3OG4B 1KFAH 4NYLB 2XPGA 5CS7A 4K7PH 1QR1B 1JF1A 1QSFB 3HG1E 3H6JA 5TF0A 4OLXH 4OFIA 4NO2B 3BP5A 2GY5A 4RBPK 2Q8BH 4OFPA 4Z6AT 3GJFB 4GAYA 5D7JD 2IGFL 1UH4A 4J2XA 2FO1A 3CJJA 4WI4A 1A5FL 4H8WH 4XNUL 3OJ2C 4Y16D 3C2AH 3MRLB 2GJ6A 4YEEA 1CK0H 4L3ED 4TVPH 2EYSA 4P2RB 4OAWB 3BX7C 4KVCH 1QRNB 4OZFH 1AXSA 2D7OA 1DLFH 3KPSA 2NZIA 4N0CD 1U58B 3S4SG 4AL8H 3SJVD 1CLYH 3HE6A 3HMXH 4NHUB 1L7IL 4I3GA 4F7CA 2BOBA 1I3RA 5CJXA 5F7MC 5AWNL 2HJKB 1N8ZB 4WGVB 1DUYB 4Z78B 5HYJA 2JTDA 3S8WA 3LRGA 4PY7B 5BRZB 2FLRT 1IC5H 2XWTB 5FHAH 4J8RA 4N0YH 5F9WC 3RWIB 4LK4A 3FO2B 1OGAD 3PWPA 4F58H 2BRQA 4K3EL 4KHTL 3SDXF 1DQQA 3DV4A 5DQJB 4LQFL 2X70A 1U41A 4FQ2L 4IIQB 5E2JA 4P9HL 1E4XI 1WSST 1HH6A 3BE1H 3U0TA 1MFEH 1G9NL 4ONHA 3DRTB 3B6SA 1DDHB 3LH2H 2AGJL 4A6YH 4PB0L 1YDPA 4NFCA 2DQGH 4NZRH 2V5RA 1URLA 3GI9H 3HPLA 1CFBA 4XAWH 1HILB 1QFHA 1ZOXA 2XNAA 3QDGD 5SV3A 4AQOA 1K2DA 1OTTC 5ADOL 2JCCF 3D39E 1P4BL 2NY6D 1I9IL 4LLYB 2BMKA 5IMLB 4UNVA 1JTTA 4FQXC 5EU7C 5HGAB 4CADA 4D0BA 4EIGB 4QYOB 4BH8A 1CGSL 2Q3ZA 1R3IH 2FIRT 2DQHH 3ARRA 3KGRA 3OGCB 1QP1A 5FAAA 4PS4L 5E8EB 5AG8A 4Y4KC 4Y16B 4U1LA 1SM3H 4IMKC 4JFEE 3KPSE 4ZDHB 1ZS8A 1KC5H 3IFPB 3MRHA 3K4AA 1WCBA 2GSGA 1T6VN 4NQXB 1JPFA 1CLOH 2Z35A 5KAQF 1BIIA 2P8PA 2P44B 4YC2B 4YR6A 2ZG1A 5E94A 3MNVA 3MUGA 2HVJA 3T0DA 1IKNC 2VXVH 1VEMA 5KSAD 5ICYB 1U92B 4O5LH 4OZGB 3OL2A 4KKLC 4FQJL 4OGZA 5IFJA 3QIWA 2AJXH 4LVHB 1QLEH 5CGYC 2A9NH 4KJQD 2LU7A 3OR7A 2D9CA 3BHBB 1TIUA 4ZO7A 5TE7L 2VQTA 3M17B 4J4PA 1Q1JL 3NZ8B 4K23H 5K33A 3MA7A 4U1JA 3NTCH 4K07A 1GH7A 2WWMD 4NC0B 3WIFA 1CVRA 4Y88A 1JWUB 5I1HL 3QDGB 2XTLA 4ZNEA 4BM7A 4R0LA 3ALXA 3HMWL 4PJ5B 4LIQE 2NY6B 5C2UB 2Y6SC 5L2JA 4JVWA 4Y8DC 3AM8A 3TBVB 5I1CH 4NCC2 3K2UL 4R7NA 3G04B 4ZSOA 1MAMH 4OLUH 3M1BA 5GGRY 3RVXD 1MFNA 2M1KA 4YFEA 4PLKD 1FO0A 2CKNA 3RJQB 3EO1A 4GKOA 4BQ6A 3EGSA 1B0RB 3L7EA 1C5DA 3BP7A 1WICA 3F62A 4GW5A 3WD5L 4DVBA 2ADJA 3DO7B 2WUCL 3PGDA 3MOBL 3VCLA 3D85D 3QWRA 5DHVA 5LCVH 1C7SA 3ARED 5HVHB 1DSFL 4JHBA 1DBAH 2Q6WB 4LF3A 3GBNH 5DUPL 3OSKA 4GRMA 2R0ZH 4CMHB 4APQA 1IC4H 2MTPA 2EE9A 5KSAB 2NY7H 3CSBA 4QTHA 4HUXB 5D5MA 1E4KC 2KH2B 3VGAC 1J5OL 4I18B 3GKWH 5JHDA 1K85A 2AV1A 3GI8L 3HCVB 1S7UB 1LVEA 3LZFL 5IBLC 1JHLH 3MPCA 4YHOL 1AY1H 1YMMB 2Z31D 2X4RA 2UVEA 2LAAA 1IT9H 3HNSH 2W60B 3NIDE 4G6KH 3TM6A 3FTGA 4P5KB 1LP9B 4KROD 2I26N 3KYNB 4U1GB 4X80L 5E00B 1KEMH 5D7LA 5CCKH 1HHKB 3L3OA 5E8NA 1DEEB 4G8GD 3SE9L 3TP4A 3LKNB 3QAZB 3EDDA 3H42H 4BYHA 5DVLA 5C08B 2LABA 3T8XB 3HE7C 4H1LA 5DJYA 3T2OA 4ZFOA 1QLFA 3D5OF 3U0PA 5DQ9A 3W5MA 3QFDA 1BVZA 3GSNA 5K9QG 3TVMC 3EFFB 5DRNB 2A73A 4CBPA 3BESR 1FNEA 1KN2H 3D0VB 1A6ZB 3BVNA 4PFEA 4ZSOE 4UV4H 4ONOA 5T1LA 3GIZL 3L3IA 1U8KB 1EGJH 3KLHC 4KZDL 5FYJU 2DJSA 4OCRH 1QFPA 5C8JA 1GOGA 3OX8B 3RVTC 3C60D 3FO9A 2YEZB 5CLTA 1A6WL 4HAFA 4OSUL 2VE6A 4OZHA 3Q5YA 2NR6D 5IFAH 3PL6C 4TYUA 4XVSH 5TE6H 5C07D 1Y6NR 1NEZA 5EU6B 2OSLA 4YHIA 1KIRB 1SBBA 1P6FA 2J7LA 2KL6A 4HKZA 1XIWC 4AIOA 4PGEB 5I6XC 1JV5B 2N1KA 4UOJA 4WU7A 4WJ5A 2EIDA 3D0LA 3QRFM 5D5ME 4WRLA 2Y5TA 4RFOH 2AXFB 1QFUL 3OPZL 5CEYA 4ZXBD 1RVFH 5JHDE 3NA9L 1XGYL 1OAYH 3QSKB 1IAMA 3EJYD 2R8SH 1UM5L 5EZLA 1KGCD 4K8RD 3MGOA 2R0LH 5F7EH 3VDCA 1R0AH 2Z31B 4NZUL 3UBXA 2PW1A 4U7KA 4O51A 5D7LE 1PYWB 3SE4A 1ZHKB 1VB9A 5DD0L 4D0DA 5FYKH 4KROB 1BD2D 2MFNA 3KPOA 2FO4A 2VXQL 3BN3B 4HIJA 2AAVA 1FZMB 2DQFA 3BYYA 4G8GB 4GO6B 5D8JH 3BPCA 2YMXH 2EEBA 1KJVA 3JV5A 25C8H 3AY4C 2FD6H 1IGCL 4ZD3L 5J1AB 1RJZA 2EDOA 3MV7D 4JFFE 3C5ZA 5F6IC 5IHZA 3ZDXF 4I0PC 2NPLX 3MACL 4OZHE 5C0GB 3Q0HA 4Y5XC 3I85A 5I8EB 5GGTA 1QFWM 3OZ9H 1Z0NA 3ULUH 4U3XA 4MNQB 1T7VA 1KTKE 3FO1B 1OWRM 1FORH 2P42B 4R2GB 1FRGH 4QRUB 5DT1H 1MELA 5I76A 4D8PB 1AKJD 1LWRA 1CVSC 3UJJL 1UB5A 2NXYC 4ZS7H 12E8H 5LG1A 4KUZH 2IMNA 1JI1A 3PNWB 5C2BL 4JHAH 4LBEB 2R29H 3SO5A 5LGJA 1FYTD 1VERA 3P4NA 1NLDH 4NCDA 4D3CH 4HIXH 1WEJH 3KPNB 4H20H 3WN5B 5D70L 1HI6A 5ACLA 2G60L 5K9OB 1KTLB 2B39A 4OTXL 3O3EB 3VFVB 5L9DH 2VZTA 3GEWB 2IAND 1FYHB 3SO3B 4LEXH 1MJJA 1IKFH 1NLBL 4YE4L 1D9KD 2VLRD 3GRWA 4IRSD 4GRWH 2EIEA 1II4E 3BIBX 5JDSA 2ZOKB 1OTUD 3FQWA 1RZ8A 4ORZC 1YNKL 3E6HA 3GNMH 2DQUL 5AEAA 4R4FL 3QXDA 1HDMB 3U4BL 1NAMH 1G7MA 4HFWA 3T0VA 3V6BR 3QEQD 3N0PB 3QUMB 3EDJA 5I1DB 1F00I 3VXNA 43C9A 4OM1H 1ZHNB 1T1YA 2AJ3A 4HHAB 3C8KA 1MLBB 4PRBA 4KDVA 4N5ED 5LBSL 1C12B 4U1NA 3QDMB 5FGCE 5CZKA 3DUUA 4U1IB 3FQUA 3OBAA 4NOBA 3WJLA 1U8QA 4X0KA 4MLSA 1KJMB 2IH1B 4OCWL 4P0DA 3ZTNH 1KCUH 4HUWB 3VRIB 5D6CA 4Z77B 3TCLA 3AAZA 5E8PB 4ONGL 1IM3B 5IV2B 4U1SA 2GJ6D 3HZVA 3SPVA 4UQ2A 1FNGA 3IDMA 4NKIH 3TNNB 3LSOB 3MCG1 3E8UL 4Q9RH 3MXWH 3I84A 3E3QC 1HHJB 2BJML 3MRMA 1ZEAH 3T0XA 3O2VL 3HLAB 1GC1C 3HE6D 2IJ0C 4GSDL 3GMMA 3MGTB 3K1DA 5D7KD 3VXRE 3H3KA 4RAUA 3MJ8B 1G9MC 2VMFA 3O6KH 3LV3A 5FUZH 4BFEA 4KRNA 3SKOB 4HPYL 3WYRA 1PAMA 4CVUA 3MRPB 3PWPD 4XZUA 1CXHA 4HT1L 4Y5YB 1I1FA 4ZYKA 1D9KB 4OD1L 4WHTB 4IRSB 4PTTA 5KJRH 3S88H 1U8NB 3AVEA 4LHQB 1MY7A 2BHZA 4YH6A 4HJ0C 4YWGH 4URTB 4UTAL 1XFPA 5GGQL 5HPOA 4RFNC 2ZJSH 3CH1A 4Y2OA 3NMEA 4GAGL 3TN0B 3O0RH 1UVQB 1M6OA 1MWAA 3QEQB 4K94H 3O2WH 3LB6C 4BUHA 3CVIL 3RRQA 4JY5L 5GGVL 1F2XK 3EYFA 4OD3L 1S7VB 4PJIF 3RQ3A 5DYOA 5F71A 3NCJL 2BY3A 3JV6A 4XNYL 4UTBL 5F1KC 4DW2L 1FFQA 3L9RB 5JQHC 4X4YA 4JGJA 4RQQA 1HNGA 5K59E 3G9AB 4B50A 5DJ8B 4H0GA 4Z76A 1AXIB 4X4XA 5I0DA 5JQ6H 1VFBA 1OCWH 4HX1A 2AKRB 4QTIL 1JHTA 2FGWH 4KKAC 4WW2B 5AAWA 3PP4L 1U3YA 1HH9B 3GKZA 1H3PH 3RX5A 2I24N 4JZJC 3MREA 2WQRA 1GC1H 3QHFL 1JNNL 4HMCA 4ZOBA 4Z7WF 5C0EB 3EYOA 2BX5A 5D2LE 4WHCA 3S3JA 1S78C 3U9UA 5C0CA 1E28A 1R5WA 3S98A 4LCYB 1LE5A 4M43H 4LLWA 2PKDA 4G8FB 3B2UD 4OGXH 1TJGL 2PW2B 4XT1C 1EEYB 5B39B 3CXHK 4L8DA 4NQTA 4F15B 2XWBA 2C1OA 4YIQB 5D2NB 3TA3A 3QIWD 3MC0A 5T5NF 1MCEA 3UTZA 3CUPB 4HIEA 5DSCA 5ILTL 3WS6C 2H45A 1N6QH 2ENYA 5HHQA 1YYLL 3IF1A 1FE8L 5DI8B 4WV1C 1MFCL 4PJGF 5MHSD 3LEYH 3ARBC 2IQ9L 1DN2A 2B20A 3MNZA 3T1WA 5F9OL 1NCTA 3HZYA 3MLVH 3UEZA 2DQIH 4LPUA 2DBLH 2E8YA 2H26B 4JPIB 2IPUK 2B1HL 4KK6C 1PG7W 3D18A 2J5LC 3TO2B 4G6FB 1MFBH 3BAEL 4RA3A 5F97E 3QULB 2IPKB 5CJQL 2ADIB 3D3VB 3ETBF 4NWTH 4TSBH 1H8OA 3LEVL 1QSEA 4PRID 3WSQL 3JUYA 5I30H 5IMMB 2V7NB 4XHJD 3S5LA 2VZUA 5FFLA 5JA8B 3P9LA 3RBGA 5D1QB 4IHOB 5ICXB 1WFNA 3H8NA 4XB7A 4GXVL 4LLUA 1LNUA 2X2YA 3DSFH 4XAKE 1BJ8A 1DQLL 3O3BA 3BUYA 5GRUH 3FHAA 2DTSA 3J8F7 2IADA 2ZSWA 5IJVA 3L1OL 4BQBA 2GSIA 3LD8C 2Q8AH 4XMKH 4WEBH 4F7EB 1TZGH 3A6OA 4JPVL 3WV0A 4JE4B 1OAZH 4P4KC 2P4AB 5C0CE 3SGDH 3DXAA 2D31B 2AP2A 5DEZA 3WKMH 4RISH 3P9MA 5CEZE 2E6PA 4TULL 1A1NA 1NAKL 5E4EB 2BSSA 4APQD 4PBVC 1PSKH 2I5YL 3T0EB 4UILL 2EIBA 3ZDYF 2F53E 4QXWA 3SKNA 3GMOB 3ARPA 2YHGA 3TPUA 3V4VH 3WHE0 5JIPA 1GZQB 3MV01 4NRZA 1KLGB 5KS9B 4PRDB 3HPJA 3GGWA 4XWOD 3E6FA 1P7KA 1YQVL 3VH8A 5EU3B 3RWDB 2KPNA 4LARH 4KUCD 5FO8B 3L5WA 3ALWA 4D9QD 1CE6B 2J4WL 4X6CB 1A1OA 5F89B 3QDJA 1P1ZA 4F7PB 2W65A 4G5ZL 2VIRA 4GW1B 5FV2A 2PO6D 3MLXH 1NEUA 2F74A 2OL3A 3AXLA 4U7SA 3NBNA 5GRWA 2QTEA 4L9DA 4JLRA 3WJJC 4G9FE 4JO3H 4PRIB 3TO4A 1MRCH 1Q0XL 5TDNB 1REIA 2NXZD 5T1LD 1DBJH 4HIHB 4MXQD 5CZVL 5I1IL 1U6AL 1X5GA 4S1RL 2E7BA 4P4RA 3FQRB 1KJ2B 5IB2A 2IG2L 4OLZH 1OAKH 4WDIA 1OTSC 1H8SA 2FLBT 2GYSA 3RUGF 4I4WA 5MEND 1UKTA 2R23A 1YUHB 1BFOB 3MLTA 5L6YH 3HC0B 1FVEB 3OXSB 4M8QA 1NCWL 1G9ML 4HGMA 3MRQB 3PWJB 4HUUA 5HPMA 4BSVB 5JNYB 1NDGA 2SEBA 1QBAA 4G6ML 5SWSE 1ZT1A 1JNHB 5BVPH 3KPQB 1I8LA 4M7KL 4MCZA 3T0AA 4NBYB 2APWA 2CKBL 1INQB 4HW6A 3WFEH 1KNOB 3VE0A 1MCOH 3F7VB 1KCVH 2BNRA 4UUJA 1PFCA 5D7IF 5H94A 5MI0B 3PGFL 4AM0A 4P5MB 4QRRA 3KLAA 1G6RB 4IIQC 3V6OC 4XPHH 3ARGC 4MXWL 4I1NB 5J57B 3ESVF 4BFGA 5FF6B 3DIFA 1BZQK 1SJVA 1WWBX 3BZFA 5FUOL 3BPOB 3VGGA 1JGVH 3OKMA 5D1ZA 3V5HB 1CDBA 1OW0C 5C0BB 3WUZA 3BIAX 4HS3B 4RWYH 4PLOB 2P1YA 1BPVA 4RGND 4OLEA 4MMZC 4NQCA 2PO6B 1ZHBA 5C7XH 4Q2ZA 4QRPD 4KGJA 2WV3A 1OL0A 3BQUD 1MREH 2BFVL 5J9PA 4H88H 5CZXD 1H3UA 3MFGB 1A7QH 3EDKA 4XP4L 5IGXL 4CGTA 1FCGA 1N26A 5D71H 5ESQA 1F8TL 3MLRL 5D7JC 5LQBL 1CFNA 5TQ0L 3C5ZD 2NXZB 5C0JB 3T2PA 1VADB 3GSQB 4Y16C 2CLZB 4M8VA 1FFNB 4NGHH 4BQ9A 3KPMA 1EHXA 3NCCB 2M2DA 5ISZB 2BVQA 5MENB 5IW6A 2QQLH 3F6LA 4LHUD 4W4NA 3BFOA 4N0CC 5FKAB 4PRHD 5CINH 4I3SL 3PQYE 1U3HB 4KDTC 2AEQL 2OP4H 3O11A 4JR9H 4QOKD 5DRZA 2WLZA 1CBVH 1FNAA 1L7TH 1PJ9A 2ARJA 1OY3B 4OJFH 4LLMA 5BW7A 3I6GA 3BIKA 4MJID 3IDIA 3OKEB 3QQ4A 1LEGB 3CLEL 4M7LL 4KHXL 5GIRA 3B8YA 1S5IH 2ZP0T 3H7BA 1YY8B 2YD6A 1XGPA 4QRRE 1EXUB 2MQ3A 4JFHD 3TT3L 2GK2A 4WO4A 5EIIA 2OR8A 1VGKB 1T4KB 3IVKB 3KDMB 3RDTB 4HS8H 4B7LA 3CFCL 2NCMA 4NUJB 2OXHA 2Q76B 5TE4H 5B38A 3VWJB 5E2WL 3ALPA 4Y19E 1X7QA 1S7XB 5A16A 1KB5A 4NQCE 1U8IA 1R3KB 3V52H 1HSAB 2J8UB 1VKXA 1I7RA 2NNAA 3BKJH 2NY6C 1GXEA 3P77B 4YBLC 1NEZG 5FOJA 4QRPB 1QBBA 1UT9A 3BQUB 5DJ2B 2JJVA 3PG2A 1LD9B 4FFYH 3S37L 4PJ7F 4XBGA 1NC4D 3L3KA 5E4IA 3JVGA 4NQED 4K3DH 1YEIL 1N7MH 3GBML 1IBGH 4HSQA 5C0FB 5ACMA 2EDDA 3PWUB 1W72L 5TH2B 5JOFB 5D9SB 4MAYA 4OZ4A 4FQHB 3IGAB 4LHUB 3LEXB 4PRHB 5ITBL 2GTZB 3L3HA 4QOKB 2AERT 3DVNB 5F3BA 1MIMH 4PRAA 4DVRH 4MJIB 3IKCA 5C0DA 3MRFA 1BMGA 3RPKA 1I75A 4RGMB 1C1EH 5KSAC 3GJEB 3DUSA 3MLSH 3TYGL 5HHOB 3FOLB 2FIKA 5FGBC 4GBXB 4JB9L 1QBLL 1PKQB 4I18C 2VO5A 2VWEC 2Y07H 4ISVA 2CDFB 3N85L 1HKLL 5F6HI 2BVPA 2X4UA 3DGGB 4Y2DB 1TNNA 3VXPB 1NFKA 4U6YB 3W9EA 3PJSA 1CGYA 2GITB 4KJQC 1BF8A 2PXYA 4DFIA 1AH1A 4X6DB 3RWJB 4BJLA 4ZAKC 3GFUA 5I0ZA 4OGAD 2X4TB 4UIMB 2ZUQB 5DJ0A 4MDJB 3KNBA 4YHML 5JO5A 2WWMC 3QAZC 1OF2B 3R06B 3MCLL 3PV7A 1TVHA 4LSUH 2JF1A 3MRGB 1ZLVK 3UJTL 2A83A 4OF0A 3T77B 3TBSA 4XVTL 3M8OH 3PP3K 2LVCA 4PJAB 4HJJL 4RGOL 4U1KA 5KVEH 1YEKH 1NANH 4I0CC 4ODVL 1LDPH 1MF2H 3JTSB 4M9OA 2N7AA 5CIPA 3RIAF 2YRZA 3BJ91 1I1AA 1XGQA 3ISWA 4J3UA 4ZO8A 5HDQL 4ONFH 4AQ1B 5KSVB 4HJGB 1T5WA 1XGTB 3SDAA 4L4TE 1NC4B 4NQEB 4S2SA 4NC1C 3RVXC 4O58H 4O02H 1F42A 3RY4A 3WL9A 3HNTH 1KXQE 1JHKL 4PLKC 1CQKA 1F58H 1ORSB 5EOQH 4QF1A 2E6JA 1KCKA 1YEEL 3IRPX 1GGBL 3LOWA 3S4SB 4MJ5A 5FUCC 4MQXD 5EZIL 1BQHG 1QD0A 4EXKA 5CD3A 3WXWH 3BEVB 4PJBA 3FN0H 4CAGA 3AREC 2O26U 3ULUF 1NFIB 2HN7B 5T33L 5JR1H 1UWEL 2Y9RT 1S3KL 3O3DB 1FSKB 2ZG2A 1NMAH 5E7BA 4KI5E 3WLWD 1FFOB 5ID1A 4K7PY 1JRHH 4WFHD 1H5BA 5FDWA 4YAQB 2EXYD 4JKPL 3IDXL 4HUMB 1QZ1A 1SQ2N 2J6EA 2W0LA 1L0XA 1VDGA 2R2HA 1N59A 1DQJA 3I75A 4YXLL 4JM2D 3ZT6A 3WNOA 3TA3D 1MI5B 3MRCA 2DM3A 5CSGA 3NCYS 1W8OA 4OZIB 5DK2A 2RCSH 3TZVB 1CDJA 2D0GA 5DQDL 1F3DH 2DLTA 2IWGA 5DHYB 1IQDA 1ORQA 3U2SB 1VA9A 4GRWF 4W4OA 3MRIB 1UC6A 4LGSB 3WNLA 4ORGB 5AYQA 3X14A 3MR9A 1BFVH 3Q6FB 5DRWA 3VA6A 3KG5A 2YPVH 4NHCH 3BT2H 2V5TA 1AO7B 4CVZA 1UADC 4ZO9A 3NA4A 3QH3A 5JMRA 4JN1L 2BCKA 2KQNA 4YUEH 3F7YA 1NGWB 1QSED 2EE6A 1DTUA 3C60C 3VXUD 4B0MM 1MRFL 5E8DL 2R39A 3ZDXE 5LJYH 3C8HA 4UDUB 2YKLL 5BZDA 3MO1B 2NR6C 2YZ1A 4HEPG 3TV3L 3EO0A 3MLPA 4GG8B 2V5YA 5DUML 4PJBE 1NJ9A 3NH7L 5EO0A 1FH5L 3IXAB 1T21B 2CRIA 1KPRA 1BAFH 1SJHA 5GZOD 4LSQH 4C58B 4J6RL 5GGSB 1GGCL 4Y4FB 2XTJD 1JGDA 5DVNA 3GSOA 4N1CA 2PYEB 4YDKH 3MLUL 4X5XA 2XN9E 3DETD 4HXAH 1A4KA 3VFTB 4O4YH 5C6TL 4LL9A 2BXYA 1D6EB 4ZXBC 2W0FA 1ZLUH 3DXAD 4PGDA 3C5JB 3QDHA 4L4JA 2DAVA 1UXWB 3EJYC 3K8KA 4FRWA 3U46A 2C26A 2JB6A 3HUJB 4K8RC 2CIIB 2XKUA 1MHCB 4FTVB 2ZCHH 2OXGA 3IFNL 3G6JB 2IAMA 4X7TA 4EVNB 4JM2B 1C7TA 2YD9A 2OYPA 5KOMC 1FP5A 1XR9B 1DN0B 2XWJB 2F8XC 4R8WH 1Q9WB 5FA3A 3SOBL 3F12B 3VXOA 4L5FH 2J88H 4RSVA 3DTXA 3RGVD 3LPWA 4LEOB 3Q2CA 3OHXA 4LLVB 1RIUH 1MCRA 3PABB 5I8OH 1IAIM 1HWGB 1ETZB 1NBYB 1JGLL 3PIQB 3LN5A 1R5VB 1UQSA 5I17B 1ZHLA 3FQXB 3RTQA 3TO4D 4WHYG 3VD9A 1A6AA 5J6GA 4LNRB 1YC7A 1EPFA 3S37X 5GSRB 4BQCA 1T5XB 2C4FT 3IU4H 4JFOA 2ORBL 5INDA 4LCWA 3MX0A 3OKLA 4OF6A 5FYJH 4M62H 4PRPA 1FZKA 3AB0C 4LCCB 5E6IB 1BIHA 3BKCL 1B6UA 1I1RA 5TFSL 5DJCA 4PUBL 4ELMF 5JW4Q 1JGEA 2Z93B 1MHEB 2XTJB 4OGYL 3B43A 4PR5A 4Y4HA 3V7AE 5MERA 4K8RH 2AK1L 3JWDC 5ENWB 2H32B 1CU4H 4AH2B 5C0AA 3I50H 4KH2A 4L8CB 5ADPL 2JK5B 3FQNA 2ERJB 4K7FA 2GQHA 1D9KC 2BNRD 5EWIL 1CT8A 2DLHA 2HTKD 4IRSC 4L3CA 4NT6B 2BSTB 5IVNA 1I1CA 4MGXA 3KPLA 3WFBL 1S9XA 3JZ7A 5EOTB 5BMFL 1UEMA 2R2BB 3H3BC 3P2TA 1OTUC 2ZG3A 3RVVD 2R9HD 1N5AB 2EH8L 5JHLH 3QZWG 1IAOA 4IMLB 3RGVB 3QXTA 4YQXH 1RUML 1H3XA 2YK1L 3DBXB 4PJGA 1ZK9A 2D4DA 5C09E 3SDYH 3Q3GB 1T03H 3LVEA 1JPSL 4XP9L 5JIIA 4XP1H 4G6JL 1RD6A 4WNQA 1FL6A 2G2RA 3HR5B 4HZLA 3PWLB 2FEDD 2X4NA 3V0AC 5A2IH 5BS0E 4N9GB 1YYMH 4MA1B 3LKPB 4Z7VF 2MCG1 5CKAA 1UA6L 1ZXQA 1HOCA 2B1AH 4TPRH 4LSSH 5T5FL 5BJTA 4PRPE 1K8IA 3U1SH 1P4LB 2JELL 3UP1A 3T09A 3R4DA 1LO5B 1N4XL 2G5RA 2GJZB 2D7TL 3QA3B 2NY5L 2X7LB 3MRJA 5EUKA 4R4ND 1WITA 4PD4K 4JFQB 2ICWI 1MJUH 4N8VG 1PW3A 1Z9LA 5TJWK 4ZFGH 1MH5A 3HE6C 1XR8B 4CN1A 1FJ1A 1FQ9C 1AGEA 3CMOL 3JWDH 5FA4B 4Z7WE 5CJXC 1IC7L 1CXFA 3OGOE 5B4MD 5C1MB 8FABB 3ARDA 1JTOA 1XZ0B 1E6OH 1HQRB 1G7QB 1M4KA 2DYPA 2WM0A 3CFEB 1X4XA 3CVHH 3FZUD 4I48A 3C08L 3S7GA 5HGBA 2EYTB 3PGCB 4CN4A 5IMKB 4Z7NF 4WO4D 1JJUA 3UYRL 1BVKA 4WU5A 1U95A 4JM4H 4ZUVA 1T66C 4X7CC 3O6ML 1QNZL 3HS0A 1T0MA 4L9LB 1INDH 1QLRB 3GUTB 5IR1B 2VDLL 4M6NH 4PJXF 2ZKHH 3RL1B 4PJGE 2YXMA 5J6HA 5E8OA 4RAVB 4Y7MA 2VXVL 5A1AA 2IQAB 4IBLT 1D6VH 3O6FB 4PJCB 3OKOB 1DUZB 4D9LL 4HBQA 3UTOA 4Z7UF 3BO8B 1R5IB 3W81A 1FAIL 5DDHA 4XNXL 3QEGH 3STZB 2HG5B 3BZEB 4UV7H 4A6YA 4P59L 5LAXB 2HMID 3UYOD 1HQ4A 2F58H 1AE6H 1KEGH 4K9EC 4JZOA 4DN3L 3VXSD 1NGPL 4JY4A 1EBAA 4X99A 4OUOA 5DD3L 5E99L 1S7QB 4KV5F 3JXAA 5F9JB 5E2TL 2R4RL 3RKDD 5J1TC 4DCQB 4OM0L 3FB6A 3ULVL 3CSGA 4KPHH 1A02N 5BZWB 4YHZL 3K4DA 1U8JA 2ZUYA 4MAYD 2HLAA 3BN9D 1G7LB 1JFQL 1QFWL 1NFDF 3CFBB 3S97C 3VG9B 5J3HD 4P3DA 1LMKA 1AGBA 4TVPE 3BMWA 2XICA 4BFIB 1EJOL 4BSWA 3VXMA 2ZPKH 1I8MA 4G80B 2DQDL 4RMWA 1U8LB 2VISB 3B2UC 5E4EC 1WK0A 5LXGH 3U9PH 1GJIA 4HIIB 4NUGH 4HUKB 1ZT7A 5B22A 3EYVB 1LE9B 3QIWC 2DBJA 4FG6C 4XCEB 1A14H 1BFSA 3ZDYE 3ARUA 5EPMA 4F7MA 3V0WL 3LPFA 4BZ2L 2B7DT 2V9QA 3TJEH 2IFFL 3QUML 5DVOA 3HKFA 2ARWA 1EEZB 4MSWB 2X1XR 3CXDH 1RAMA 5L2KB 1RZKC 5J06A 2HJLA 2VDQL 3VMOA 5AAMA 5E1AA 3MJ7A 1G7IA 3LRSB 3TBTA 1XGRB 4XP5H 1Q38A 4R0LC 1EZVX 4FZ8L 4XHJC 4LIQH 4JCMA 3FRUA 4K9EH 2Y36H 5KBNC 3AM8C 4ZS6D 1XF5A 2PR4H 4GG6F 1S7TA 1CR9H 2PYFA 3SDAD 1B88A 5IB1B 1BZ9A 1UJ3B 4WCYL 4P46B 4XC3H 3EYUL 4PTUB 1BM3H 1I9JH 4FQXA 4RIRA 4XNMB 1BEYL 4KGLA 4WFEE 4AEIL 3P30H 1MAKA 5DWUL 4P2OA 4Z0BL 3HRZA 3RUGE 2XZQH 5IVXA 2R2CA 5IB4A 1I1YB 4JFDA 1WBYA 2WUBL 4G43B 1Z6JT 1ZKAA 2HFFA 2RB8A 4NN5B 1CIUA 3VXME 1DJSA 2OCFD 4JFZH 3U7YL 2F19L 4G9DA 1IQWL 3WFDL 2WIIA 3VFOA 2F8OA 2GKIA 4GLRH 1NC2A 1HE7A 1KACB 3MA9H 4IS6B 5B38G 2ITDB 3ELAT 4PV8A 3DVGB 4NO3B 1MOEA 4JPKH 1UB6B 3KYOB 4APQC 5F8RC 1OOAA 2VAJA 1ROWA 1HXYA 4OLWL 5J13B 1A6UL 1WV7T 3BH9A 1I8IB 4RMQA 4YGVB 4WFFD 3KR3L 4TRPL 3KPTA 4JJHA 4J1UB 2BDNL 5DO2D 2FB4H 4JPWH 4Z0XB 5IHBA 3NIFE 4XWOC 5C9JB 1PG7H 3BYTA 1CFTA 3K0WA 5DMYA 2DQTH 4QT5B 1RZKH 4OCMC 3B2VH 1WWAX 3OAUL 4M48L 2HFEB 2HFTA 1B0WA 1SYVB 2I9LB 3QCUL 3I9GH 3UTTA 4PY8J 1RVFL 1ZA3A 2OJEB 2VZOA 4WY7H 5FO9B 2VDPH 1XH3B 1T7ZA 2BVUA 3FB8B 1DBKL 1DVFD 3EKCA 3U36B 2R0WH 3ZYJA 3SY0A 2MCPL 2HRPH 4N90E 2NXZC 1JRHI 2R1YB 2V7HA 4MXQC 4LU5H 5EIQA 2YUZA 3G5VB 5EU7E 2C1PA 3EOBA 3R1GH 1FO0H 2WBJA 1F90L 2NLJB 4WWKA 2VDKH 1MVFA 5ANME 2CMRL 2VABA 1F4XL 1PZ5B 2R69L 2NX5E 3N1MC 4HLZG 5DK3A 5IVXE 3HZKB 3V5DA 4JFDE 1A0QH 3SGEH 3QXVA 2OTWA 1EGJA 4LCIH 5DHVH 4TUJB 3QUXA 3K81A 4AJ0A 1D5BA 2F5AH 3BKYH 3U7WH 3FO0L 2IC2A 1J18A 5EORL 2R4SL 4S1DD 1IARB 3OF6D 1E6JH 3EJJX 5EA0H 2Z8VC 1A6PA 2AABH 3O41A 5KW9H 1F6LL 3BP4B 3DURB 2GAZA 4G7YL 5CGTA 4JVUA 4M03A 5TDPA 3W9DB 2XT1B 3UO1L 4CL7A 1VEPA 1FG9C 4N8CL 1FBIL 5F7NC 3D39B 3QWQB 2CIKB 4PP1D 5DEGB 4BELD 5IESH 2Z0BA 2F54D 2OMNA 5EUOF 3GZKA 4HCRL 1OB1B 1ZTXH 4ODSL 4TUOB 4E5XB 4GAYB 3PWVA 4QWWD 3B9KA 2IAMD 4R4BB 2WINB 3S96B 4P99A 1AGFA 4AMKL 4PJFA 4NM8L 2B4CC 2FHBA 3UTTE 5ACZB 1NGYA 1WISA 4H1LH 4RGNC 4Z95H 5B3NA 5FCUH 1Q9KA 1RURH 4JFEB 3UC0H 5DC4B 4LLQB 3KPSB 4HKBA 3TBYB 5I1KL 1EEUA 3GSNH 5DF0A 4ZUUB 2FJHA 1KPUA 5EBMA 5EZJB 1FG2B 4DZBB 3BQUC 5D6DC 2BNQA 5CZXC 4P9MH 1DVFB 1SMOA 4MDIA 3R0NA 3LKSA 4NQVA 4P2QA 4PGCA 2VLKD 3L5XL 3C5ZC 4J8RB 5E2VH 3MBEA 3PDOB 1MCWW 4EDXA 3VXTB 4JG0H 4NO5B 4PJ7E 4CMMA 1AJ7H 1QYGL 1Y6KR 2EKJA 3CZJA 3DHJA 4FZEL 4NZJA 4ODXB 1ACYH 4V1DA 1DQQB 4MA7H 1LO0H 1SVZA 3O3AA 2XZAH 2ICEA 5ESVB 4NJ9L 5ID0B 5BXFB 3CC5B 4I9WD 4H25B 2AEWA 3G6AB 4MNGB 4LCWD 3EO9L 3WS3B 4KQ3L 2X9YA 3EOTH 3KYMB 4PRNA 5D72L 1M7DA 5IWLA 4FXGB 3QCTH 3PL6A 3UPCA 9CGTA 3CCHB 5JW5A 1QKZL 3SE3A 1W0VA 1BJ1J 5ETUB 4HBCH 4OF7A 4KTYA 5J8OA 4M61B 4Y4HD 2UZYB 4EI5D 1UFUA 4XGZA 4PV9B 1WJ3A 3SE8H 2DI7A 1QVOA 1F97A 1FL3B 4HXBH 4K71B 2PN5A 3KPRA 1JZ8A 1MJ7H 3G6DL 4DGYL 4RX4A 4GMSH 3P73B 4X5WB 5SWZE 1JZ6A 1DQMH 1E4JA 2ZUQC 1JMZA 1KBGH 3MLYL 1EUUA 1CIDA 3QI9D 1E4WL 3LHPH 4JDVA 1X5FA 1CD1B 4P49A 2QHLA 4JQIL 2DWDB 3SQOL 1FZOA 5K9KA 2K9UA 3QEUA 5FK9B 2YSSA 4NRYB 1OAQH 2BNQE 3BRDA 4YGAB 2W9DH 1HSBA 4G6AD 3VA2C 1KJ2L 4AENA 3RWGB 2APVA 2QQKL 1RFDH 2VLKB 4ZOCA 1TVBB 3V5KB 5BV7H 3AY4A 1QFWI 1KELH 3IXTA 1T04A 3QCVH 4U1HA 1CGXA 2DMBA 4U7MA 15C8H 1UKSA 5INCB 5GGTH 3QWOA 3VFNA 3T4AA 3MLZL 2YA1A 3WJLC 2C7UB 4MXVF 2ESVA 3MV9E 1FAKT 1IGTA 3P40A 1Q94B 3V7AG 1JK8B 1A3RL 2P5WD 4MD0A 3X3GL 1EO8L 1U91B 2NW2A 1OSZA 2HLFD 3WIIH 1T7YA 4DAGH 4CDHA 2FNBA 2FL5A 1FSKC 1FN4B 4UBDD 5LVEA 3SKMA 1N5YH 4KK8D 4OF3A 1MQKL 3AS1A 1G6RL 2YOCA 3S36L 3CX5J 1P2CB 2UWEA 3KYKH 5EU4A 4C56E 4ZFFB 1KT2B 5HHMD 4EI5B 3KPRE 5IBTL 2EECA 4ZQKB 1I7TA 5L2JB 4KVNH 3QO0A 3QUZA 3ARDD 1RK1B 1IEHA 2HFGL 4E41A 1K4CB 4LSTL 2CUIA 2R1XA 1YMHA 5SWQB 1F3JB 3AS3A 1O7SA 2JB5L 4OGAC 5C3LD 3GRWH 4M5ZH 2JKXA 3QPXL 4EN3D 3QI9B 1KPVA 1ZLWK 5E5MB 3OV6A 4GW5B 3EOAB 3H3PH 1H8NA 2O5ZH 1RJLA 3KVQA 4NQDA 1A9EA 4DVBB 1PDKA 1KB9J 1HXMA 5JOPD 4PG9B 4LSRH 1I7ZB 5T3ZD 5BVJB 2D2OA 1KIQB 3AROA 3RHWK 5H37G 1LO3H 2BVOA 5I19L 2A6IA 3L5JA 1HYRC 1Y18B 5F1SA 1JF5A 4R3SB 3PWNA 4L29A 2XQBL 1NUFA 4JZNB 3S6CA 5HHNA 4F57L 2FECI 2YBRB 4HKXA 2ESVE 3JWOC 5E70A 3V6ZB 1J0ZA 4DZ8A 5DS8B 5KZCD 3V0VB 3W2DL 4MQXC 1H15B 1JPTL 3TEUA 4JRYA 3QUYB 1QA9B 1MCPH 3GMLA 3FTGB 1EFXD 1ZA6A 1J11A 3QNXB 4FMKA 1XEDA 5DEFA 5D7LB 1M7XA 4K2UL 5KSBF 1HINL 2R0KH 3HAEA 5D1XB 1WAAA 3WLWC 5ERWA 3ECBA 5IBUB 2QHRL 2AV7B 1YPZF 5T5NG 2EXYC 4RRPA 4G42B 1OP5H 4FOMA 1HK6A 3IDGA 3GSRA 4E41E 4DK6A 4TNWK 2V2XA 2QLVB 4POZD 2MPAL 4YHPA 1FNEB 2H2PC 2VDMH 2Y25A 3L5IA 4JG1H 5SX4I 4NM4H 2J12B 3INUH 2B4CL 5C0RH 3BRGC 3MJ6A 3FT4B 1K5NB 1IFHL 4KXZH 4XVJH 2V2TB 4JM2C 4OQ1A 3P9WB 3SDCA 2JE8A 1J1XH 4GXUM 4JFFB 4X9BA 3TA3C 1M05A 5C6PB 3A6CH 4MD4A 4XB8A 3QG6A 4EN3B 2F5BL 5F1NA 5DK0B 4OZHB 4YLQT 4BZ1H 4LPVA 2QKIB 4Z5RB 4RZCA 1VPOH 2FX9L 2DQJH 4ODHH 4YPGB 2AK4A 4L8SB 3RWCB 4XCNA 3MUJA 4NPYA 5J89A 2CKBA 5ESAA 4XNQB 1MWAH 1TFHA 3G5ZB 2A9ML 1JUFA 5EFIA 3ARYA 1I9EA 4PJ8B 4PJEF 1Q72L 3N1PC 5CMAB 1JNLL 2RR3A 4H26A 4OFKA 1FFPA 2XA8L 5F7LB 3KXFE 3D2UB 2VDNH 3TBWA 4X8JA 5KVGH 2PTTB 1HIMH 1A3LH 3K3QA 5AYUH 5T1MA 1MCJA 1H0DA 4JRYE 1T6WA 1TQBB 3IRZA 2B5IB 1MJ8L 2DJ4A 4NP4L 1XF3A 2H9GB 1UCBL 5AD0A 4OZFG 1WLHA 1J1OL 1FV1B 4XPFL 1FNHA 4FQ1H 4WI6A 1EFXB 5GZOC 5GXBB 4JFXA 4DUXA 3KPOB 4P2OD 1CFQA 2D7PA 4WHYH 2DQFB 4P2CG 3DETC 3RWEA 5EG6C 4ELME 3MNWA 3LRHA 4ODWB 2A6KA 1ZSDA 3E3QE 3ILPA 2AVGA 1NUNB 1J1PL 1RIHH 1GAFH 2I07B 1FNSH 2XFXB 3H0TB 3RU8L 4W68A 3P4OB 1RUKH 1NSNL 5D96C 1T1XA 2P5EE 3AU1B 3HNVH 1HHIA 2FYYA 2QR0B 4BQ8A 4LSVH 2DB8A 8CGTA 4OKVA 1R3LB 4WUKL 5J11B 1KENL 2NTSP 4LLAA 3REVB 4NBXB 1TPXC 2ZCKH 1MCDA 4A2LA 1EUTA 5FGCB 1T20A 3LQZB 4TSCH 1GVIA 3RGVC 4HWEH 5GRJH 3LN9A 3O8XD 4PJDB 3OKNA 1CE1L 3HI5H 4LKXB 3WEXA 2EYRB 4AG4H 2X4QA 4WV1A 4S10A 2A6JA 2DM4A 3ARBA 5DJDB 5CUSH 3CDCA 2LVEA 2YD2A 5DA4A 1OAXH 4MJ6B 4YHNB 3KPPA 1MUJA 4QNPF 3WFHB 4GLRI 3TO4C 3LS5H 4YXHL 2Z9TA 5TF1H 4Q6IB 3T65B 2FX7H 2ZNWA 1D5ZA 1BQHB 3O9WA 1MPAH 3VXRB 3LN4B 2HVKA 3QHZL 3OXRB 1ZLSH 2FJGB 3H2WA 4OV5A 4FABL 2WBJD 2CPCA 1IAIH 4YHKH 2BNUA 4WWKD 1XCQA 5TDOA 3DX9A 5CBEB 1TZIA 1YNTB 3T1FA 4YK4C 4WENB 3W0WA 5J7CC 2NY4B 3P11L 2R56L 3QUXD 3C6LA 3BXNA 3QXDB 5GSVA 1EZVY 5B8CB 1RSFA 1EFQA 3N9GL 4OBSA 1YN6B 1I7UB 4GKNA 1I8LC 5GGRB 1WUNT 1YEDB 3UTSD 35C8H 4JO2H 4JO4H 4M7ZB 3S36X 1A2YB 5L8KB 1CG9A 4KRPD 1NDMA 3SN6N 1A9BB 3RWHA 5KSUB 1W72A 3RX8A 4XNZB 1LK2A 5IQ9A 3QO1A 2HTKC 4KRMB 3ZE0F 1AD9A 4U6XB 1J8HE 4Z7NE 3QUKB 4L9LC 2MHAA 2H6PB 2P8MA 4PGBA 1OQOA 4MA8L 3RVVC 1BJ1H 2Y72A 3HI6L 2HT3D 4HC1L 3QDAA 4JDTH 3FB7B 1FC1A 3B9KD 4GUPA 1X5XA 2C9AA 1WBXB 3PV6B 3FT2A 3O8XB 4WW1B 3ARXA 4PJHA 3ZTJH 4ZPVB 5HYSG 4X7SH 4HUVB 2I27N 4F7TB 3OMZA 3FOMA 2XI9A 1FVDB 2OL3H 2OJZH 2VC2H 3FQTA 1GL4B 4OFVA 1B4JL 3JWOL 3VWKB 1DEDA 4G3YH 2ICWA 4Z7UE 4P23B 4CNIB 2ADGB 3B83A 1NBVH 5ICZB 2VDOL 3W39B 1V3KA 4QHLB 5DD6B 5D2LB 3NFSL 1JL8A 5I66A 3M45A 5L88H 2DL2A 1AGDB 4P2QD 1KIPA 3BWAA 4JO1L 4NYLA 3MBED 1U8OB 2BVTA 1YN7B 1QSFA 1KV3A 1QR1A 5DFWH 4EUPB 4NO2A 5JW4R 4V1DD 3B8SA 1RUAL 4KV5E 1FLRH 3W0WE 3GJFA 4GS7C 5GS1B 5I1GL 5EZOH 4XWGH 2F9BT 2AEPL 4R4NC 5DD1L 2XKNB 3LMJH 4X9IA 2W9EL 3MRLA 1J0IA 5BO1L 3V6FA 1MAJA 1FGNH 1NFDE 5GPRA 4OAWA 3SCMB 5KVFL 4ENED 2X4OB 1QRNA 3ZL4H 5B4MC 4OFYD 2EDJA 1U58A 1I3VA 4LVNC 3HHRB 3FONB 4NHUA 3MYJB 3FZUC 1TCMA 1TNMA 4U3HA 3GSUB 2HJKA 1N8ZA 1DUYA 4Z78A 4WO4C 1F4YL 2Q7NA 3ARFD 4PY7A 5BRZA 2FEEL 2XWTA 4OCSH 4UZGA 3RWIA 3OKDB 3DROB 5CILL 4XCYB 3FO2A 3BUTA 4RX4D 4NN6C 5I8CB 4JKMA 4UT6H 1TJIH 5DQJA 4ZFZB 1FIGH 1AHWB 4RNRB 2OTPA 4IIQA 3V6OA 4N5UA 3DV6B 2C4XA 3WFCL 1LK3L 5IUSA 3NIDF 3GIVB 4I0KA 2OZ4A 1LO4H 3DRTA 2N7BA 1DDHA 1KN4H 4ZOEA 5I18L 1MFDH 4LGPB 4HDIB 5E03A 2JJUA 5HHXH 32C2A 5L7XL 1KCRH 2HMIC 1G0DA 1HILA 3RL2B 5F70A 5E9DD 4R6UA 1J88A 3BD5A 1QSFE 2CXKA 5HHVH 4LLYA 2BVYA 3JVGC 3CIQA 5IMLA 5CEXB 1EVUA 4KJPD 4YDLB 5B21A 2FWOB 3RKDC 2B0SH 3ZT7A 1MCBA 3IAQA 1Y6MR 4QYOA 1MRDH 2F53B 3UBXI 2ATPB 5D7JA 4P3CL 5HSFA 5C86A 3L95B 4MAYC 1E4XH 3OGCA 4YDIH 5KVEL 1RZJC 1DL7H 5E8EA 4Q9BA 4NN5C 2Q20A 4Y16A 1RUPL 1QRNE 2GY7B 5J3HC 4DQOH 3V95A 1TJHH 2AJVH 4ZDHA 3IFPA 5DUBB 4NQXA 4Z7QE 1H3TA 4O2FA 5J13C 3OJMB 4KI5C 3TJHD 2AJZB 4QRQB 5J4MA 4R97B 1HNFA 3ARFB 5D5MF 3QUZD 4G9FB 4LMQI 1FDLH 5ICYA 1U92A 3RVWD 3QZWB 4OZGA 2YD3A 3V8CA 3ARSA 3MOAH 5FECB 3ET9F 5JIHA 4Q74A 2CGRH 3V6OE 3P0YL 4X5LA 4I5BB 2XIDA 1KB5H 3CX2A 4YJZL 2GSIB 3P4LA 3BHBA 4MQ7B 1GGIL 4KUCF 2AJUH 4HWZB 3P0VH 4NQDD 3M17A 1B0GB 4YFLF 1DFBL 1MEXH 3NZ8A 4HF5H 2IF7A 4EOWH 1G6VK 1GOFA 2ZCLL 3VFSB 3E2HB 1QQDB 3O2DL 5IHUL 1OSPL 1JWUA 4ZS6C 1I1AC 3QDGA 4M93C 3ZSSA 2HAZA 3H9YA 5SWSB 2EH7H 2QSCL 1ONQB 1GPOL 3DRQB 2DI8A 1BX2B 4PJ5A 3SDAC 1U93B 3GHBH 5MEOB 2MKLC 1E27B 2CDGB 1NBZB 2P7TB 3OR6B 1C08B 5E08H 3NFPB 3TBVA 4Q58C 4WTZG 1JWSB 2DIBA 3G04A 4N8VB 1RZJH 1UYWL 4N8PA 3SDXB 3SEPA 5J12B 5F9DC 2CDEB 3GGWB 3H9ZA 4L3EE 1INEH 1B0RA 1NL0H 1TCRB 1ADQL 3JTTB 3SJVE 5A2JH 3DO7A 4RDQG 1N2RB 1CFSB 4ODTH 2W65B 2VIRB 3ZYOA 1H5BC 5IIEB 4NRXB 2XZCL 4JLRB 2Q6WA 1KXTB 4NZTH 4YHLH 2DRUA 2NZ9D 2CR3A 1A7OH 3C2SA 3MJ9L 1G7PB 1QPPA 3VFPB 2JCCB 5DO2C 1OGAE 4ZTOL 2C4FU 5GRZA 2ZUSA 5KSAA 5EOCL 5KVDH 2E27H 4HUXA 3BP6B 4LVEA 4QLRA 3A6BH 5FGBA 4UOW0 3X13B 3LS4H 1FFRA 1HHHB 5EUOE 2DLFH 3A0OA 5DMJB 3SDCD 4I18A 2L7JA 2AI0L 4UDTB 3BSZL 5FO7B 2XG5A 3HCVA 1S7UA 1BHGA 1YMMA 1L4IA 2W60A 5CP3A 3DMMB 3SDDB 4P5KA 4GQ9L 1LP9A 4W4OC 3KYNA 2AK4D 1MQ8A 3MLTB 5E00A 4I13B 3CZFB 1HHKA 5CIPH 4M7JH 1DEEA 5T1KB 4ALAL 2YC1B 3LKNA 1DVFC 3PQYB 3QDGE 5DTFB 4DKEL 5C08A 3T8XA 2W0KA 2JJTA 1BGXH 4MCYB 1HWHB 4Z8FL 2AJYL 3EFFA 2RQ8A 5CJ5A 3D0VA 1A6ZA 1CFVH 3RA7H 4QRRB 2J88L 2NY0B 2NY1D 4LSPH 3FAXA 1OVZA 1BP3B 5I1JL 1WT5A 4GMTL 3BWUC 3OX8A 1A7RH 1R6VA 3RVUD 2YEZA 2M26A 3NGBB 5IF0B 4KMQA 1BECA 43CAB 3HFMH 3MBXH 4S1DC 1PKOA 3BEWB 2R15A 4L4VD 4UINL 4LVOB 5EU6A 5FYLL 5DMKB 5IEKB 1CF8L 1KIRA 4U6TA 1D5MA 4KY1L 2HWZH 4Y19B 2VZ1A 5IT2H 5AZ2H 4LRNL 5BOZG 5TPWH 2UY6A 4PGEA 2J6EH 3KJ4C 3MRKB 5I15L 2EXWD 4H0IA 4K71C 5CJOL 1JV5A 3TIEB 4PP1C 2XQYK 4FP8L 2XRAH 4KTDH 1YECH 4NWUL 5C6WH 2AXFA 1W0YT 1YNLL 1K8DB 3FKUS 2VWEE 3GHEL 4QWWC 2IAMC 1IL1B 3O3UN 4ZUSB 4HPOH 4OUUB 3EHBD 1NGZB 3MV8D 1CICD 2Z31A 1LP9E 4FQCL 5KANG 5DLML 4LASH 1YJDH 3L6FB 4JY6B 1PYWA 1ZHKA 1DLHB 4HK3N 4EKXA 4LNVA 2ARJB 1FZMA 4G8GA 2JIXD 4XP6L 3TWCL 3WLBB 4C4KO 1NCAL 3ARVA 1FCCA 3HAEG 4P9HC 3NZHL 3D9AL 3FCTB 2EKSB 2DQEH 3BZDA 2V2WA 1G9NC 5J1AA 3O9WD 5DMIL 2B2XL 4NC1E 5JLZB 1V3MA 2NY2D 4ZMAT 5F7YC 4MXVE 3PHQB 1EIBA 2AW2A 1EMTH 3I2CH 5I8EA 4ZG1A 1NMCC 5GS0H 1AI1L 5FUCE 4QXUL 5C07A 4L4VB 3FO1A 3THML 4EI6B 4LPYA 4UAOB 1UCTA 4QRUA 2DMCA 4Y4HC 2IGFH 4D8PA 3C6LD 4EI5C 4FQQB 1A5FH 3SKJL 4XNUH 2FX8L 3NCYP 3HC4L 3PNWA 1KYOK 1UZ8B 4LBEA 4DK3A 3H9HB 3NPSC 4XPAL 1DQDL 5HJ3B 5KG9B 2YRLA 5T3XD 3MTRA 3JV4B 4O2CB 2HKHL 3IETA 2OK0L 3KPNA 3QI9C 1TQCC 3GMRB 3WN5A 1OT1A 4ETQB 2OTUB 1L7IH 4L4TB 3S3PA 1KTLA 3MCKB 3QIBB 5K9OA 3GSWB 3O3EA 3VFVA 4IRJD 2EC9T 5I74B 3MV8B 1CICB 5AWNH 4S11A 5EU5A 5I71B 5SX5K 3KWWB 1AGCB 1DP0A 1QEWB 3OAYK 5GHWL 2CUMA 1WC7B 4G8GE 2ZOKA 1XT5A 4G6AC 4K3EH 4KHTH 3FMGL 3NAAL 4LQFH 3VI4E 2JIXB 5J56B 3K74B 2Y06L 4FQ2H 5AZEL 1HDMA 4P9HH 5C0DB 1T89A 5H35B 2XN9D 4ELKB 1G9NH 2GT9B 3QUMA 2AGJH 1B4RA 3RAJL 5I1DA 2P48B 4PB0H 5ECJE 3T3PF 4DEPC 1AQDA 1ZHNA 4IM8A 4HHAA 4EJ1C 1MLBA 1UACL 4JFPB 5IOPB 3UYPA 1N64H 1T0NA 2VDRL 2X10A 4U2YA 5H37H 1C12A 3QDMA 3WIHL 3HZMB 5ADOH 4U1IA 2HLFC 1RZIB 2V9RA 1P4BH 1I9IH 5C07E 2CLVB 1KJMA 3U4EB 2IH1A 4UBDC 2NTFB 1TETL 1BVLB 4KK8C 3IJYB 2CJUL 3MRNB 4HUWA 1YC8A 1ACZA 4PREA 1S7WB 3VRIA 4Z77A 5E8PA 1IM3A 5IV2A 2J1KA 2A83B 3V4UL 3L3DB 1CGSH 5HI3D 1A7NL 1MFAL 4W81A 4P2RD 3TNNA 3LSOA 5GRVL 4PS4H 1YPZE 3VGEA 1NMBL 4Y1AD 1R3HB 1HHJA 1CZ8L 3ARDC 2IALB 4M6OL 3HUJF 5DR5L 2Z92B 3HLAA 1YEFL 2YWYA 1NCDL 2O5XL 3MGTA 1NCNA 3QXAB 4KPHL 2Q86B 4TTGA 1KGCE 2QSQA 4BK4A 3MJ8A 4XMPL 3EYSL 4EN3C 1SYSB 4GRLD 5AUMB 5BRZD 3SKOA 1IEBB 3IAPA 4IRJB 1BOYA 4BH7B 1GIGL 2IANA 3MRPA 4Y5YA 4L8SC 1BD2E 3OKKA 1D9KA 4WHTA 4XCFL 4IRSA 5TQ2L 1EJ6A 2GTWB 2ZWLT 3MLWL 2DF3A 4FQJH 1FLTX 1U8NA 5T1DL 1MCLA 1OAUL 3WNKA 4DKFL 3TN0A 2XN9B 5CHNB 1UVQA 1MLCB 5I75C 5TE7H 3QEQA 2H1PL 4M4RA 3MV7E 4FFWD 2D7MA 1Q1JH 2B5IC 5ITFB 3FHQA 5I1HH 3TLRA 1CXLA 2FJFB 4R7DB 3L9RA 2HA1A 3VG0L 3RZCD 3HMWH 5ALCL 2HT2D 5DJ8A 3GJFK 3ME0A 4JHWL 2AKRA 5C9KA 5FOBA 4WW2A 1T2XA 1HH9A 3K2UH 1S8DB 1XMWA 3MMEB 4F8TA 4S1SL 1E0OB 1F11B 3REWB 3RBSA 3U0WL 3DVIA 1KTDB 3ULSB 4Y1AB 4POZC 4LFHG 3ZKXC 5C09D 1FYTE 1IGFL 5C0EA 3WD5H 4KMTL 2NY3B 3U79A 4LCYA 1UWGL 3FFCD 1CXIA 4HUNB 2WUCH 1Q0YL 3MOBH 5C70A 1VHPA 4G8FA 2LTQB 4D0CB 4DFHA 2PW2A 3QIUD 4GRLB 5I8KL 1EEYA 5B39A 1DSFH 2IANE 4MNHB 1WFTA 4YX2L 2UY7A 4E9LA 1CGVA 4QY8B 5F3HB 2VLRE 4YIQA 5D2NA 5DUPH 5MEPB 5JXAL 2I60L 3CUPA 5DI8A 1ULVA 5F6HJ 2VXTL 1J5OH 4ZTPL 4MQSB 2ATKB 2Y4SA 3GI8H 1WZ1L 3GDBA 4OI9A 3LZFH 3PE9A 4YHOH 1MVUB 2H26A 3QEQE 4JPIA 4QXGL 4HCRA 2V5MA 1R24B 4B41A 3Q1SL 1SEBB 3TO2A 4X80H 1OWWA 4QNPE 4UB0L 1YQ2A 3QULA 1X5JA 3U46B 5K9JL 2IPKA 1TTGA 4RFEB 2ADIA 3SE9H 1BBJB 5IMMA 1BBDL 2V7NA 4PJ5D 1ZGLB 4TTDD 4HG4J 4ZOAA 4KI1A 1EHLL 3RPIB 4E42B 4IHOA 4P5TD 3RZCB 1JN6B 2A77L 5ICXA 1J86A 5E2UL 3MFFB 1EBPA 4P2OC 3WKNA 3Q5OA 1Z9MA 1Z0MA 4IOIB 4NKMB 2GJ6E 2YUWA 3GIZH 4WVRA 4KZDH 2QEJA 1BQLL 2FBJL 5GJTL 1L0YA 5F7WC 4F7EA 3V4PL 3WO4B 2RFXB 3ILQD 1A6WH 2GHWB 4OSUH 2FDBP 3HR6A 2BERA 1NUDA 1J0KA 5C09B 3DGCR 1FPTL 2D31A 5D7KE 4XNZC 3FFCB 5HYJE 4CJ0A 1ZT4B 2EDRA 1JZ7A 1CWVA 5F96L 1GYAA 4CDGC 3QIUB 4LCIL 2LFGA 4PBXA 2L0DA 3ZE0E 3PWPE 4WI5A 1VGEL 2CSPA 3T0EA 5BS0B 4PJIB 3GMOA 1GZQA 5FGRA 3O8XC 1CS6A 1IGJB 1KLGA 3NCEB 1QFUH 3OKLB 3OPZH 5JW4N 5HDOA 4KJYA 5KS9A 1FL5B 4PRDA 2HH0L 1XGYH 3NA9H 1YMMD 3L7FB 3Q5TA 2WLYA 1UM5H 2R2EB 1KG0B 4AK1A 1JGEB 1GZPB 1U2CA 5EU3A 3RWDA 4UT9L 4GAJL 4NZUH 1CE6A 4X6CA 5F89A 2X1QA 5DD0H 1ZWIB 4F7PA 4N0RA 4GW1A 5C08D 4Z7WB 1G7JB 2VXQH 4XPGL 3EYQD 3QJFB 3WNNA 2AJSL 2DIAA 4PRIA 5JW3L 5TDNA 4YXKL 2WBJC 4WWKC 5GZND 2PTUA 4P5TB 5GJSL 4HIHA 5DJAB 3KHOA 1IGCH 4EBQL 3FQRA 1KJ2A 4ZD3H 1P5UA 1EO5A 3QUXC 1IAOB 4R96A 4HMEA 4JAMB 5E56A 4JREB 1YZZA 3FRPA 5I1AB 3MACH 1BF2A 1YUHA 2KUTA 1JWMB 2AEIT 1BFOA 3S3SA 5EU6D 3HC0A 3TH2T 1FVEA 3OXSA 3K7UA 4QHKJ 7FABL 4KRPC 3MRQA 1JPGB 3PWJA 5GGUB 5JNYA 4BSVA 4XC1L 5MP6L 3EDFA 1JNHA 3KPQA 4Q0XL 1INQA 3UJJH 5T3ZL 3W11D 3CPLA 5F7KC 1KNOA 2HT3C 3F7VA 5E24E 3B9KC 3C5SB 1P84J 2YPLD 5KS9E 1VENA 5C2BH 4P5MA 1G6RA 4KC3B 5MHSE 5FF6A 2WZPD 4S0TD 1RULL 3M07A 4R26L 1TTUA 4F9PC 5D70H 4YDVB 2G60H 3TYFB 5L0QC 4XH2B 4OTXH 3QBTB 4GQPH 5D93B 3V5HA 5C0BA 3B4NA 1HN1A 1SY6L 4HS3A 3NACL 4J7RA 1NLBH 5KTEL 4YE4H 3QEHB 3MODL 4ZNEE 2V17L 2PO6A 4PRIE 1QSZA 4DTGL 4OZFB 4MB5A 3MBEC 2EO1A 4YDLC 2VXSL 1YNKH 2IBBA 5EB9A 2DQUH 4S1QL 4R4FH 3U4BH 3MYZA 3ZKND 4XMLL 4NJAL 4BK5A 5C0JA 1BWWA 3IDNB 1VADA 3IJHB 3GSQA 4X9GA 2CLZA 1FFNA 3VD7A 5IWLC 2HRLA 5ISZA 4ENEC 5MENA 4YO0B 5LBSH 1JGUL 3QNZB 4MNQD 1OP9A 3SE3C 2CK2A 5FKAA 1MCIA 1U3HA 4MLIA 3ZLQC 4R2GD 2W92A 4M00A 4OCWH 5DDHB 4I3RL 2OI9B 2HJFB 2OX5A 3OKEA 4A6YB 3ARFC 4KI5F 4ONGH 1T22B 1OLZA 1LEGA 1Y0LB 4FXKB 3ULVD 5IQ7L 1YY8A 1PLGL 3E8UH 4Y5VB 3OWEA 1EXUA 4PLNC 4U3CA 3LKQB 1QHPA 3IVKA 1VGKA 1T4KA 2BJMH 2YPLB 3KDMA 5BQ7B 3O2VH 3RDTA 5HYFA 4GSDH 3NABL 4NUJA 5IFHL 4NN7B 1UM4L 2Q76A 5CBAB 2OR9L 1BOGB 3A67L 3VWJA 4HPYH 4D9QE 2MMXA 3RUGB 1AC0A 2WSKA 1SJEB 1S7XA 4HT1H 1R3KA 2J8UA 3QRGL 4OD1H 4F2MB 3GSVB 4NO0B 1G7HB 3N06B 3P77A 1K3ZA 2JJWA 5I9QC 4QRPA 1L6XA 4KJPC 3BQUA 3LCYA 5D6DA 5DJ2A 1CGTA 4UTAH 4WEUD 2PNDA 5DRXB 5GGQH 1LD9A 2DQCL 4KZEL 1V3JA 1KOAA 4JVPA 2VL5B 1TTFA 5F9WB 1P7QD 3CVIH 5D7IB 4JY5H 5GGVH 4JDZB 4DOHE 3QDMD 4QCIB 5C0FA 5MENE 3PWUA 3G5XB 1T1ZB 4L8BB 4OLYL 5TH2A 3ZE1F 1IGYB 5JOFA 4OD3H 4PJBF 5D9SA 3FT3B 2XA3A 1TZHB 5CSZB 4CW1B 3NCJH 4JKKA 4DW2H 4XNYH 4UTBH 4FQHA 3IGAA 4LHUA 1AXTL 3IDYC 1G7IB 3CFKB 4PRHA 4ZUWB 2GTZA 2J8HA 4QOKA 4C59B 3DVNA 5DZNA 1AFVL 3LY6A 3TJHC 3ES6B 3ZO0A 4MJIA 4QTIH 3CD4A 2NW3B 2A1WL 3C87A 5EC1B 3QUZC 3PP4H 2H8PB 1CCZA 5CAYB 3GJEA 3RVWC 2G75B 5HHOA 3FOLA 2VQ1B 1RIVL 2YWZA 3T0WA 4GBXA 2ICCA 1PKQA 4HEME 5IP4A 5C71A 6FABL 1CL7L 2CDFA 4OF5A 4XBPB 3QHFH 1JNNH 3DGGA 3VXPA 3F58L 4U6YA 5HYSB 2X1OA 2GITA 4PP2B 4XBEL 1KTRL 3CDGB 4X6DA 3RWJA 4YDJB 3TT1L 3QYCA 4CKVX 3VFGL 5ANMB 1QBML 2X4TA 4UIMA 1TJGH 2NX5B 4MDJA 4FFVD 4ZPTB 4ZUTB 1U3ZA 1NGQL 3OKYA 4Y4KB 1OF2A 3R06A 4Q9QL 4RGNE 2I9TB 3MRGA 3VFOB 3T77A 1KJ3L 3LKOB 5ILTH 4IDJL 5J1SC 4PJAA 4PBWD 1I3UA 3CSYB 4QRPE 4O2EB 3RI5K 1YYLH 5LGKA 1M71B 1FE8H 3CLFL 1MFCH 2BY1A 1B9ZA 3JTSA 3TNMA 3HI1B 3TN0D 2VSDA 2IQ9H 3K2MC 2V9TA 5F9OH 4QHNB 3P4MB 3BGFC 5KSVA 4JRXD 4LKCB 1AQKL 4HJGA 1XGTA 2B1HH 4LMQE 4WTXA 1NC4A 2DKSA 4NQEA 1MCQA 4J3VA 4NNXB 1P7QB 3MUHL 3BAEH 2Y23A 4EQ3A 1ORSA 5CJQH 2CUHA 3AUVA 3LEVH 2XXCB 3WSQH 3S4SA 4E0RB 4OCNC 4PRHE 1RZFL 4QOKE 3VJ6B 3UTTB 3BEVA 4HV8B 5MEQB 4GXVH 3RFZC 4MJIE 1DQLH 2KZ1B 1NFIA 3S9DB 1F45A 2HN7A 2EIZB 3O3DA 4J3XA 5FYKD 2P8LB 2NZ9C 3C09C 3VW3L 1T7WA 3U30C 4X6FB 3L1OH 4OCXL 1FFOA 1OT2A 1C16B 3G5YB 5EBLB 3HN3A 4JFHE 5GS3A 4YAQA 4JPVH 2HTLD 4FQLL 3SDCC 2EDFA 1Z9OA 3F5WB 5ABDE 2VR4A 4PJ7B 3DLQR 4U2ZA 4TULH 2ENSA 1NAKH 1RUQL 1B2WL 2IBGA 5CEZL 3EJZD 4OZIA 1IILE 4WTWA 2I5YH 3TZVA 4HWNA 4UILH 1GHFL 5DHYA 1V7ML 3U2SA 3F7RA 3MRIA 3BPNC 4ORGA 3ULUD 1J05B 2Z91B 3Q6FA 2MOVA 3OQ3B 1RHFA 4KFZC 1AR1D 3GMPB 4HC1A 3L3JB 1YQVH 3MXVL 4G6FD 2NY1C 4NQEE 3D3VD 4JRXB 3BISA 4D9RD 2J4WH 2X1PA 1NGWA 3CK0L 4G5ZH 5JOEA 5IK3B 3GB7B 4UDUA 5D1QD 3MO1A 2D7NA 5I73C 5SWZB 5C0IA 5CD5D 3HAEH 4F3FA 2E7MA 2OS7A 5HHPB 4GG8A 1Q0XH 3IXAA 4XXCC 5I1LB 1T21A 3WFZA 3C6SB 1A6VL 1NCUA 3TIDB 5I1IH 2EXWC 1U6AH 4S1RH 4Y4FA 3FB5B 1L6ZA 3RWFB 4F33B 2HKFL 5CGMA 1MNUL 5IJKC 4IRZL 2PYEA 4Q9CA 3WUWG 2IG2H 2VITB 4OT1L 2VH5L 5ALBL 3VFTA 5GISL 1D6EA 4M3JA 4DN4L 1I9RL 4J3SA 3HE7B 3C5JA 4DJMA 3X3FL 1UXWA 3HUJA 1NCWH 4POUB 1G9MH 3EHBC 2CIIA 4UNUA 3TVMB 1F4HA 5I74C 1MHCA 4FTVA 5DVKA 4XRCB 4G6MH 3G6JA 4EVNA 4U1MB 3T0ED 4JM2A 4M7KH 5F7DB 3TPKA 2G9HB 1XR9A 1DN0A 2CKBH 3GM8A 3CFJB 3MV9B 2AXGB 2XWJA 4KQ4L 4TQEL 1Q9WA 1XCTB 4NSKB 4NFDA 4Q97A 4J3OC 3F12A 4Z7OF 3PGFH 3V79C 1RI8A 1ZANL 4LEOA 4MXWH 1V5JA 2K7QA 4LLVA 1I8KB 3O6LL 1HZHL 4IOFD 4KKCD 1XIWB 5FUOH 1NBYA 4C56B 1ETZA 3PIQA 1R5VA 1W0WB 3B5TA 3O9WC 2ZSVB 3GMNB 3T3PE 2GI7A 1NGXB 1KLUB 2NY2C 3FQXA 3VXUA 1J0HA 1OP3H 4LNRA 4X7SL 5GSRA 1T5XA 3OJDB 4MHHG 2BFVH 1AIFB 1IGIL 1OARL 4XP4H 5K9KB 5IGXH 5B39G 1IGML 3S34L 4X7FC 1F8TH 3UROR 3MLRH 5LQBH 1QO3A 3LDBC 3C6LC 5TQ0H 4LCCA 5E6IA 3I3EA 3DYOA 4QHUA 1PEWA 1C5CL 1MHHA 2Z93A 4GRWB 4WFHE 1CDYA 1A1MB 4HFUL 3HUJE 2ZUXA 4I3SH 2H32A 5ENWA 4AH2A 1ZGLP 1CYGA 2AEQH 4PB9L 1NAMB 1UM6L 1DE4B 2IPUG 5SX5H 1P4IL 1F3DJ 3G6JE 4L8CA 2JK5A 5FIEA 3OAYH 3WE6B 2PF6A 2VLLB 3BZ4B 4CU6A 5F6IB 3Q6GL 3CLEH 2BOCB 4I0PB 4M7LH 1WQVT 5L8JB 4KHXH 4NT6A 2BSTA 1CXEA 3FFDB 3DJ9A 4Y5XB 5EOTA 4FFZH 2R2BA 4I77L 3IT8D 5DJ6B 3TT3H 4C83B 1I3GL 1N5AA 1YEJL 5E6YA 1YEGL 5I16B 3GSXB 1D5IL 4IMLA 3RGVA 4KKNA 3VFUB 3CFCH 3DBXA 5EDXA 5C0BD 3D25B 3Q3GA 5JXED 1XF1A 5DJXB 5E2WH 3DO3A 1QSEE 3VXUE 2DD8L 1XF2B 3ZSTA 4JKWA 4E41B 3HR5A 3PWLA 1LO2L 3NN8B 1PD6A 1U8HB 3LKPA 3I6LD 2P5ED 1RZ7L 3ZYIA 3GO1L 1PQZB 1KCSL 1OM3L 1NCBL 1XGUB 1P4LA 4LLDB 3O2DA 3S37H 2BP3A 5HI3C 1MHPL 2GJZA 1CL7I 3LIZL 5D7SL 2XTJE 1YEIH 3QA3A 4GOSA 5ISZD 2VKWA 1VACB 5KOVC 4JFQA 3GBMH 2BRRL 2EDHA 4XPTL 4XXDB 1NCCH 2QQNL 4G8IB 5C0ND 5LWYL 3ZKMC 1U3HD 3DXAE 1W72H 1XR8A 4M6ML 1RU9L 5DURB 3IFLL 5HY9A 3O45A 4U05A 4NIKB 4ODBD 8FABA 3PWNB 2EDLA 4GRLC 4HH9B 4NBZB 5ITBH 1J87A 1XZ0A 2O5YL 3KXFB 1HQRA 1G7QA 3CFEA 3PGCA 1ADQA 1H3GA 2D4FA 5IMKA 1IC1A 4KK5D 3WNPA 4UT7L 5JTWA 2GUOB 4GKZB 3TYGH 3RDTD 4KAQL 3MROB 2YPKB 4JB9H 1QBLH 3ARTA 4L9LA 4B7IA 1IEAB 1QLRA 1U8PB 3RNKB 3GUTA 5IR1A 3N85H 3NIFF 4AEFA 4ACPA 3RL1A 3UPRB 2D9QB 5ERWB 3GK8L 4RAVA 3VWJD 4K3JL 3QG7L 2IQAA 3QDJE 3O6FA 4PJCA 4ELMB 3DX6B 4FFWC 1DUZA 4NNPL 4OIAA 2VNCA 2E8ZA 4YHMH 2EZ0D 1R5IA 3FRPG 3STZA 3MCLH 2HG5A 3GBLA 4HKJB 3BZEA 4MWFB 1OPGL 5LAXA 4RBPH 3UJTH 4XVTH 4DGVL 3RZCC 1G84A 3GJFH 4OIIL 1JZ4A 2W07A 4OQTL 4HJJH 4RGOH 1U9KA 5IHLB 2P5EB 4ODVH 3OTTA 2HT2C 1S7QA 4CJ1A 5F9JA 5HDQH 3CDYA 3ROOB 5CP7B 5JZ7D 4DCQA 3WO4C 5IVXF 5BZWA 4RAHA 5JUEL 2D03L 2Q7YB 4OIBA 1G7LA 1JHKH 3WMSA 2DKMA 3RNQA 3CFBA 3L3GB 1YEEH 5IB3B 1GGBH 3U6RB 1HHGB 2K3TA 4G7VL 5EZIH 4BFIA 5JPNB 4YC2C 1VFAB 3WXVL 4G80A 4RFNB 2VL4A 1U8LA 3SGJA 1WIUA 2VISA 4KK6D 4X9FA 3QIUC 5IG7A 4X8JB 4HIIA 1I85C 4Z9KB 5T33H 5HHOD 1UWEH 1S3KH 4HQQL 4WUUD 4GBXD 1TLKA 2BNRE 3VFWB 1ES0B 3EYVA 1LE9A 1O0VA 1U8MB 4LVHC 2FH6A 4UMGA 3SKUD 4Y2DD 1EHNA 4H1LG 4Z7VB 1HEZB 1S9WB 4JKPH 3IDXH 2OZ4H 2WNGA 3IDJB 4XPBL 1EEZA 2FATL 4MSWA 4PJCE 2LU3A 4I2XB 5L2KA 4YXLH 4U6VL 4F8QA 3LRSA 1T3FB 4JZJB 1XGRA 4P4KD 3T2NL 4M5YL 4ZO6A 5DQDH 4QRSB 2DDQL 4HK0B 4FNLL 4WI8A 1CLZL 5B3JF 4YEFA 3VXSA 5HGHB 2EDKA 5IB1A 3AMLA 1DANT 3D1MC 1RHHB 1J8HB 1UJ3A 1T20B 4P46A 4PTUA 3CU7A 3QQNA 4KTEL 4TNVF 4XNMA 1GGTA 4JN1H 3BDYL 4N68A 3N50A 1MRFH 1PEZA 1F4WL 5E8DH 2P47B 5D4QA 5T3XL 4R90L 5FHBL 4PJXB 5F8QC 2YKLH 1I1YA 4C4KT 4G43A 4YZFF 4DGIL 5LGHL 4OLVL 3TV3H 2CK0L 3EIFA 4LAQL 5HVHC 1A21A 5DUMH 3NH7H 3UBXG 4M1GL 4XCCL 1FH5H 3IYLW 4IS6A 3IU3B 2ITDA 4Z7UB 3DVGA 4NO3A 2OR7A 2J5LB 4CMHC 1NQBA 1UB6A 3KYOA 4J6RH 1LHZA 2VXUL 1GGCH 1S7RA 4HMDA 4WUUB 2G5BB 1I8IA 3MLUH 4YGVA 5A2FA 4EIZC 5M7QA 3CSPA 1ZAGA 3R8QA 5C6TH 4CRPA 1T2QL 4J1UA 2X4SB 4ESKA 5IEHB 1H3VA 2P45B 2GJJA 4Z0XA 4PJFF 2WBKA 5C9JA 5DA0B 1MI5D 4U1GC 3AFLA 4QT5A 4TSAL 5EBWA 1MCCA 3N1QC 1OGTA 3IFNH 3VU2A 2MJWA 3VFRB 3TZVD 2HFEA 1JF6A 1SYVA 2I9LA 4GW4B 3LD8B 4MX7B 3EFDL 1JBJA 1NFDB 2OJEA 5JORB 2ITCB 1VFUA 4P4KB 2JJTC 5FO9A 3EYQC 2Q1EA 4G8EB 1XH3A 4F9LA 3FB8A 1RMFL 4FQIL 4LHUG 4FHBD 3U36A 5I1EL 5GZNC 3BH8B 1AO7D 3VXSE 1WFOA 4LRIC 3LQAL 1BQUA 1TITA 2EC9U 2R1YA 4ERSL 1ED3B 2EDXA 3G5VA 1WT5C 1N0XL 3KLSA 4OCYL 1JGLH 3BKML 2NLJA 3O4LD 1LGVA 4GUPB 1PZ5A 4H5SA 3CXHJ 3HA0A 4WI9A 4OI8A 3HZKA 4UOW1 3VD4A 1LEIB 2PCPB 1RK0B 1BLNB 1WTGT 4TUJA 2ARJQ 1YEHL 2EDNA 1NKOA 2ORBH 3V7MA 2UZIL 2ADFL 3IFOB 1V8HA 4JQVC 1I4FB 4Y4FD 3X12B 3FN3A 2PYED 2RGSA 3I02B 1SBSL 3BP4A 2E9BA 4JJ5B 3DURA 3WIHA 2F8VA 3BKCH 3W11C 3W9DA 3IJSA 4TN9A 5TFSH 4PUBH 1S5HB 2NY5C 2ZUTA 3EZ8A 1IM9B 5IW1B 4OGYH 3D39A 3VI3F 2CIKA 2Z8RA 1HCFX 5DEGA 3WHXB 4GG6B 1PX3A 3LPGA 4FTVD 4NN7C 4TUOA 5CP3H 1OB1A 1EX0A 2VTFA 4E5XA 2FCBA 2Z31C 2AK1H 4RDQF 3QFJD 1A64A 4R4BA 3S35L 2QV2A 2WINA