3WS6C

Crystal structure of h-2d in complex with a mimotopic peptide
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
97
structure length
97
Chain Sequence
b'KTPQIQVYSRHPPENGKPNILNCYVTQFHPPHIEIQMLKNGKKIPKVEMSDMSFSKDWSFYILAHTEFTPTETDTYACRVKHDSMAEPKTVYWDRDM'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords H-2 class I histocompatibility antigen, D-B alpha chain
publication title Compensatory mechanisms allow undersized anchor-deficient class I MHC ligands to mediate pathogenic autoreactive T cell responses
pubmed doi rcsb
source organism Mus musculus
molecule tags Immune system
total genus 14
structure length 97
sequence length 97
chains with identical sequence D
ec nomenclature
pdb deposition date 2014-02-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3ws6C00
1IM9B 3QDMD 3ZKQD 2CKNA 1MCKA 1SBBA 4NQEE 1P7QB 4J3SA 1H3WM 4KZEH 1ZTXH 4WFED 4PS4H 5A40E 4G8IA 4DK3A 5HVWA 3P0YL 3ZSSA 2EO1A 4EN3D 3DMMA 3KGRA 4NZDA 2GI7A 1VENA 4L8DA 3G9VA 3WIIL 4QHMA 4JN1L 1U8PA 2H8PA 4PP1C 4NO3A 1OTSC 1JMZA 3SDDD 4UDUB 5AYUH 5EA0L 3IGAA 3RTQB 5DVMA 3LRGA 2JIXB 5FECA 4HLZG 3KYKH 1KCSL 4JFOB 4JPKL 1MQ8A 4M93B 3PGDA 2A73A 4P5TA 1NANH 4J3XA 2VZOA 4YHNB 4NNYA 2B2XL 1T0NA 1WCBB 5HYSB 2EXYC 3LVEA 3LEXB 3ZT5A 1UENA 4I3RL 4Z77A 1TCRB 2FWOA 1ETZA 1MFCL 3PHQB 1NFDE 3ARWA 1U8JB 4L5FH 4MA3A 2H26B 2IPKB 3DIFA 5CHNA 2RR3A 1J8HE 4UB0H 1K85A 3W81A 1JWUA 3FFCE 2FRGP 1SY6H 1KB5A 3C6SA 4I18A 2Y36L 3HNTL 3WE6B 1CYGA 1UWXH 4U1SB 5IMLA 2JLLA 4G8EA 4MA1C 4URTB 3RL1A 3GBNH 3A6OA 3EYUH 5E2WH 4JQVA 5D6CB 1FFRA 2A6KA 5KSBA 5ESAA 1JHKL 3D2UB 3GMPA 5FUOL 4V1DB 5M95B 2A6DA 5D7IF 4P3CH 3O4LE 3VFSA 5CGYC 4J7RA 3DURB 4U3HA 4RFEB 4ONFL 1F4YL 4QY8B 3MJ7B 2I07A 3W2DL 4ZD3L 3L5XL 3MRRA 4TNWF 4UBDD 4TUJA 1BQHA 1MVFA 1UXSB 2EECA 1MJUL 2W9DL 3KPOB 4U1HA 3OXRB 1T1XB 5I1EH 1OWWA 1D5XA 4XB7A 5DD1H 3MLWL 4QXGL 4XBGB 4Z7WB 1AR1D 1OAYL 3DUUA 2PYFB 3UTTB 3RIFK 3BP5B 5DUPL 2IQ9L 4PJXA 3SCMA 1YEDA 2AJ3B 2MFNA 4CJ1A 1A21A 3GSNB 4AEHH 3ZDXF 3P0VH 5HHMD 2P1YA 4FQIL 4JHAL 1JRHH 5F70A 2Y4SA 2PUQT 4HGWA 4P59L 4KV5F 4H25A 1U93B 4FMKA 2EEBA 3IFNL 3SKJL 1UA6H 4OF7A 5F89B 1HEZB 3MFFB 4U1GB 4Y5XA 3I50H 4HWBA 3IVKA 4K23H 4KHXH 2NY0B 4FP8L 3S3SA 3TVMD 5JOPD 3HPLB 4I8DA 2HFFB 2DBLL 1I9IL 4JFHE 4XTRC 3BYYA 1U8OA 2L4OA 3LY6A 2YKLL 4P23B 1O7VA 4L8SC 2W65B 2DYPD 3T2QA 1NCBH 4IRJC 5B3JE 3O6LL 2VLJE 4JB9L 4AQOA 1B4RA 1PSKH 1TVBA 4ZPVB 1P4IL 1HNGA 4NKOA 3GSRB 4HT1H 4KJWC 1MHEB 1YZZA 3D25A 4NC0B 1G84A 5CP3A 1UB5B 1MCIA 3VXSA 2BNQD 3QHZH 4XPFH 2QQKL 3HFMH 4R0LC 1A4KB 4YWGL 5F7DA 2R1YB 3OKOB 5EH1A 5EG6C 1MNUL 4OUUB 2XOTA 4LCUB 1IGIL 3WDIA 4LSSH 1KLUA 3P11H 1KGCD 4F33A 2EDTA 3EBAA 3GDBA 3C6LD 2B39A 2IPUK 3PG2A 1X5LA 4HUKB 5JOEA 4LOUC 3CSBA 5F9JB 1FE8L 5GS0L 1G7HB 1X5GA 5DMJB 1G7LB 4YUEH 5KSAC 3U30C 1VKXB 1P69B 5DD5L 4L1DA 2HG5B 3IDMB 2GIYA 5J6GA 5T5FL 5A2IH 5I17A 1H15B 3BYTA 4KVCH 1EHNA 5CMAA 4ZQKA 2IADB 4JO1L 4LQFL 2BCKA 4EZMA 1CLOH 3BT2H 5JPNA 1NKRA 1IC4L 1K8DB 1KNOA 4PJIA 5IJVB 1N7MH 2VITA 4JY5H 2MCPH 2DQJH 5ENWB 4YHIA 2UVFA 5D71H 1LDPH 2AEIT 3P4NA 3VI3F 2BNRD 4XZUA 3C60A 1P84K 2CPCA 1DN2A 1KN2L 2B1HH 3M8OL 3RVWD 1RAMA 3LCYA 4G8GD 1JYXA 2IPTL 2DD8H 1XCTA 4Q0XL 3QCVH 4PJFE 1RIHH 5DQJA 2BSRA 1T1WA 3GSQA 4LEOB 3FJTA 5I8KL 2F8OA 1CCZA 1DQML 4H1LA 5EC2B 1UKQA 1NGXB 2PW2A 1CDYA 1R0AL 1RZGA 4R96B 5CJQL 2C1OB 4NZJA 1BGXH 4I3SH 1BQSA 2PCPA 2YPVH 1LO3H 5GJTL 2MHAA 5GZOD 5EZJB 1Q9OA 4JRYD 2NPLX 1N5AB 3CX2A 4N8CL 4F7CB 2XN9A 5F7EH 4OLVH 3IRZA 4O2FB 1W72B 3SE3C 3TVMB 2EIDA 4LSTH 2PR4H 3TPUA 2BMKA 1QBLL 5DMKB 4ZAKD 3VCLB 1KXQE 1ULVA 3V7MA 4OZIB 4FABL 3KDMB 1H3VA 4CKVX 2IMNA 5C0AB 1NC4A 5I16B 2DWEB 4GAGL 5KAQF 4XWGH 4GKSB 1KXTB 2EYRB 3KLHC 4MAYB 1KBGH 4M9OA 2FBOJ 4EXKA 1A2YB 3EUUA 3AS1A 2AQ2A 3BHBB 4QWWD 3FOMA 4BZ1H 1ZS8B 5DJCB 4WDIB 1CFNA 1JNLL 5EU7E 2K7QA 2O5YH 2F8XC 5EO9B 4E41A 5C0CB 2H9GB 1E4XL 4XMKH 2Y6SD 4Y5YA 1AKJD 4K9EH 4KXZI 1JZ8A 1N59B 2NYYC 3DX7B 3H9YA 5F88A 1YEHH 3HRPA 4B53A 3TV3H 3PP4L 3H3KA 2NY3B 1P9MC 4L4TE 1EJ6A 1AD0A 1RZ8B 3BKJH 2GTWA 4X6DA 2B8OT 4GXUN 2XWTB 4OKDA 1FZJB 3O2VH 3FFDA 4DW2L 1T7XA 3EFDH 3DHMA 4FZ8L 3D69B 3S35X 5HHQB 5BRZD 3LKNB 5B38G 3MC0A 5B3NA 4NBXB 1ZA6B 1OW0A 3MNVA 1QNZL 2MQ3A 2DKUA 2QHLA 2OI9B 5KZCD 2Y5EA 4XPAH 1HK6A 5I71B 3O3EB 3D39E 1GC1L 1GOFA 2V2TA 5TE4H 5I1GL 5IROC 2RAMA 1DVFC 3V0WH 3NA9L 1TJIH 2Z93A 3OR7A 4J8RB 1T83C 3QEGL 2LV4A 1FVDB 1X5XA 1MWAH 2LFGA 5DRNA 5IKCB 4S1SH 5EU6E 3SDXF 4X7TB 5GGRY 4MA8L 4RISH 5DK2B 3CX5K 5D1XD 1FVCA 1XGPA 4AENB 1RZJC 1ND0A 2BHUA 2YZ8A 1WBXA 4WTWA 3CFKA 1DN0A 3O8XC 4Y1AE 1IAKA 4RZCB 2NZ9D 2W91A 5IV2B 2IAMD 1UQSA 1JPFB 3E6FA 4LFHD 3K8LA 4ENEC 5E2TL 2HJLB 1EGJH 1FL3A 4JZOB 5D7IE 4B0MM 3K0WA 5CZVH 3V5HA 2C3WA 5IHUL 1HKFA 3V52H 3GJFB 3PWUB 4NZUL 2UZIH 3G5VA 4IM8A 4ZOBA 3H7LA 2ICWB 3VFUB 1RZKC 4WI6A 1BF2A 4S0TD 1LO4H 1YEGH 3QT2A 2JJTC 3ZE2E 2ORBL 2WQ8A 43CAA 3WHE1 1R3IH 4TRPL 4MGXA 1ZHNA 2VLLA 4Y4KA 2IEPA 4XXCA 1ZTXL 4PS4L 3CSPA 1LK2B 3OKKB 2ED8A 1K9TA 2CMRH 1NUDA 1D5MA 4ODUB 1NFDB 5C8JA 2J88H 3ZL4H 4DGYH 3MV8D 4Q58C 2HKFH 3RDTB 4FQCH 3R06B 2JK5A 3DGGA 3ZDXE 1QG3A 2AJYH 5AYUL 3MYJA 3KNBA 3FFCB 4ZFZA 5D7KD 4N0FA 4AT6B 4CVZB 1F3DH 4KV5E 3LQAL 1S78D 2BY2A 3PGCB 3WJJA 4EN3C 5HYQA 1TQBB 1JGDB 3KYKL 3O6FB 2JE8A 4TTDD 1NDMA 3VFRB 2ZUUA 3OKNA 4B5EA 4JPVH 2BNUB 2V2WB 4F2MA 1N0XL 4E0RB 1Q94A 4YDLB 4TN9A 4DTGH 1FL6A 5SWZD 3FZUD 4ZUUA 4F9LC 1KJ3H 4YDKH 1M7IA 2P49B 3O4LB 5T33L 2AV7A 2Y7QA 1G6RA 3RX5A 3QIUD 3VXPB 3BIAX 3LRSA 3QI9A 2CLVB 1X3DA 4LBEB 2X41A 1GRWA 4NRXA 2I9TB 3FN0H 1LILA 1O0VA 2YPLA 5C0BB 4I3GA 5ESQB 2VQ1A 1ZLVK 1LK3H 1BFOB 1N2RA 4KK8D 4L5FL 1QEWB 4HH8A 4NQSB 2NNAA 3P77A 4Y4FC 3MQIA 3OKMA 5DC0A 2WNGA 1PZUB 4AMKH 1HZHH 5DJYB 4X8JB 3CIQA 3HNSH 4ELMF 3EJYD 1F3DJ 3GBNL 4KJPC 4YR6A 4MCZB 3RPIA 1T6WA 3HE7A 5EBMA 3RWJA 1I7ZB 1T89C 2FHFA 1UKSA 4P3CL 4J3WA 2EDXA 5HDOA 1LEIA 3MOBH 4PJEF 1Y0LB 4P46C 5DSCB 4JO4H 4BKLA 1F4XH 3SDCD 1DP0A 5FHAH 3GEWB 4GAFB 5EUOA 4TSBH 4YJZL 5CIPH 1XZ0B 2FBJH 1E28B 3FO1B 4L9LC 4WW1A 1NDGA 3S96A 4Z7UF 1CQYA 5DD1L 2VTFA 4NQTA 4RWYH 5DT1H 5HXMA 3OAZK 2ZKHH 3H9SA 4KPHL 1SEQH 4LSPH 5HGAA 1FCGA 4KZDH 5LBSL 4Y2DC 3RVTD 1HDMB 5E6IB 5F9WB 1SEBB 3LAFA 1INEH 3WXWH 4XPGH 4AEHL 1CFBA 4PJ7B 4GRWF 4Q6YA 4WW2A 5CILH 1QOKA 3EDJA 1JRHL 4CMHC 1Y6MR 1HHGA 2FB4H 4JDVB 2QSVA 5DMYA 2ZUWA 3VI3E 3K8KA 2NXZB 5JPMA 2EDBA 2X4OA 4LCWA 1UA6L 1OB1B 1G7QA 2BDNL 2Y07H 2BC4A 2OBGA 2VDPH 4K23L 4PV8B 5DO2C 4H26A 1BZ9B 1B3JA 2L7JA 3NZHH 3VXUE 2HVJB 5KOVC 2XTJE 3D87B 4D9LH 5IVXF 2HFTA 2LABA 2V7HB 5HGBA 3ALPA 3G5XA 3H0TA 3CSYA 2EDFA 1NCBL 3LQZA 1YMMD 5HHOD 1D5ZB 3GO1H 2D31A 2PXYB 4AL8H 2YOCA 1VA9A 4NCDA 3S97C 4HT1L 1TVHB 2R56H 4EI5A 3G5ZA 4GBXB 3QHZL 1RJLA 4XPFL 1RY7B 2YD7A 1GOGA 2FLRT 3QIBC 3QUKA 4GRLD 3KPPA 3SO3B 1C16B 1HYSD 3FRUB 3KLAB 1HXMA 3QULB 1TZGH 4CJ0A 4NT6B 5C07E 3QNYB 5LKNA 4FFZL 4LSSL 2AK1H 3MUJA 1JPST 5BZDB 3HR5A 1RULH 3BGAA 5KSVB 3VXNA 1MLCB 3VRIB 3FQRA 5KJRH 3HS0A 3PDOA 2Y5TA 3BZDA 3P4OB 1S3KH 3ULUH 1JE6A 2P42B 35C8L 1BJ1H 2ARWA 3O41B 4PRHB 1LO5A 4M3KB 2OQJA 5FGBC 1VADA 3T4YA 1VEOA 4YUEL 3RWGA 3BUYA 4GAJH 2A83B 4DOHE 1CN4A 1CD8A 4KVCL 4R4BA 2VZUA 2KKQA 4I77L 3BT2L 1MAKA 4PUBH 4YQXL 1N7ML 2XY1A 3OPZH 4FNLH 4JFQB 1AY1H 1KIPA 4LKCA 5FO8B 3VDCA 2R0KH 4JY5L 4P57B 2MCPL 3TYFB 5IMKA 1QSFA 1RI8A 2VQUA 5BQ7B 1GGTA 1LDPL 4RGMB 1YNKH 5C0IB 4NUJA 3B9DA 3VWKD 5EU5A 4N1EA 1DLHB 2J3SA 4XAKD 5EU3B 3HG1A 3BPLB 3QCVL 4HWNA 1RIHL 3HAEB 4KMLB 5DHYA 3U7YH 4DZBA 5CJXA 3WFHA 4F15B 1IGYA 1TJGL 3LEVL 2VLMD 1BJ1J 2HA1A 3UO1L 4AG4H 5DVLA 1RK1B 1BGXL 3AREA 2J7LA 4I3SL 3REVB 1A7BA 2YPVL 3ARZA 3QPXH 5F21B 4Q7DA 1IILE 3DMMD 4O2CA 1QFUL 4KI5D 3ULSA 5T1MA 5T3XH 4KKNA 3AY4C 4I2XE 4K7PH 5CBAA 3TO4B 4GUPA 3C5JB 1FBIH 3MBXH 3QJFB 5F7EL 4IS6B 2VOTA 3ARFA 3T4AA 4LSTL 5AUMA 4QXUH 1A9EB 1XR8B 3BAEL 4IOFD 3KPNB 2H6PB 4YHZL 3ARBC 1TZIB 4L4TB 4QTHB 4ETQA 1B0GA 2HAZA 4UT6H 1IGTA 5E8OA 3CFJA 4LLDB 4XWGL 4JJ5B 2WIMA 1QFWH 4NZRH 1KBGL 3UTOA 2DQTL 2DJ4A 5IVZA 5FF6B 3PF2A 1IGCL 4NQXA 5BXFA 5IFJA 3IFLH 4Y5VA 2DQEH 2P8PA 2O5YL 2VQTA 5I18L 1CGVA 4PGZA 4Z7QF 4NKIH 4XMKL 1OT1A 1QUNA 3BEWB 4N9GB 4YXKH 2OTUB 1B0WA 1DQTA 4XWOD 1D5BA 2G5BB 4XPTH 1A6UH 4NKMA 2CUHA 4AIOA 2F5BL 4F9PC 3BKJL 3NCBB 3A6CH 3EO9H 2VLJA 5EU6B 3Q6FB 2QSCH 4QRRD 4XHJD 3P30H 2Q76B 1JPGA 2GITB 1INQA 3K1DA 1K2DA 3EFDL 2BY3A 1SM3H 1DFBH 1CIUA 1PKQA 1UVQA 1MHPL 3RWHA 4S1RH 4C57C 1KACB 4JQIH 3G08A 3EKCA 5GS1B 2YK1H 2W1NA 4XPAL 1BBJA 4P4RB 3BO8A 2P5EE 4EKXA 2WW8A 3L3DB 5TE4L 3RGVB 4MJ6B 2PW1A 4FQXB 3N85H 1REIA 4JZNA 3B6SA 5E5MB 3ROLB 2X44D 4M7LT 3V0WL 4WJ5B 2X70B 3SE4A 2DWDA 2FX9L 4GG8B 2J8UF 3ZKXB 4XCFH 1MWAL 4ZODA 2AV1A 3VGHA 2VJXA 1GZQA 4RISL 4WUUB 4LIQL 3MSPA 1IQDA 3SBWA 1I7UB 4PJ5E 3BZEA 4MJIE 2AEPH 4JDZA 3SGJC 4NC1E 4Z6AT 5ACZB 3QG7H 1U8LA 4ELME 1W8OA 3H6JA 3JWOL 1DQJB 1NCWH 1BZ7A 5D1XC 4OCYH 2H8PB 1IEAA 4NQCA 4NO3B 2WLZA 4PGEA 3QDHA 1QFWI 1EGJL 1I9JH 3JTTA 1RPQA 1L9MA 5DURD 1T2JA 5TGBA 7CGTA 1AXSA 1HOCA 5CZVL 4D9QD 4PJEE 3RZCC 2V7NA 4YHKL 3EDDA 4YNYB 2C4FT 3AMLA 4L1HA 3BIBX 2C3GA 4PJFA 4P5TB 5J89A 4Z7UE 1LO4L 1YEGL 4GW4A 3VXSD 5FUZH 1R3IL 4HULB 1FVEA 2EXWC 4FXKA 4J2XA 4LRNH 1YY9C 1F4HA 3WD5H 2CMRL 4K3DL 1ETZB 2EYSA 5I0DA 1F11A 3OJ2C 4DGYL 1CD9B 4NQDA 2HKFL 3ECBA 3OG4B 4PJAE 5JHDD 3CC5A 2AJYL 5MEOA 4XVTH 1NJ9A 3QXDB 1ED3B 4ZUWB 1KB5B 3C6SB 5JOFA 4I18B 1A0QH 1HH9A 5IUSA 4G3YL 3TA3A 4XMPH 1FL5A 4JPVL 3VFMB 5E7FA 1AHWB 1PEZA 2YD4A 4I9WE 3RL1B 5FA3A 1NCCH 3VGDA 2NY4B 2X40A 1J05B 4DTGL 3Q0HA 3PDGA 3KPSE 2MQCA 4X4XA 1KJ3L 1IEHA 5CSGA 3VFSB 5IVXE 4U1MA 1FNSH 1YY8A 1OGTA 2FATH 3TZVC 4F8TA 4NBZB 5FYLH 4F80A 4ZPTB 4TUJB 3FN0L 1HXYB 4KU1A 1C12B 2ADJA 1FO0H 3DVIA 1LK3L 1LNUA 3S35L 4X6EA 2GQHA 3C60D 1X5ZA 3NPSB 4WCYH 5E0QA 3LS5H 3DSNA 4KI1A 1AGDB 4AMKL 4POYA 3DUUB 2NY2D 1HZHL 3ARUA 3HNSL 4HKZA 3V2AR 2QADC 1V3KA 3LSOA 4P4KB 4PJXB 3SCMB 4UNUA 2ZG1A 3CCHA 2EYTA 4ODSH 5D1ZC 2YUXA 1YJDL 5IB3A 5HHPB 3QQ4A 3MOBL 5D1QC 4NCC2 4ZS6C 1LD9B 3EJYC 5C9KA 2JJVA 1BD2E 5FYJU 2WWMD 5FHAL 1SYVA 1JGVH 3OKDA 5L2KE 4TSBL 3AS2A 2A1WL 5J13B 2XN9D 4Y5XB 2FBJL 2E7CA 3WS6A 4G42B 4JN2A 3NOIA 4AQ1B 5C6TH 2DLEA 4LMQE 3C5ZC 3MRDB 5I76A 2XNAB 2W9LA 1KCLA 1R3LB 4Y8DC 1X7QA 2WMPA 3AVEA 1FPTL 4RGNE 4RWYL 3EO1A 1YN6B 2I25N 5F44A 1EVUA 1SEQL 2NY1C 4KC3B 4LSPL 4K8RC 3T3PF 4KZDL 2VISA 4XBPB 4BQBA 5J12B 1RZ7H 4PYGA 3H9HB 1CU4L 1CTNA 1I1FB 1C5BH 3WXWL 4XPGL 4XT1C 3IDGB 5HPMA 3PQYA 5GHWH 2RFXB 4HS8L 3GSOB 5ANMA 5CWSB 1T5XB 5CEZE 3KYAA 1IQWH 3ARSA 4NJ9L 1ORSB 5DDHA 1BZQK 4LVOB 5C0DA 2R2CA 3RVTC 5BW7A 1TCMA 2Y07L 1XT5A 1UJ3A 2ADIB 4ZUVB 4E41D 2FR4A 5F7DB 3I02A 5TPWH 4RAHA 1MVUA 4XCCH 3GI8H 2GK0A 4W4OA 4Q9QH 3NZHL 4E42B 1JNJA 1CR9H 2VKWA 4D9LL 5IWLC 1LP9F 3BKMH 2GSIA 2E7LA 4ORGB 5ESVA 3QUMH 1OGAE 2O5ZH 5D7IA 1KJVB 3D85A 3MRIB 2FZ3A 3QG6A 3GO1L 4RQQA 1II4E 3Q3GA 4NPYA 4AL8L 1OF2A 4WFFD 4KMTH 4PJ9A 2XQYK 3CDFA 1M05A 3MV11 3IAGC 3RZWA 4OD3H 5F6IC 4BZYA 3P73B 1NLDH 3H8NA 3L7FB 4EUPG 3TCLA 3EZ8A 4F7PA 1CGSH 3QAZB 3UAJC 1R3JA 4MNQE 2VITB 5A2FA 1TZGL 1HI6A 4MB4A 4K3EH 2XKUA 3VXQA 4RDQG 4N0YH 2YD6A 2AK1L 3NIFF 4OTXL 1DL7H 1J88A 3PWLB 5IHZA 4HIJB 4XVUD 4HX1B 4HKJA 1J87A 4OBSA 3C60B 4XZUB 1FV1A 4G9FA 3QNXB 4R3SA 4OZHF 3AM8A 3V5DA 2DQDH 5DQJB 1AH1A 4H20H 1T1WB 4BELD 2YSSA 4N0CD 3FAWA 4OIBA 4H1LB 4Z7QE 5I9QB 2PW2B 2Q86A 3FO0H 4GAJL 4JQXC 1XH3A 2GT9A 2ZNXA 4JY4B 4OD1H 4FRWA 3WMSA 5L2JA 1VFOA 5FYJD 4FG6D 2NXYB 3IF1A 2QQQA 5F1IB 1Q9OB 4HWEH 5F7MC 5TF1H 4B7IA 2HT4D 2LU3A 4FNLL 4L8BA 1AY1L 1ITBB 1HHHA 4X7CC 2R0KL 5T1KA 1AGCB 2FO1A 4L29B 4KRPB 2GTZB 2XA8H 4NUGH 4RGOL 1FGVH 1YNKL 4WHTA 3TPUB 2BMKB 3SHSA 3L3OA 1E27A 2OMNA 4D9RE 4NM4H 2OK0H 1QRNE 3MRPA 1P84J 4B7LA 3E3QE 4NQVB 4FTVE 3H2WA 2Z92A 3ALWA 5TQ2H 2FECL 4HAGA 5C0FB 3U7YL 2ADGA 2IBZY 4E5XA 1GVIA 1WZ1L 3D9AH 1NC4B 1KTDB 1UXWA 3MBEC 3RL2B 4AG4L 4Y4KD 5HY9A 5GGVH 2EH7H 1ACZA 2ZG3A 3UZEA 3QPXL 1WBZB 5ICXB 2WIIA 3BDXA 3QUYD 5T3XL 3FOMB 3MROB 1J0IA 1CXFA 2GEEA 1LE9B 4K7PL 1T22A 3MLZH 1FBIL 4QHUA 2X9WA 1EFXD 1KIQA 1HSBA 2ATPB 2IH1B 1UWEL 2DB8A 3HCVA 1T5WB 5HDBF 1V7MH 1NBYB 2C4XA 1OM3H 2J6EH 1YNTB 2IANE 3MNWA 1CI5A 3V6OA 2FHBA 5E00A 3ZKMD 4LVHC 2GTWB 4X6FB 3IAQA 4UT6L 3S88H 1AGEA 3I3EA 4YLQT 3W11D 5HGHB 3FFDB 2CDFB 3RUGF 5GZND 3H9ZA 4R2GD 2C7UB 4NWTL 3PXJA 1NBZA 3EYFA 3C87A 3SJVE 3N1GC 1ACYL 3BISA 3MV9E 3WL9A 2YPLD 1JNNH 1JF1A 4KQ3H 4ZYKA 3IFLL 1U58A 2DQEL 3IJSA 5EZLB 3WFCH 4MX7B 5C7XH 2IALA 2X1PA 3NA4A 1S8DB 4Q6IB 4LNVA 4MJ5B 1DBKH 4UU9A 2V2TB 2XPGA 2EEAA 1DUZA 4XPTL 1A6UL 4LCCB 3MUY1 2C3HA 4JPWH 2DQUH 3ARPA 1J9CT 1YN7A 3HZKA 1H3UA 1M7DA 2UWEF 1P53A 3GBMH 4PR5B 3OR7B 4JM2C 4F7TB 2V9RA 1QO3A 2D2OA 5ITFB 1DQLL 3A6CL 3CVHA 4PJHB 2VKXA 3EO9L 2IWGA 4XWOC 1IKFL 5FAAA 3HE6B 4HJ0C 3U48A 1FVCB 3FT3A 1MCFA 1KT2A 3B8SA 1JF6A 1CFSB 1FFPA 4YH6A 1SM3L 1LE5A 2EDDA 4KK5D 4WWKC 4S1RL 1WBXB 1DN0B 4XCYA 5B22A 4JQIL 3NFPB 4TVSa 1I3GH 2YK1L 3ZTJG 4JZJA 3GNMH 1UQSB 3KXFE 3LOWA 2VE6A 2NX5E 3ISWA 3PWJA 4ODWA 4O00A 1FL3B 3MUHL 1BFTA 3B9KA 1Z0NA 3L6FA 3N85L 4OQTH 3MLUH 4RFOH 5ADPH 5A2JH 5IB5B 3SDAA 3V5HB 1TLKA 4C56E 4HJGA 4GG6F 3T1WA 2DM3A 3G5VB 4XCFL 3NACH 1U95A 2XICA 4LSRH 3MV7A 4OAWA 1HNFA 5FKPB 5FDWB 5ACMA 4LCWD 4DFIA 3BWAB 2IBGA 3BPOC 2AEPL 2DS4A 3ZHKA 2Z4QB 2ZSVB 4MYWB 3OR6B 3WHE0 1G9MC 3FQWA 3FQUA 1S7SA 2PTTA 1T2QH 4WV1C 2EC9T 3UYPA 1NCWL 5EDXA 5I1HH 4YFLI 1T6VN 1I9JL 4EXPX 1D9KC 4PJAB 1CVSC 4LSVH 2B7DT 5D93C 3VWJD 4Z7NE 3HZMB 4KUCD 1UM4H 1XF4B 1MLBB 4NO0A 4ZXBC 4HZAA 3QRFM 4F2MB 1SJHA 3QEQA 3KS0H 3NABL 4HEPG 32C2B 4ZUUB 1DANU 1CXEA 3N1PC 5FUZL 5IK3B 4X9GA 1QQDB 4TPRL 2AV7B 4NQED 4YZFE 5EO0B 2ITCB 3CLEH 3WD5L 5JW4Q 3QI9B 8FABA 2LAAA 3EOTL 3T3PE 2BOBA 5HYSG 3TBYB 4OLZH 2IFGA 4M7ZB 3RIAK 1OSPH 3I2CH 2AQ1A 2VQ1B 4I2XA 3RVVD 1N2RB 4HUNB 5J1SC 1E6JH 5ERWB 2NNAB 3P77B 3OB8A 3SDXA 3OKMB 3OTTA 4XI5D 3TN0C 2O61A 1EAPA 3O45A 4MWFA 4WFHD 1N5YL 3WN5A 4ETYA 4PG9B 1OAKH 3O6MH 3VG0H 3F7YA 2H3NA 1NCCL 4JFDB 1NLBH 4WVRA 5D4QA 4U7MA 4J3UA 1JGLH 2O5XH 1GZPA 3HE7B 2A38A 2WUBL 3W0WE 5K59E 5EBMB 3RWJB 4WU5B 1MH5A 4GQ9H 3KS0J 1LEIB 3MO1A 3V4UH 1FNSL 3MODH 4ODTH 2FATL 2FX8H 1JWSB 2BVPA 5FYLL 1RUKL 5TE6H 5EUOB 4M61A 1FO0L 1QSFD 1MJJB 2DI9A 1QVOA 4QCIB 1NDGB 2IC2A 1QR1B 3DSFL 5JIIA 1I85A 1D5IL 3IDUA 2XZAH 1J8HD 4WCYL 4RGNB 3OAZH 1URLA 3HG1D 4YBLB 2AJZB 3H9SB 4POUB 3IJHB 3O0RH 5HGAB 5I8EB 1P7KA 4P2RB 5GRZA 1ZT7A 2CD0A 1PKOA 4EVNA 1RZJL 2R29H 3OL2A 2F9BT 5D2LF 4ODSL 3ARXA 2CK2A 1K4DB 4H0HB 4X5XB 2FL5A 5F1NB 2EH8H 2D7TH 3PNWA 2X4OB 4M93C 1JGVL 3MRFA 3UTPE 3QDJB 4ZFOB 4RIRB 3DRQA 1U6AH 4OKVB 2QEJA 3ARFD 5IGXH 4XP1H 2ICWI 1PG7X 3QA3A 3QH3B 2P5EA 2F53A 3O9WA 5DVKA 1XF1A 4KUZH 4OFYA 1OGAB 3G5XB 4JJHA 4P9MH 1I3RB 4I4WA 1RZKL 1RZ7L 3WNNA 4JG1H 1C5BL 2D31B 4LARH 2R1XA 2CJUH 3VJ6A 2NY5C 3K4AA 4HIEA 3CMOL 4PP2A 2I9LA 5EN2A 3TBSA 5DJDB 5GHWL 3P0GB 4EI5B 2D9CA 1P2CA 5FKAA 2LU4A 1IQWL 4KJYA 3QFDA 4GKNA 2X4UB 4MJIA 1EPFA 1FZMA 4JPIA 2WUCL 1GGIL 5C3TA 1PLGH 2D4DA 2RCSL 2BHZA 3RVXD 4QRQB 5TPWL 1DEEA 4XCCL 3GI8L 3HRZA 1XGYH 5D7LA 4YBHA 1U9KA 1XF3A 3W9DA 4EQ3A 4OZ4A 1CR9L 2ARJA 3BKML 4XAWH 2VH5L 4M1CD 4U1LA 2OZ4H 5DYOA 3LKRB 4MD4A 4WWID 3QUML 3RWDA 3VXNB 2O5ZL 2EKSA 4U6YB 3PDOB 4PJEA 1C08A 1ZGLM 3VXRE 2VLJD 4UINH 3O3AA 3DX9A 1VDGA 3CH1A 4KMTL 1LO5B 4OIIH 3T4YB 1VADB 3RWGB 5HYJB 1HKLH 3RKPA 5HHXH 2FGWH 1PY4A 2C1PA 1XGRA 1NLDL 2ZCHH 1CXLA 2YXFA 5FOJA 3HMXH 3QUXB 5F97E 2Z31B 3TH2T 5HDBE 2ZZUT 5IB2B 1QRKA 4HF5L 5D5MF 3OGOE 3QEUB 1ZKAA 5K9KA 4K3EL 4EBQL 4N0YL 5CZXC 4MB5A 5FM4A 3UJJH 3HZVA 1MI5A 3CFEA 3MLXH 1J0KA 1MHCA 4DCQB 4U1GC 2XZCH 5EU5B 3NN8A 3Q1SH 3PHOA 1MUJA 3D3VA 2DQDL 3B3IA 3T09A 5J56B 4OD1L 3KPSA 4P23C 4I0PA 1JVKA 3IDIA 1B0RA 3UBXB 2J4WH 4RX4A 3HB3D 3BP7A 3AREB 4JFEB 5IVXA 1TENA 1UB6A 4Y0GA 4O2CB 5FB8B 1Y6NR 4N0CC 4HWEL 2CIKA 2FIRT 2UWEE 2W0LA 5TF1L 1KLGA 4NQCD 4QLRA 3HLAA 1RZIA 3VGAC 4OCWH 3MGAA 2EEDA 2XA8L 3GMQA 4FG6C 1FG9C 3CNKA 2VDOL 4RMSA 3MLVH 5AUMB 3N1MC 5BS0A 3QDAA 3IAPA 4NM4L 1BJ8A 1IEBA 2OK0L 2C9AA 2HT4C 3CFDA 2IANB 5HHNB 2XWBA 1H8OA 1XR9A 5TQ2L 4J1UA 3TCXA 1MCDA 1B0GB 3VFOA 5C09A 2BVYA 3D9AL 3MZTA 1M1SA 5T1LB 4JRXA 1DDHA 2VN7A 4LHUA 5GGVL 2EH7L 2DJSA 1HQRA 3BSZH 2HH0L 4R97B 4X98B 4CVUA 4WO4B 3SJVB 3LN5B 3ZDZE 3ARDB 5IVZB 2MQ0A 1BD2A 1KPVA 4O9HH 2VR4A 3ROOB 5IFJB 4GG6E 2P8PB 2YMXH 1U8NA 5HD8D 4OZFH 5LQBH 1EEQA 2ESVE 4LSQL 4OCRH 2P44B 3GIZH 5GQBA 3S9DB 1V7ML 1Z5LB 1OM3L 2BSSA 3TA3D 4KFZC 3I6LE 4Q9CA 3QUYC 5J6HA 4M62H 2OSLA 2X2YA 5IG7B 5SX4H 2NQCA 3V6FA 2JCCF 3TBTA 3S88L 2VO5A 4L4VA 5DD0H 3RFZC 2VWEE 4KKAD 4O51B 1LEGB 4G80B 1KF9B 1JPGB 1NQBA 2WINB 1NCDH 1INQB 4N90E 5TDPB 2GJZA 4Y19E 1J5OH 2CR6A 1BVKA 2EZ0D 1MRFL 1D6EB 4DVBA 4NZTH 1A7NL 2IH3A 1JWMA 1PKQB 3RWHB 2NTSP 4HKBA 5KVFH 3WFBH 5C7XL 3TT1H 3MTRA 3QXWA 3L3GA 2EIZA 2GJ6A 3T8XA 1A6AB 2PW1B 3ULVC 1P4LA 2IJ0C 3VXME 1PDKA 1I8LC 4JPWL 4JZNB 1FC1A 2DQUL 2WBJB 3AAZA 4CN6A 3LD8B 3FQNA 3EDFA 5CFHA 1VEPA 2VN4A 1F2QA 3IRPX 3ESVF 3VFVA 1HSAB 4JG0H 3VFNA 4PJDA 4OLUH 2OS7A 5HDLA 3NGBB 4AH2B 5HYIA 3H3BC 2LTQB 3RNKA 4HZLA 1QA9A 1ODAA 1H0DA 3BZEB 3OGCA 1AD9B 5J06A 2YWYA 4JGMA 4JDZB 4KDTC 4H5SA 1GGUA 3NTCH 1I3GL 1ZVYA 1ZV5A 5J3HC 2ERJB 4WGVB 1BZ7B 4GXUM 1AQKL 1IEAB 4MNQA 3D39D 4WENB 4P99A 4L8SA 4OQTL 3S7GA 5EZOL 2OTWA 1A9BB 3MLUL 5KG9B 4RFOL 5ADPL 1HOCB 4IRJA 1IBGH 4UIKL 1B88A 2VZ1A 3G04A 3TM6A 5JMRA 3IXAA 4X0KB 3UX9B 3P4MB 1JL8A 1ZWIB 1BPVA 3GSWA 4MDJA 3S5LG 4TULH 3T2OA 2W0KA 5IR1B 4R0LA 1ORQA 2NY3C 4DAGL 4FXKB 4HJJL 1QFWM 1MREH 1JPTH 2B1AH 3CZFA 2GAZB 1NMCB 4Y1AD 2AJSH 3GMLA 4KAQH 2H2PD 3BN9D 1UZ6E 5F72S 3T0EE 4PRDB 4K3HA 1GAFH 4NQDB 4JRWA 2YC1A 3ECBB 5D2LE 3CC5B 2R0WH 5FHBH 3THMH 1NJ9B 5IMMB 1DQDL 4NNPH 1S7VA 5JOFB 2OI9C 1UM4L 3EOBA 3T08A 1FL5B 5KSAA 4K94C 4O58L 4PJ9D 1QRNA 1EO7A 4NNXB 4RDQF 5FA3B 2VAAA 4FTVA 4JR9H 3MYZA 1WIPA 4R8WH 5GIRB 5HI3C 4N5EC 2VLKE 1XGQA 3VWJC 3C2SA 1X4YA 1NGPH 2OR7A 3CLEL 2VUOA 2V5MA 1F97A 1YMHA 2BVTA 5C9JA 4APQB 1OSPL 4PRIB 3I2CL 3IDXH 5DA0B 1LNUB 5H35A 1E6JL 4X6EB 2J8UA 5A3IC 3HC0A 4KKCC 1I1YA 1K8IB 2R23B 1UM5H 4G9FD 5L7XH 1WC7A 2OCFD 2YUZA 4DQOL 1P4BH 5IB4A 4H8WC 5GRYA 3OAYH 3FONB 5E9DA 5EBLA 1YECL 5B8CC 4X7SH 3SDYL 4HKXA 1JGLL 2O5XL 4OF3A 3IFPB 2BSED 4JM2F 4NO5B 4GQ9L 4OZGB 1A4JA 1KPUA 1T3FA 4TVPE 1B6DA 3QQ4B 3V4UL 4GW5A 3SGEI 2LE9A 4ODTL 3MUGB 5D7JB 2RBLA 4ZOEA 3MLYH 3OKDB 5TE6L 3MV9A 1C1EH 5D2NE 2YRLA 4JN2B 3SE3A 4UDTA 3STZA 5KN5A 3U46A 5I76B 3SKNA 3Q2CA 3UJTL 3BZFA 1T03H 2XZAL 2JKXA 1LO2H 2DI8A 3L5WB 4WTZG 3DXAE 3L95B 3KHQA 3KJ6H 3O0RL 3WBDA 1ZA3B 1JNHA 3WFDH 5K9JH 3RDTC 4PLKD 1RJCA 2R29L 3EOAB 5E8NA 1RK0A 2WQRA 5HPMB 4WEBL 3PQYB 1NUGA 2VSCA 4KTDH 3P3YA 4NN5C 3MLSH 4OIAA 4XCNA 2EH8L 3O6FC 2D7TL 4MXQD 5GGQH 1TTUA 5DDHB 4ZO6A 2AGJH 3BEVB 1OHQA 2CRMA 5FDYA 1UJ3B 5ILTH 4C4KT 4EIZC 1U6AL 2VLRE 3MOAH 3I02B 1TFHA 3FB7B 4XP1L 4HWBH 5EIQA 2J1KA 4N8PA 1GGYA 1VGEL 5EIIA 2VERN 2NX5A 4W6YB 4BQ8A 4JHWH 2MKLC 4HFUL 5CSZB 5FO7A 5FGRA 5ESVB 1P9MA 5FOBA 3D85B 3B2VH 3IETB 5KS9E 2QQLH 3QG6B 4JG1L 4LARL 4NPYB 2CJUL 4O02L 5B39B 5HHVH 4JM4L 3G6AB 2VXQH 3OZ9H 5C92A 4QOKE 4ZTPH 4PJBE 3LHPL 3IDYC 1A7PH 2CGRH 2HMID 2CXKA 4MLSA 1G1YA 1AP2B 4YDIH 4MVBD 4PREA 3O4OB 5CP3H 1G1CA 4BH8A 5EOTB 4FXLA 4ACPA 1VSCA 3BH9B 2H41A 3RKDD 3VXUD 2VSDA 3RWIB 1KOAA 1T2XA 2XTJD 1DVFA 1RMFH 3OWEA 5EB9A 3NMEA 3SKOB 3X14B 2HLFD 3GGWA 5IHZB 4LAQL 3DROA 1T83A 5IBTL 1FV1B 5KANI 3BFOA 4R3SB 2HJFB 4HXBH 4RMRA 3V5DB 3EDKA 1PZ5B 1G7IB 2XQBH 4UINL 1CGTA 1ZANH 4DGVH 4JFFA 2FLBT 2X42A 2DJUA 2YSSB 4JKPH 4NFCA 3RVUC 3FRPG 1HKLL 3H42H 5HHXL 2AK4B 2Q86B 3CMGA 1I9EA 2H1PH 5EZIH 1XH3B 1I8MA 3V95A 4M6OH 1F2XK 1J0HA 3O8XA 1S7XB 2FEDD 5E6IC 3B83A 3F12A 2ICEA 2B5IB 4G5ZH 2N56A 4LHQB 3VRJB 3LIZH 3UYOD 4L8BB 1HHHB 3CVIH 3ILQC 4ODXB 5C07D 3VGEA 5T1KB 1SQ2N 1X5JA 3B9KD 5DUMH 2NXZC 3UJJL 5A1AA 1NCUA 3MRCA 3SDAD 2XKSA 2NY6B 2XZCL 3CFBB 3L3OB 4NCC1 3V6ZA 5HI5C 2R2BA 3Q1SL 4FQ2L 2D0HA 2I60H 3MV7D 4F58H 2JJTA 1H3PH 3J8F7 2ADGB 4E5XB 3HAEG 2F74A 1OY3B 1CT8B 1HHJA 3W0WA 2UY7A 2ZSWA 2P5WE 3T65B 3BRDA 3LKPA 1LP9A 4FFWD 5B38A 4TTGA 3HMWH 2PXYC 1A14H 1FZOB 2AEWA 2FJHA 3VG9B 1MCRA 4BUGA 3QDMA 1KIUA 3MXWL 3QQ3B 2YUWA 3KG5A 5DK3A 3OAUH 3GMOA 4GBXC 4OCWL 4OZFG 1MCOH 2VDRH 4BSWA 4V2CB 3BI9X 3GHBH 4EN3A 2J8OA 5E2JA 1DJSA 3HCVB 1UZ8B 2DRUA 3MV01 3RA7H 4MXVE 4LLUA 4NO0D 4PLNC 2X7LA 1N6UA 2K7PA 1DUYA 4U1IB 2WP3T 1ZLWK 1PG7L 3T77A 4F9LA 5E00B 2V5RA 3FOLA 3I6KB 1EBPA 1A7OH 1MJ7L 4HS3B 2HT2D 5DJXB 3VMPA 4KY1H 4Y19B 4BK5A 1NBZB 4LVEA 1RD6A 4JKWA 3MGTA 4U0QB 4YHYC 2QKIB 2YMXL 3IJSB 4KKLD 4OZHA 4OLWL 5LQBL 3F5WA 2IALB 1T0PB 3KAAA 1KCVH 4OCRL 4LLYA 1X5FA 15C8H 3GIZL 4LLQA 2J8HA 1NC2B 3BVNA 3QDGE 4A6YH 1NSNH 4M62L 3ARGB 4U7KA 3HZKB 3EDEA 5JA9A 4F7EA 3ULUE 1NMBH 1T89A 1RUQH 1QO3B 1LHZA 5E5RB 5DD0L 4RGMC 4GKZA 4NKQB 4XBEL 1QR4A 4P46A 4S2SA 1NCDL 5ID0B 2BOCA 3O3BA 5E4EB 4PGBA 4OUOA 1J5OL 2F54E 1RJYA 5F9DC 1NPUA 4AEEA 2HWZH 3BPLC 4KVNH 4Z7WF 1S9WA 4NZTL 3DX8A 4L9LA 1B9ZA 2EDWA 2IG2H 4XCYB 5KVFL 1HHIB 3FCTB 3TT1L 4ZMAT 3PWJB 4LLMA 1VEMA 3N1QC 1OSZA 2VL5A 3L6FB 3VH8A 1R5IA 1AR2A 4Y2DA 3QCTH 3QO1A 4HIHB 5EUKB 3QNZB 4KK9C 4PRPB 1NBVH 3NIDF 1T4KA 3TO4C 2XKNA 4HJGB 5EU7C 1MJ8L 4G6ML 3E6HA 1U95B 2Q8AL 5DFVD 3VXRA 1PBYA 4OLUL 4BFIB 4OAWB 3QO0A 5BZWA 4JFXB 3ZHDA 5DK0B 3BESR 2HFEB 2NLJA 2V5YA 5I8OH 2Z8VC 3PV7A 3NTCL 4PJ8B 5GGSA 5T3XE 1BQLH 2ATKB 1FLRH 2W60A 3LS4H 1S7SB 5FYJH 1CZ8H 1EEZB 1ROWA 4F3FA 2P5ED 2F53D 3PWPA 2HVKA 1FYTA 4OFYD 3MGOB 3T3MF 5H94A 2A0LD 3RUGA 3UDWC 4QRPE 4WGWB 2YPKA 1IAII 1W0YT 3DO7A 2IBBA 4PV9A 3QEQB 2DMBA 3CXHK 2GJJA 3CPLA 2VLKB 3NCYS 1CLYH 1R6VA 1Q0YH 5DJ6B 4PJ5D 5ITBH 1F42A 3QIBA 4MJID 2F5AH 2E7BA 4LLWB 4ORZC 4Q9RH 1JPTL 4J6RH 2B1AL 2AJSL 1A1MA 2BOBB 4KAQL 4M5ZH 5D7LD 3MRLB 3C8DA 2CO6B 2UWEA 4PD4K 4JEGB 1UC6A 1GAFL 2A9MH 1ONQB 3ZE1E 1XCQB 1WAAE 5FHBL 4G6FB 4NNPL 1EAPB 2QR0A 5GS1C 3LN9A 3MJGX 5FGBA 3WS3A 1YEKH 2CDGB 4MB3A 5I1LA 3RGVC 4JR9L 3VXOA 1MWAB 4FQXC 3WIFA 1S7WB 3CSGA 3UZVB 1K4CA 1H3XA 5LVEA 3GSXA 3HUJF 1NGPL 3WXVL 4MDIA 3ZKXC 1F45A 1G6RH 5SWSE 1T7WA 3QISA 4QRTA 5CUSH 2Z91A 4N0RA 5MENE 4WHYH 4LP5A 3IDXL 1AE6H 1MI5D 2VR5A 1KELH 1BQHG 2QSTA 5AD0A 1WK0A 1VFMA 4KKBC 1P4BL 1FJ1A 5D70H 3D3VD 4QRSA 4D8PA 2NTFB 1EXUB 3ULVF 5KSUA 5CEYA 3BGMA 3TEUA 4QXTB 4I9WD 4ZFGH 1W0VB 3BQUB 3K80A 3R8QA 1CS6A 3KPSD 4DVRH 1JTOA 5LJYH 2VC2H 4UT9L 2UUDK 1I8KA 3MLRH 4UOW1 1U8QB 3JSSA 2FL5B 5DR5L 3HPJA 2G75A 1QLRA 4HGKC 3AY4A 4LNRB 3I84A 4PP1D 2B0SL 1OTSD 1XF2B 3MLYL 4N0UA 3MRFB 4P5TC 1I1AB 4UIMA 1C1EL 3U2SA 4OZIF 2PO6D 3P0YH 4MD0A 4YFLF 1T03L 2HJKA 5BS0D 1CDBA 2FO4A 4LPWA 1LO2L 3WIIH 4OGZA 3MXVL 3O9WB 1OP9A 3ARBA 5K93A 3PE9A 3VXMA 2JJSC 4H88L 5C08A 4FXGA 1ZXQA 3HI1A 5KS9B 3WFDL 1AIFA 1MCPH 5K9JL 3UXFA 2R1XB 2EXYD 3PV6B 3VJ6B 2DLFL 3TBSB 4JRXD 1KCSH 4PJBB 2YEZB 4KTDL 2CKBL 4U4BA 3MLSL 3L3IA 4P2OB 4AM0B 3R1GL 4ZNEA 5IM7A 3WO4C 3S3JA 3I75A 1AHWC 1BD2D 1YPZA 4WFGE 2NY4C 5IJKC 4PLKC 5L2KD 3UTQB 1B6UA 2D3VA 3U0TA 4YXLH 2VABA 4F37K 3MOAL 4CW1B 1DEEB 4I3RH 3HRZB 1MFCH 3M1BB 3PP3K 1GOHA 1XF3B 1MFEH 4OZ4B 2ARJB 4JHWL 4U1LB 4N5UA 3MJ8B 1EO5A 4K94H 4MD4B 4F9PA 3QR2A 5GRVK 2CDEA 3B2VL 1OQXA 5CGYD 4XVSH 3HNTH 4ISVB 3D0VA 2D0FA 3KPRB 2CRYA 3NPSC 2Q7YA 4ZG1A 1U8IB 5HHVL 3SE8H 2VXQL 3OZ9L 1QFOA 4ZTPL 1RU9L 1KJ2H 2OP4L 1A7PL 1CWVA 5JIPA 1XGRB 4IRSB 5CEZD 1JHKH 3EO0A 3MACH 4HUWA 3RHWF 5IQ9B 4YDIL 4P4KC 1OLZA 2JJUA 4X4YA 1SBSL 3L5JA 4ONFH 4AZ8A 1F4YH 3FO9A 5MHSD 2GJ6D 4P2QB 1S7TB 5DJAA 1NGQH 2OR9L 5C6WH 3MRJA 2HMIC 1KB9J 3ES6B 1RMFL 3EGSA 1MJUH 2W9DH 1HIML 2AJXL 3BXNA 2AXFA 1S7RB 4KRMB 2PYEA 3VFTA 3JUYA 5J13C 4Y5XC 4HXBL 3MLWH 3PHOB 2R0LL 2XQBL 3IDNA 4NYLA 1ZANL 4FFYH 4DGVL 3O2DH 5SV4A 4OM0H 1JFQH 3B3IB 5DUPH 4EDXB 3DECA 1KV3A 5C1MB 1CL7H 2H1PL 1ZVSA 4X5WB 3GM0A 3SGJA 4M6OL 4I0PB 3FB8B 3IDIB 2CUMA 4H1LG 1ZHBB 5J12C 1MIML 3BP7B 4FQIH 1WQVT 3KYMA 2H32A 5D1XA 4AEIH 3GZKA 3LIZL 1MF2H 3WDJA 1KLGB 1OTUC 2DL2A 3IFNH 3SKJH 3CVIL 4MNQD 1RZIB 1T80A 4DGIH 3KPQB 4P9HC 4KH2A 4OFPA 5DUML 3X12B 4OCXH 3RZCA 4LVOC 4IRJD 3GMQB 4LCYB 4PGDA 2OX5A 1FFOB 2CXGA 3F7VB 4KJWD 4PYHA 2APVA 2XWBB 3SQBA 4F58L 1H3PL 4QXWA 1NFDF 3S3PA 5C09B 4MNGA 4JB9H 4MXWH 4R7DA 1VGKB 4LHUB 1G7MA 3QZWA 3SKMA 2DICA 1HQRB 3F6LA 3MA7A 4R4FH 3TWCH 2V2XB 3CUPB 3HMWL 1A14L 4PPTA 5D9SB 5BVPH 4W6XB 3NIDE 1TTFA 3U4BL 4G8FA 1BWWA 3PL6D 2QQKH 4LOUD 2ZNWA 4RMVA 1U8NB 4Z0XA 5F7KC 1MCOL 2VDRL 4YHPA 2ZP0T 1YEJL 4YWGH 3LKSB 4HH9A 3U4EA 3WO3B 4YEEA 4BSJA 1MNUH 1SMAA 1A1OB 4XNZB 5EFIB 3RA7L 1B90A 4D9RD 4F7MA 5CBEA 5FCUH 3DXAA 3QDGB 3ILPA 3MV8A 3QAZC 4Z0BH 1QRND 2FH6A 2OSLB 5CP7A 4FTVD 4GLRH 2H2SD 1I8IA 2DM7A 3TBTB 4K3GA 2ZOLA 1A7OL 1CD0A 4L4VB 4UQ2A 5D5MA 2EE3A 3TZVA 2D7NA 2RGSA 3T1FA 1U8HA 1PG7W 5SWZA 3T3ME 4DVBB 4IDJL 5DD5H 5IIEB 1CFTB 1GPOH 2IH3B 2XV6B 1JWMB 2QHRL 3RNQA 4HKBB 3UYRH 5JW4M 3FT2A 4LQFH 1YNLH 2AP2A 2VLRA 2A77H 3L3GB 1R5VA 15C8L 1RVFL 5LAXA 1GGCH 2BXZA 1FHGA 3OKEA 1OCWH 2A9NH 2WBWB 1F02I 3LN4A 4A6YL 1NSNL 4P5MA 4JFPA 1BHGA 2KDGA 1V3LA 2GSGA 4QRUA 3VFGH 1NMBL 5D1ZA 2FIKB 4M8QA 1BVLB 1KN2H 2VMFA 3PIQA 1BLNB 3M8OH 4KRPC 3X11B 1G6VK 4XCEA 3VFVB 5D1QA 4PJDB 2IPTH 4XC3H 5GSVA 1AXTH 5IEKB 4NGHL 5SWQB 4IHOB 4QOKA 4D0BA 1YEFH 4PRBB 4HZLB 3U9UA 4TSAH 3KVQA 4KVNL 4XNYL 1H0DB 2E3VA 3BH8B 3MV9D 1Y18B 2WAHA 5F7FA 3UTSB 3C5ZA 4H5SB 3J7HA 1VACA 1CD1B 3GIVA 4M02A 4UAOB 4X6BB 4PJ7F 2P8LB 4L8SB 3RX7A 4ZUTA 4HIXH 3UBXI 3QCTL 1NBVL 1ZGLA 4YO0A 5JXAL 2HRLA 4M3JA 1NEZA 2WV3A 4Z7VB 1Z0MA 4J3VA 2CH8A 4L3EA 3ETBF 4FABH 5L6YH 1NAKH 3U6RA 5I8OL 4GAGH 2D4FA 4WUKH 3V79C 1CFQB 3CZFB 2YA1A 3GMLB 1FLRL 3LS4L 5FYJL 1CZ8L 1X4XA 2NYYD 5E8PA 3KXFD 1H5BB 4QHNA 2NX5D 4JGUA 3KYOA 2JCCA 1JNLH 1X5IA 1OL0A 4RFNB 4S1DC 5ISZA 4FA8A 2VXSL 2X4RB 1J18A 3JWDH 4OGYL 1S7VB 2DIBA 4C56D 4G6KH 2H45A 4PGCA 2X4QA 5KSAB 1TDQA 4Q6IC 5DHXB 3PP4H 2VAAB 5MEPA 1SJEA 1CE6A 4OZIE 4LCCC 3TBWA 2QBWA 5HHOA 1Q0YL 3WNKA 4LSDA 2APWA 4CN1A 2P5WA 4J6RL 4DW2H 1U42A 5C6PB 4M5ZL 3O11A 2R4SL 3V7AE 5SWSB 5DMGC 4PY7A 5C9JB 3HE6C 1DVFD 3HC3H 4R26H 5ECJE 4WHYG 2A9ML 3DVNB 4HFWA 5BCAA 5EPMA 2KPNA 5J1AA 1S9XA 5IF0A 3QUZD 5LGJA 4UTAL 5DGRA 5DEFB 1GC1H 3EHBD 2OM5A 1KGCE 1HHKB 5E9DB 3WUWB 5EBLB 1BOYA 5I8CA 4RWHA 4PY8J 3NA9H 4JQXA 3IDJA 5J9PA 5E1AA 4GKOA 1A6WL 3AFLA 1MHHB 1D6VH 1A4JB 1XIWB 1N64H 3MOQA 4RAVA 1KPUB 3FHQA 2E27H 4GW5B 3M17B 5TDNB 4ODBD 1KULA 5IEHB 2P24A 2UVEA 4ENED 1G6RL 1VFAB 3GMRA 5MI0B 1XF5A 5CUSL 1AO7B 3CFCH 3DLQR 3ULVL 1AE6L 2R0ZL 2VR9A 4JCMA 1KELL 5GSRB 4XRCA 3ZYJA 2FCBA 1EIBA 1W72L 4BFEA 1IM3B 2X1XR 1ZSDA 5DQ9A 5HGDA 2BNRE 2HP4A 4ZFGL 2WSKA 2W0FA 3MBEA 5K9OB 3MRBA 4RBPH 3W0WD 4DVRL 1FNAA 1RK0B 2VC2L 4G8GE 3C5SA 1E4XI 3OKLA 1V3MA 5F1SA 4XCNB 1W8NA 2P4AB 3MRMA 5JLZB 2DQIH 1AGFB 3NVQA 2WANA 4HQQL 2ORBH 1FLTX 4NRZA 1PJ9A 4TRPH 2Y72A 5JO5A 4P3WA 5JZ7C 2ZJSL 4Z78B 1BAFL 1TZHA 2UYLB 5FGCB 3L9RA 4MAUH 1QSEA 4JRYE 5H2BA 5DD6A 3KLSA 3S34L 4M7ZC 1TQCC 3W39A 5DTFA 3RWFA 5ICYB 5TH2A 3PDDA 4Y4HB 2PO6C 5TFSL 1MCPL 3LQAH 1IL1B 2DIJA 5DLML 4DKFH 4Y16B 3C8KB 3CH8A 1YUHA 4KGJA 1N0XH 3NFNA 1R3HB 2Z35B 1C7TA 1JK8A 3DV4B 3CAFA 3VE0A 4D2NA 3EJZC 4PREB 4EDWL 5T33H 5JA8B 4Y4FD 4BH8B 3HE7C 3UTPD 4YXLL 1NBQA 3WKNA 4CL7A 1FO0B 1I3UA 1MFEL 1WZLA 5F3BA 1IC7H 1JYNA 4YAQB 5I15H 3GGWB 1MEXH 1XFPA 4KJPD 3BMVA 4JM2A 4K94L 4CMMB 1FRGL 4WU7A 1OT2A 1NAMA 4I5BA 5TDOB 4HUMB 3OV6A 3TJEH 2CO7B 1QSZA 2LAGB 1U3HB 3B9VA 4XVSL 1ZT1A 4QRPA 4P46D 4JFFB 3SE8L 2NW2B 4JCLA 3QJHA 4RGNC 1KJ2L 3R0MA 4YBLC 1E4KC 3C9NB 5ICZB 1I8MB 3FN9A 4WWKA 1B4JL 5ID1A 3MACL 3G5YA 1UCTA 3O8XB 2XI9A 4QYOB 4QRRA 2ICEB 2SEBA 1DE4B 1IGJA 4MQTB 1K3ZA 5BRZE 2KQNA 4NN7C 1NGQL 4PLJC 4R7NB 4DKEL 4Z7OE 2N1KA 2NY7H 5C0BE 4ODHH 1S7UA 3EW3B 3SY0A 3CXDH 1KJMA 2GY5A 4Y2DD 2CLRA 5J8OA 3Q5TA 2C3VA 4HMDA 5F3HB 3MLTB 3ZE2F 2AKRA 2R2BB 1HE7A 3FQXA 2ED7A 3M45A 4JFZH 4KPHH 4FFYL 3VXRD 3VGGA 3O2DL 3NBNA 4HUVA 3QIWC 4OM0L 5LBSH 1JFQL 2Q8BH 1O5DT 4RMWA 3C2AH 1CL7L 5DJ8A 2DI7A 2F74B 1ZLSL 3RI5F 4M43L 3H7BA 5C0EB 2ZSWB 2CKBA 3RU8H 4GW1A 5DO2D 3LKPB 5ETUB 4K7FA 1RV6X 2XYCA 4WV1A 3UBXG 1A6TA 4AEIL 1MF2L 2YBRA 3QDMB 5JORB 1OP3K 1FN4B 3I6GA 1D9KA 4PTTA 3PWPD 4DGIL 2BDNH 4X9HA 1JMXA 1BEYH 5IW3A 1FYTD 4OCXL 4BSWB 4MQ7A 3F7RA 4WI2A 4X4ME 2AVGA 2P45B 1NANI 4EN3B 4UILL 3TIEA 5FV1L 5DF0A 1JYVA 4ZXBA 3QUMB 1PQZA 2X7LB 4HCRH 3SDDB 1ZLWH 1WJ3A 2CIIB 4PRNB 1YQVH 1EV2E 3TNMA 3U0PA 2XWJB 3IJYA 4YPGA 3FOLB 1FIGH 5L8LB 1LMKA 4MXWL 3QIBD 1NKOA 3K81A 4PJ7E 3U1SH 3EOYG 4PG2A 4R4FL 3TWCL 1GHFL 2D9QB 1T1YA 1F58H 3VFWB 2G9HB 5BVPL 3RWEA 3QXAA 3EYOA 4JO2H 3MGTB 3EYSH 2OJZH 3IU3A 4V2BA 1VESA 5C2BH 3F5WB 3QUXC 2Z31C 4HIIA 4LLYB 1FGNL 4UUJB 5CEXA 5DWUL 2FJFA 4FFZH 5FCUL 4Z0BL 5AWNH 3JV6B 5JHDA 3PL6C 5LGKA 3PWNA 4F7EB 5D7KE 4U1KB 5BO1L 4GKZB 1G9NH 3ALXA 4KWUA 4S2SB 35C8H 3BPNB 1WFOA 4H0GA 2BOCB 4PGBB 2A2QT 3E3QC 1S9WB 1GPOL 3BP4B 3DX8B 2KZ1B 3ELAT 4L9LB 2H2SC 1IM9A 4G9DB 3PGFH 1N4XL 2P8MB 3L3HA 3UYRL 1UEMA 5T3ZE 4QHKJ 4I77H 1YNLL 4PJXF 5I1DA 4LLVB 2A77L 5E8EA 3E2HB 2ESVD 4YQXH 1EVTC 1GGCL 4LLMB 3TESA 1OCWL 2A9NL 3CU7A 1EMTL 4PTUB 3VH8B 1JRHI 1L0YA 3I6LD 1MAMH 2YRZA 3QO1B 1J0YA 1V8HA 3GMMB 4UDUA 4MA7H 5JUEH 1T4KB 5LGHH 2XKNB 5MP6L 1JP5A 3MR9A 3VFGL 1FDLH 2VZSA 1WFNA 1CBVH 2DDQL 4HAFA 1PEWA 2JIXA 2OL3H 4XC3L 1AXTL 3CVHH 3G6JB 4PRHE 4N90D 4JFOA 4ELKB 5BZWB 1YEFL 4N8VA 2Q20A 4TSAL 1TJGH 3LEVH 5GS0C 2YHGA 4MD5A 3UO1H 5HHMB 1JV5B 3QFJA 3MRHA 5GGSB 4ZSOB 3O3DA 3U9PH 1WCBA 5HYSA 4UV7L 4WRLA 2G2RB 1QFUH 2ZUXA 3IXTB 1TCRA 3IB4A 4R97C 3ARBD 2HVKB 4WO4C 3VXMD 3CLFH 3ARDC 1I1RA 1X44A 4HIXL 5C08D 5JQHC 5H94B 5I66A 2H26A 2IPKA 3B2UC 2Y1VA 3RUGB 3BAEH 1W0WB 5IB1B 1Q9KA 2HT3C 3WE6A 4OCSH 4YHZH 4U1SA 5L6YL 2DYPB 3CPLB 1NAKL 1WTLA 4XNMB 4ONOA 3GM8A 5D6CA 1RFDH 3VMNA 1C7SA 3D2UA 2VDMH 4WUKL 4DEPB 4V1DA 3U7WH 3ZO0A 3PWVA 2DQTH 3UTZA 3QYCA 4PRAB 4QY8A 3MJ7A 4QT5B 2BNQB 4ONHB 1IGCH 3U4AA 3QHFL 1IAIM 1L0QA 2EDHA 3QEHA 5I18H 4R9HA 3B5HA 5JHLH 3KPOA 4YFDB 1OD9A 3JWDL 3OXRA 1SVCP 1T1XA 1HH6A 1BM3H 3JVGC 4A6YA 4G6KL 4JAMB 3NCJH 2DAVA 5IW1B 4XBGA 4Z7WA 3WS3B 3C6LB 3GSUA 2PYFA 2HTLC 3DPBA 3RP1A 2F5BH 3UTTA 3BP5A 3VXOB 5KVMC 1YMME 2WBJC 1Z6JT 2AJ3A 3CXHJ 3LQMA 4GRMB 3GSNA 4IOIA 2IBZX 1HQ4B 2FSEB 4IMKC 1GGBL 4I1NB 2GCYB 4QRTB 2W9EH 2Z91B 3NGBC 3HC3L 4R26L 4XNQA 5T5NG 3T0ED 1MHPH 3MCKB 4PJCA 2OR8A 5F89A 1HEZA 3GHEH 3MFFA 3FT4B 4LPVA 1Z9SA 2PYED 5AD0B 1I75A 3DRTA 1MCNA 3HPLA 1FJ1B 4OB5H 2HFFA 4QRSB 2ERJC 2ILLA 3OB0H 5KSUB 4OD2B 2BNRB 4P23A 4L9DA 5KOMC 2W65A 5C70A 3QUZC 3R8BB 3MMEB 2FX9H 5JDSB 1BIIA 1D6VL 4G8GB 3MPCA 3KPLB 3FHAA 1N64L 3EHBC 2E27L 4LK4A 4ZPVA 3GSRA 2G75B 4LIQH 3DARA 4CN4A 1LWRA 4UOW0 1QPXA 4N0UB 3S36X 3CFCL 4UIMB 1UB5A 5GRWA 1C5DB 1WEJH 5HJ3A 3RZCD 4C83A 2MNUA 3BJ91 1A4KA 3JWOH 1CTOA 2HJKB 4JRYB 2X1WL 3B8YA 1RUPL 2R1YA 4XGZB 4P2CG 5C0JB 3MRNB 1NMCC 3BW9B 2YD8A 2CUIA 3P9LA 4BH7B 1PW3A 1J1PH 4JGJA 1WFTA 3O3UN 1WWWX 4YHKH 3BGFC 2EXWD 1A3LL 1QACA 2I26N 3SGKC 4ZAKB 4XAKE 1YY9D 3WNLA 4IJ3B 3S5LB 1G7HA 4TVPD 3ZYIA 1YDPB 5IFHH 4WUUE 3REWB 2DQIL 4LSUH 1UCBH 1T7YA 4KJQC 1VKXA 3UC0H 4M7LL 1YPZB 2HG5A 3IKCB 5I2IA 5E2VH 2RJMA 3LEYH 5A2KH 1H15A 1FC2D 2VABB 1J1OH 1G0DA 4QTIH 4RNRA 3PP3H 4UOJA 4K3DH 4EI6A 4I48B 1QP1A 4LF3B 4AY0A 2J5LB 4MAUL 4KI5E 3QUYA 2A74A 1K8DA 5IJVA 3DXAD 1EFXA 5ENWA 1AQDA 1DSFL 4APQC 4F37F 5IMOA 2CDEB 3HUJA 3JXAA 1AKJB 5INDB 3D0VB 4DKFL 4G3YH 3TZVD 3OHXA 5F6HJ 1CDJA 3QXUA 5E94B 5B39G 1V05A 4CNIB 4HUWB 5EC2A 5EBWB 1NGXA 3PXHA 4HC1H 1OPGH 2B4CC 3BKYL 3VW3H 4X7DC 1OAZH 2C1OA 1QFPA 2EO9A 5F7YC 4LRIC 1KXVC 2VLRD 3C8HA 5BRZB 5DJAB 4PJHF 1IC7L 1I8LA 5EZJA 1OOAA 2QADD 2ZOKB 3QQNA 5I15L 5D6DC 1N5AA 1CICD 1MEXL 5D7JC 3S35H 4F7CA 1IMHC 2AXFB 5KZCB 2X4NB 4O2FA 1W72A 3TJEL 5D1ZD 2ITDB 5FA4A 3IDNB 5D1QD 5DMKA 2GUOB 4ZS6D 5EC1B 3VCLA 1VFUA 4U05A 3KPTA 1SHMA 4QOKD 1MIEH 4ERSH 5F1OB 3CDGA 1ZVSB 4XXDB 4HUUB 3KDMA 4KDTA 5CD3B 5JDJA 1YJDH 5C0AA 3C5ZD 5I16A 1CK0H 3EFFA 3KYMB 1F13A 4GKSA 5E2UH 3STLB 3FQTB 5D1XB 2EYRA 4WI7A 2N4IA 2VIRB 1QD0A 1A2YA 1Q1JH 4OI7A 2NY1D 2NY7L 3BHBA 4K8RD 4ODHL 2A1WH 2BSTB 3CXDL 2F8VA 2Z0BA 4U6XB 5DJCA 4KROD 4PGDB 1M6OA 4W6WB 2IAMB 4WHCA 3S36H 5C0CA 3S4SA 3DTXB 2X5PA 2X05A 4GRWH 1FPTH 3FN3A 4LASL 4JFZL 4L3ED 3TFKC 4NKDB 2X9YA 3DX7A 2Q8BL 3ZSTA 1H9VA 3C2AL 1CU4H 4PJXE 4TUKL 4PJGB 2YWZA 3MA9L 4IDLA 3RU8L 2F19H 4PJAF 3QZWB 1L9NA 3SKMB 4HS8H 2XWTA 1FZJA 2KZWA 2XT1B 4M4PA 1U91B 2R2EA 3P9MB 4NJ9H 4FQLH 3LKNA 4G8FB 1U3JA 1BEYL 5ISZD 3SPVA 3UPAA 1JI2A 1SYSB 2QL1A 4MSWA 5F7HA 5F96H 3O4OC 4QNPF 3O3EA 5CBEB 4HCRL 3ILPB 3MV8B 4QHLB 1CGUA 3P9WB 1YQVL 3VWJA 4D9QE 1I8IB 3MJ9A 1FIGL 2ZOLB 1AC0A 4J8RA 1KJ2A 2BX5A 4M7KL 1FVDA 4Q2ZB 3B5GA 5CJ5A 3U1SL 1T7ZA 2P5WD 4WEUD 4Z95H 5IKCA 2M26A 3TO2B 3UAJD 4NSKA 3P2TA 1F58L 4IIQB 4S11A 4X7TA 5SWZB 5DK2A 4AENA 1QFHA 8CGTA 1INDL 5JW3L 4FQHA 4JO2L 3EYSL 3TNNA 2OJZL 4NQEA 5C2BL 3QIUB 1YYMH 5JNYB 1EO8L 1R5VB 4GMSH 5IV2A 5FM5O 1MQKH 1JPFA 3BD3A 2B5IC 3L7EB 4TYUA 5I1AB 1R5WB 4OTXH 5B8CA 4BM7A 1CE1L 4BQCA 4P5MB 5AWNL 4RRPA 4K2UH 1FZKB 4JFPB 4JZOA 3MRKA 2BK8A 3O2DA 3PIQB 1U8KB 2HFGH 1A47A 4KRNA 4HPOL 4U2YA 1G9NL 3GJFA 3PWUA 5D1QB 3AGVA 4RAUA 5I74B 2NY6C 1JGEB 5DRWA 2CK0H 1S7QA 4ZS7H 5FXCH 2ICWA 3VRLE 3VFUA 2E9BA 4LPXA 4X6CB 5F7LB 1GYAA 4MMXC 4XH2B 3X17A 2R9HC 5DRZB 1QZ1A 3C5ZB 4POZC 5CEZH 3PGFL 4YIQB 1IC1A 1VACB 2XFXA 1MFAL 1LK2A 3OKKA 3C09B 1FG2B 3SDCB 4C58B 2XG4A 4QF1B 4ODUA 1NFDA 2QJDA 3VG9C 4ZUTB 1MAML 3VFPB 5DVNA 4G43B 2MJWA 4RGOH 3RDTA 4RA0C 4MA7L 5JUEL 1QBBA 3K4DA 5LGHL 1J8HA 3MBED 1FDLL 4YO0B 3ULUD 5J11B 1UYWH 3FFCA 1CBVL 4CVZA 4AT6A 1A1NB 1NEZB 1EX0A 4FQ1L 4HLZH 2OL3L 2O93L 3A67L 1JGDA 3CVHL 3O6FA 2Z8WC 4O5LH 3PJSA 3L5HA 2BNUA 2V2WA 4W70A 2F54D 1BVZA 4S1QH 2FNBA 1IJ9A 1WZ1H 1AGBB 5BMFL 5DRXA 1OAUH 1F4WH 1QYGH 1KPRB 4P9HL 1EEYA 3O4LA 3U9PL 1KTRL 2VWEC 1R3KA 1GJIA 3VXPA 5I1KH 3TT3L 1QSED 1U2CA 1N3NB 5E8PB 4OZFB 4LBEA 1I7TA 4QHNB 1R24B 3HTLX 5L0QB 5C0BA 3IT8D 2XN9E 3CLFL 5K33A 5ISZB 4EIGB 3SN6N 5GGRA 4FN0A 1BFOA 1JGUH 4C59B 1QEWA 4NQSA 1UWEH 3GMNA 4CVXB 2X89A 2Q6WA 3QPQC 1N8ZA 5GGUA 5DJYA 4HPYH 4OCSL 4HDIA 1BX2B 1WCQA 3TBWB 4GO6B 1YMMB 4M4RA 5HHOB 1Y6KR 2DQFB 3ARGC 4MCZA 1RFDL 2P43B 2VDML 1I7ZA 4UQ3A 1T21B 3U7WL 4F57H 4NWTH 4PY7B 2ZUYA 5DSCA 1ACYH 1ZHKB 5E4EC 4DUXA 2R1WB 5E7BA 4JM2D 5IF0B 1XZ0A 4E41E 1E28A 4GRLB 5JHLL 5AZEL 1QTYT 1BM3L 5GXBB 3U0WL 4QRPD 3NCJL 3SE9L 4HJ0D 1EAJA 4TNVK 1RQ5A 3IDJB 4UNTA 5J9PB 2MWCA 4R4NC 5HI4C 2DQGH 4WWKD 5FYKE 1DQLH 3QWOA 1HDMA 5E6IA 3TIDA 2D7MA 1SEBA 4X6DE 4RAVB 1IKFH 5E6YA 4PJ7A 1TETL 1PGRB 3TH3T 2YXMA 4XVJL 1NGZB 2X4PA 1P1ZA 3GMRB 1EZVY 1XF5B 2W9EL 4DN3H 3LKOA 4HMCA 1JHTB 1OB1A 3GHEL 3HZYB 4M1DH 2FECI 3JV5A 4PV8A 2YN3A 5F7UA 1BZ9A 3S6CA 4PJ8C 2HVJA 4OB5L 1BOGA 4K71B 3VXTB 3ZT7A 3T0EC 3AU1B 3VWKB 2W0FB 2LVEA 4WI3A 3L3KB 4K9EC 4PJHE 4ZO7A 5MERB 4LGPB 5J7CC 1D5ZA 4GMTH 1WGOA 2PXYA 3OKLB 4UNVA 2FEEL 4HK0A 2CLZB 3MRMB 4HS6B 1MCJA 1EFQA 1EERB 3ZYOA 1TVHA 1A5FH 1D9KD 5JO5B 2BZDA 4GBXA 1KSRA 1CG9A 1WEJL 5FYJE 4G8IB 3DO3A 1TZHB 1A22B 3BP6A 3DMMB 2D7OA 1Q38A 4GXVL 4L8DB 5KVEL 4QHMB 4ZXBD 1C16A 3V8OA 3D1MC 1U8PB 3FRUA 5DD6B 3QULA 5A43C 4NT6A 4AK1A 3QNYA 1F3JA 3V5KA 1ZAGA 5BZDA 3IGAB 1J1PL 2XA3A 2KH2B 1MLCA 1DBML 5FECB 2DLHA 2R15A 2J2ZA 5CJ8A 5GS3A 3PGDB 2A73B 3O41A 4PRHA 4WY7H 3BX7C 3NABH 5FUCE 1JK8B 5C71A 5IFHL 4LSUL 1UCBL 5L8KB 3UC0L 4NNYB 4U33A 1KENH 2A83A 4TPRH 5E2VL 1T0NB 5FCSH 4GS7B 3LEYL 1J1OL 3TN0D 1NCNA 4QTIL 5F9OL 1UT9A 4Z77B 4YDJA 3EOTH 2FWOB 1MCCA 2E9JA 3ESUF 1HYRC 4JFQA 5FO8A 4MA3B 3U36A 3TYFA 5I6XC 3DIFB 5CHNB 5BQ7A 1LQSR 5D2NC 1JWUB 5C0IA 3BDYL 1N5YH 3BPCA 1JN6A 1TPXB 5EU3A 1DLHA 5IMLB 4G6JH 4G8EB 2RB8A 1JYWA 3HAEA 2ENSA 2A6KB 1T20A 5KSBB 5ESAB 2BY1A 2WUBH 4X7EC 3GMPB 1IM9D 4QNPE 5AG9A 4HC1L 2A6DB 4QRRB 1OPGL 2JELH 3VW3L 1OAZL 3BQUC 1P7QD 4YHLH 1IFHH 4JE4B 1IGJB 2I07B 3REVA 1RUKH 3MRRB 1NFKA 1Q9WA 1S7UB 1BQHB 3M07A 3L1OL 1KJMB 1S9VA 2CLRB 3T2PA 4U1HB 5LG1A 2C3VB 3DSFH 3TO4A 3C5JA 5C3LD 3QJFA 1D5XB 1K5NA 1D5IH 1I1AC 4OT1L 3RTQD 5I1JH 5EULV 2IQAA 4L8CA 1L0XA 1A9EA 2JIXD 1XR8A 4KTEH 2DL9A 1PX3A 3KPNA 2H6PA 3O9WC 3ARYA 4ERSL 1MIEL 1CICC 4JFDE 1TZIA 1YEDB 3BPOB 4L4TA 1RZJH 3WLBA 3PHSA 4XP6H 4QTHA 4MZ3A 2CKBB 4NJAH 4GT7A 5CZKA 3QFJD 4KTYA 4Z7NF 3VD7A 1CK0L 4JJ5A 4HGWB 4WV1B 3NCFB 5E2UL 4H25B 5KVGL 4L4JA 1Q1JL 3I6GB 1D9KB 1S5IH 3U82B 1RIVH 5EUOE 5FF6A 4P2OC 3IVKB 2IGFH 4MQ7B 2DIAA 3G6DH 3UDWA 3TIEB 3E1F1 3S36L 5F8RC 2AABH 3OX8A 4N9GA 3BEWA 4YZFF 4M6AA 2OTUA 1DCLA 3D39A 1EHLL 2R2HA 1U8OB 3H9SE 4MCYA 1NCTA 1N6QL 5DURB 4BJLA 4OFDA 2RHEA 4FFVC 2BVEA 2P46B 4QEGA 4P2RE 3IJYB 2BVUA 1RZKH 1M71A 4KROC 4EJ1C 1CLZL 1TVBB 3SQOH 3D2UD 2F19L 2BJML 3CMOH 4NKOB 1UFUA 4V1DD 5EU6A 3WJLC 1JHLH 2Q76A 3D25B 2GITA 4LHUG 4S10A 1DTUA 3RWEB 3VXSB 5HYFA 4FQLL 4X80H 1FAKT 3EYOB 4LCWE 2D03H 3UMTA 4IRSC 2WUCH 1GGIH 2F58H 3QDJE 4U1JA 1P7HL 2RCSH 3TH4T 4Y1AA 2AAVA 5K59F 5GS1A 5F96L 5CEXB 2DQHH 3LRHA 1C5CH 1KLUB 4YX2L 2VH5H 4F33B 3RGVA 4FQXA 5JHDB 3UTTD 4U6TA 3ROLA 1U2HA 2R69L 2X70A 3H3PH 1X4ZA 2XXCB 3K46A 4GG8A 4RMUA 4Z95L 5KBNC 1KC5H 1FSKB 5EU4A 5CZXD 5J6GB 5I17B 1I7UA 4A2MA 5CMAB 3L3HB 4ZQKB 2BCKB 4I0PC 1YYML 2M2DA 4HF5H 5ACZA 5I1DB 5E8EB 5JPNB 2NY0D 2EDKA 1KNOB 4PJIB 4GMSL 2DTSA 1DQJA 4MS8C 5CCKH 1MQKL 4OZGF 5IVNA 1PAMA 4EBQH 4YHIB 3FL7A 3P4NB 3B43A 4K2UL 2GK2A 2DQCH 4LPYA 4P23D 4FMFA 3TC9A 3MR9B 4U2ZA 1WITA 5I1CH 2HFGL 4WFHE 2NY2B 4YNYA 1P6AB 1XCTB 2BSRB 1BIHA 2VYRE 3GSQB 2CK0L 4ZS7L 5HYJE 4N8VB 3BWUC 4MD5B 1RZGB 5CEZL 3QFJB 4HGMA 3MRHB 4OGAC 3O3DB 2PCPB 2HKHL 3I3DA 2MHAB 1XAUA 3NFSH 2YD5A 4LGSB 5IBLD 3TJHC 4U0RB 4ZFOL 5E56A 2JJSA 2CRIA 1WZKA 2V17L 2XN9B 1QSFE 5I66B 4HCRA 2VDOH 3SOBH 1UM6H 5HSFA 1UYWL 3QXDA 1ED3A 1Q9KB 3HG1E 4ZUWA 1KEGH 3LB6C 4LHJB 4XNZC 4Y89A 5D72L 1G0XA 4O5LL 3VFMA 1AHWA 1VB9A 4HSQA 4S1QL 5GPRA 2APXA 5IJKA 1J05A 1OAUL 4NIKB 4OFKA 1F4WL 3ULUC 1QYGL 1FFNA 3IS1X 4JFEE 2HH0H 5H8DA 1AI1L 2KL6A 3PWVB 5I1KL 3VD3A 4LKXA 3UTZB 2OJEA 1F5WA 4ZPTA 9CGTA 4ESKA 1CFNB 3QEHB 1HXYA 3UROR 1C12A 2Y06L 4E41B 1JGUL 4Y5YB 5K9QI 4LSQH 3UP1A 1HH6B 3HC4L 5MEQA 4A6YB 1OAXH 2DLTA 4JANA 1AGDA 5F88B 1CGYA 4LDEB 4HPYL 3GSUB 4G6AC 1AD0B 2FH8A 3AXLA 4P4KA 1CGXA 4X6DB 3WSQH 3RJQB 4IOIB 2APFA 5HHPA 5IT2H 1ES0A 4F57L 1MRFH 3RY4A 1U41A 3ULVD 1LD9A 1A7NH 1KCRH 3MNVB 4XNQB 3EYVA 4EOWL 2LU7A 4PJCB 5M7QA 1N26A 1OTTC 4G42A 4B50A 2YZ1A 1CQKA 3DRTB 4CVWA 3MRDA 2XNAA 4OF6A 3BE1H 4TSCL 3VXUA 1R3LA 4WHDA 4UAOC 2VDKH 1YN6A 1IVLA 1KCKA 1WBYA 2Z93B 2VXTH 4JREB 4XBPA 2AJVH 4PBXA 3WUWG 2OL3A 2DQGL 1BIIB 3H9HA 5DRNB 1I1FA 5C0AD 5T1DL 3MCLL 3K2MC 5J3HD 3I85A 3IDGA 3BRFA 2DTMH 1XGPB 2RFXA 3GSOA 4MAYD 3VGAB 5CWSA 2OXHA 1T5XA 1ND0B 2IMMA 2VL4A 4DN3L 4UI2A 1ORSA 1PKQE 5HJ3B 3CFKB 2J12B 4QKXB 4M1DL 1IAKB 2ADIA 5BV7C 4C83B 4ZUVA 4KK6C 5C0CD 3E6FB 5F1KC 5HGGS 2ZCLH 4E42A 1AQKH 2Z9TA 3QSKB 2ZG2A 5I1IH 4WI4A 5C07A 4OLEA 5AAWA 4IMLA 5EZOH 3P9LB 3JTSA 1IZJA 4ORGA 1H5BC 3ZDZF 4OF5A 4UIKH 5F8QC 2NY3D 4RFNC 1KJVA 3K2UH 5CJOL 3MRIA 3CZJA 4GMTL 2PKDA 2Y9RT 3KHOA 4X9FA 4XNXL 1A5FL 5CJBA 5CINH 43CAB 3P73A 5SV3A 2GY7B 4DAGH 1ZHNB 3L7FA 2VLLB 3CX5J 5I2IB 4Y4KB 1WUNT 3IS0X 4HJJH 4KXZH 4RNRB 4EI6B 2CRZA 5E1HB 1ADQH 4NHCH 1D5MB 3CDYA 3QUYB 1DBJH 2A74B 5C8JB 4NQCE 2PN5A 1QLFA 1EFXB 2JK5B 3DGGB 2C5DC 1AQDB 3MYJB 3PWLA 5HI3D 4N5ED 5IMOB 4HIJA 4HX1A 3HUJB 3KNBB 4ZFZB 4HG4K 4N0FB 1DQDH 3ZT6A 4YXHH 5HYQB 3QNXA 2YRPA 1NDMB 3F8UB 3OKNB 4JDTH 3OHXB 1WTGT 4O58H 3HN3A 1X6LA 1Q94B 4OSUH 4WY7L 5GGTH 1A6VH 1FL6B 3VA2C 2WWKT 4ZOAA 5DHVH 1MFDL 1M7IB 1KENL 4JY4A 5A3ID 4KKCD 5E5UB 2Y7QB 5FIEA 1G6RB 3WLWD 1UH3A 3X13A 2G60L 4KQ4H 3T0VA 3LRSB 4R2GB 1XIWC 5EWIL 4NRXB 3X3GH 2DLGA 5F1IA 4YGAB 2XY2A 2YPLB 1SMOA 1ZLVH 3D5OF 3NH7L 5DS8A 1T04A 4NQDE 5IW6A 5BVJA 5MI0C 1AGCA 4L29A 2GTZA 1X5YA 4DQOH 5FA4B 3N0PB 3ZKNC 1Q72H 5JXED 4D0CA 1EH9A 4G6JL 1YECH 3K4ZA 1CXKA 4NQVA 3CDGB 4YR6B 3SDYH 3RPIB 4ZOCA 1RHFA 5C0FA 4X83A 3QWQB 1OARH 1KTDA 2JELL 4NQUA 3EFFB 3RL2A 4YHLL 4WEMB 1IFHL 3QQ9D 4BKLB 1WBZA 5ICXA 5DFWH 3C08H 2DKMA 4DN4H 3I9GL 3MROA 4PRIE 1LE9A 1Q0XH 4WW1B 2E6JA 3S96B 3RDTD 1M6OB 3UJTH 4ZTOH 3NIGF 3S4SB 4GFTB 2ATPA 5SX5K 2IH1A 5I1JL 2B20A 3FFCD 1F4AA 4J4PC 1T5WA 4KTEL 1NBYA 2FJGA 1H8SA 3O6FD 4TOYH 1KN4L 3BN3B 1YNTA 1UZ6F 1CFVH 4MHHI 1BBDH 1H8NA 2ZCKH 4XP6L 4BFGA 2W07A 3RTQC 4Q97A 4WW2B 4X6FA 4NJAL 1BECA 2BFVH 4Y4HC 4WEBH 4OZGE 1S9KC 3TBVA 3O4LD 5HGHA 1HHGB 2CDFA 2R2EB 5JPMB 4Y16C 2C7UA 3RPKA 1A64A 4DKAA 3MLPA 2H32H 3ZZ1A 4LCWB 1S5IL 1G7QB 1RIVL 2BC4B 1CF8H 5C0BD 3K1KC 2IGFL 3SPVB 4LL9A 4H26B 1WWBX 5JIKA 3G6DL 4MSWB 1NGYA 5EZLA 3FTGA 1YC7A 2AABL 4MX7A 1A3QA 2X89D 1VGEH 4Q6IA 1S8DA 3UZQA 3KWWA 4MJ5A 3AB0B 1WT5C 4HFUH 4NBYB 2R4RL 2IPUG 4MQXD 1U8MA 4LCCA 4WNQA 5HGBB 5INCA 4D3CL 3H0TB 3CSYB 3VWJB 1ZE3C 2GHWB 3LQZB 4PR5A 3ZKSD 4F7TA 1KJ2B 4O02H 3E8UH 5ITFA 3SQOL 4PJHA 4YBQD 3V4VH 4JM4H 3PQYE 1U3HC 1JHLL 4M7JH 2HTKC 3LHPH 4NSKB 5ANME 3G5ZB 3KPMA 3HE6A 4HC1A 5E95B 3NZ8A 5K9QG 2MCG1 4HV8A 1H3TA 1SVZA 4TVPH 4X80L 4FQHB 3Q48A 1CFSA 2D03L 4PJ5A 3TNNB 1RJLB 5LWYH 4OF0A 4NQEB 2ZUQB 4DJMA 2F58L 5F71A 4DK6A 3QUKB 3KPPB 1DBAH 1G0YR 2JTDA 3NFPA 4ELMA 1HXMB 3WFEH 2DQHL 2EIBA 1C5CL 4JLRA 5JQ6L 3U79A 3RVUD 5B8CB 3HR5B 4JFHD 4LAQH 4U3CA 5IP4A 5E8DL 3MRKB 3FQRB 5IBTH 1F6LL 3HS0B 5IB5A 2Y5TB 4X8XA 1WICA 5E6ID 3RHWK 2WLYA 3H3PL 2AXGA 2VRAA 4RAUB 2I27N 1QBML 3DI2B 5DRWB 2B4CL 1S7QB 2OQJB 1YEEH 1KC5L 3CD4A 3ILQD 3BUYB 4NM8H 1N6VA 4NC2B 4Z7UA 2NXZD 5FKPA 1CXHA 5FDWA 4R4BB 3BWAA 4P5KA