3ZDXE

Integrin alphaiib beta3 headpiece and rgd peptide complex
Total Genus 40
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
40
sequence length
219
structure length
216
Chain Sequence
EVQLQQSGAELVKPGASVKLSCTASGFNIKDTYVHWVKQRPEQGLEWIGRIDPANGYTKYDPKFQGKATITADTSSNTAYLQLSSLTSEDTAVYYCVRPLYDYYAMDYWGQGTSVTVSSAKTTAPSVYPLAPVCTGSSVTLGCLVKGYFPEPVTLTWNSGSLSSGVHTFPAVLQSDLYTLSSSVTVTSSTWPSQSITCNVAHPASSTKVDKKIEPR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Cell adhesion/immune system
molecule keywords INTEGRIN ALPHA-IIB
publication title Complete Integrin Headpiece Opening in Eight Steps.
pubmed doi rcsb
source organism Homo sapiens
total genus 40
structure length 216
sequence length 219
chains with identical sequence H
ec nomenclature
pdb deposition date 2012-12-03
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3zdxE01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3zdxE02
4XWOC 1KXQE 2UY7A 5ESVA 3SDXB 2BFVH 2HA1A 1G9MC 5KBNC 2AXGB 5FIEA 4N8CH 3MZTA 3RIFF 3QDGB 4U1NA 3UBXI 1UWXH 4XP9L 9CGTA 4YO0B 3RI5F 1NQBA 2XTLA 3S5LB 1UT9A 1HXMB 5SX4H 5KANI 4PV9B 2NCMA 3CCHB 4GMTH 5HVFB 3WD5H 4Y7MA 5DRZB 1OB1A 4KVNL 3G6DL 4O2EA 3TWCL 4OD3L 3HI6H 4QOKD 5SV3A 4H1LG 3QWQB 4I0PB 5CIPH 5DJYB 2DQTL 2BOBA 1I7TB 3FL7A 4X6DB 1YMHA 4K3EL 4P5MB 15C8L 5KTEH 3S6CA 5DD5H 5LVEA 1BFOA 5F9JA 3C6LA 3E6HA 4PJAF 1TVHB 5IB3B 3BHBA 1CU4L 3KYKH 5LWYH 2VC2L 4PTTA 3CMOL 2VQTA 1IM9D 4NT6B 4R97B 1RUAL 3BZ4B 3J8F7 2Q3ZA 5ESAA 4C4KO 3O41A 1QFHA 1QBMH 1JI1A 2EDHA 4F9PA 3DGGB 2DQJL 2QL1A 1RSFA 1WFOA 4WV1B 1U8NB 2HG5B 2LU3A 3QBTB 2EYRB 4PG2C 5B8CB 1ED3B 4JPWL 1CBVH 1BLNB 1RUPH 1XF1A 4N0UE 5FUCC 2OTWB 1DL7L 4LRNH 3MRMB 4NO0A 3OV6A 1JNLH 3LRSB 4KV5E 1I7ZA 3QA3A 5CJOL 3WJJC 3LS4H 5F3HA 3BDYH 3IVKA 3LN5B 3RVUC 3KPPB 1J0KA 2PCPA 1V7ML 4PJ9D 5FKAB 3QSKB 2VE6B 3CDGB 2I25N 4JLRB 4NQSA 5CMAB 4M1DH 1IC7L 4WIQA 5HHVH 1R0AH 5IFAH 2XV6B 5T1KD 2GUOA 2FX8H 3QFDA 1F02I 3LSOA 5D7IF 1NFDF 3OHXA 3VXRE 4NZRL 4UTBH 4JY6A 5IMKB 5K59F 4HCRL 2NXZC 3T2OA 4U1MB 4HCRA 2R1YB 5HI3C 2P42B 1JGVL 4M5YL 4PRPD 1FBIL 4K3JH 1MI5A 5E5MB 1VFUA 3JWOL 2HFFB 3GSNH 2DQGH 3W2DH 3EJZD 2GJZB 5E6ID 2O61B 3BAEL 4LIQE 5IHBA 4L9DA 4PBXA 3GGWA 1IGTB 4U0QB 3H2WA 1CLCA 1WJ3A 3NABH 1NCWL 1FYTD 3LPFA 1DFBL 2F58H 3MV9B 4U6YA 1IC1A 1OTTC 2GK0A 2IH1B 5D8JL 5D2NC 4I3RL 2FX9H 4YAQA 4L9LB 3QEHB 1A3LL 1YMME 3WIIH 1FO0H 1GOFA 5BZWB 3BRFA 3BP6A 1QFUH 2A9NH 4Y4FA 3RX5A 3VD4A 4GKOA 5INCA 2IADB 3P0VL 1QQDA 3PQYB 3AB0C 5I17A 3BPNB 1M4KA 3QIUC 4ODUB 5EZOL 5JIIA 4JDZB 3FQRB 1BPVA 1LGVA 3OQ3B 5C71A 2IQ9L 3QQNA 1GRWA 2OK0L 1Z5LA 1C5CH 2AKRA 2QQLL 4H1LA 1JBJA 3ALPA 3O6FB 5AD0B 1VACA 4U1SB 4ELME 2LU7A 4Z7QF 1KPVB 1J5OL 2WP3O 4HXAH 1OAKL 1GHFH 2AEWA 5DJXA 3SOBH 3TT3L 3TJHD 1BAFL 4PJ5E 3C6LD 1OPGH 5FYJL 3MBEC 2HTLC 5CGYD 1ITBB 2DLHA 5GXBB 1NC2B 5MP6H 1SMOA 5BMFL 5JOFA 4FQLL 4NOBA 5HD8D 3STBA 4MA8L 1MAJA 2HT2D 4PJXE 3RUGB 5AZEH 1KIQB 1T5XA 4TOYH 1CLOL 2OLDA 1UJ3A 2HKFL 1AQDA 3U7YL 5IB1A 2OXHA 5KSUB 5CP3A 3SE4C 5J11C 2ZNXA 3NGBC 3VMPA 3VA6A 2OSLA 2OL3H 2I9TB 2ICEA 4I77H 2A6KB 5ADOL 2P4AB 4MNHA 1U0QA 4KKAD 5LAXB 1A21A 4NO0D 2Y5TA 5D7JC 1YECH 2F5AL 2ITCB 1VGEL 3ARBC 2ZUWA 4E9LA 3MV8E 1PX4A 4ZFZB 4KK6D 4OFDA 3BUTA 3ECBA 4NWUL 2HAZA 1W72B 1ZT7B 1N64H 3H9HB 3V6OE 4FQXA 4HIXH 1FFOB 1VDGA 2DBLL 5DMJB 5FO9B 2BHZA 1UXWB 1EHXA 2BNUA 4P23A 1IKFL 4LGPB 3X3GL 1CF8H 5HVHC 2XZCH 1I1AA 4PS4L 3OAUH 1BD2B 3IDYB 3DVGB 2GSIB 3P0YH 1F4HA 3TBSA 5EZIH 1F5WA 1KGCE 1RQ5A 5DXWA 1R5IA 3LKSB 5IOPA 3IGAB 2YPKB 1KENH 5AUMA 4C55A 4OLVH 2UZIH 4AT6A 1MI5D 3MXVL 4GAYB 3MRIA 2V7HA 5D5MF 5C2BH 3IFOB 4YBLB 4WUKL 4NM8H 5TF1H 4OCMC 2X4QA 2ADJA 2HKHL 2ZCHH 2I9LA 4MAYC 4O02H 4LP5A 4M5ZH 4NYLB 1GGCL 3TVMB 2D7NA 4RAVA 1CICC 1YEEH 1LK3L 3BO8A 4GW1A 5HVWA 4XNYL 5D1ZA 4Y4FD 5DQJA 3TJEH 4CNIA 4MJ6B 3A67H 4YHYC 5GJTH 1GAFH 4YEEA 3T77A 4RDQF 3IDJB 4Y16A 3QO1B 1AHWB 5EU5A 4S1QL 2GTZA 2G9HB 1QLRA 5D7KE 1N2RB 4U6TA 3WN5A 4P4KA 1TVDA 4UDTB 4WCYH 3ARDC 5J0BA 1W8OA 5HGGS 3GRWL 5DQDH 4OSUH 4YHPB 3GRWA 4RGMC 4ZPTA 5E8PA 4HEPG 4ZFOL 4PTUB 3A6BH 1CFNA 4ZFOA 3QG7L 2BNRE 1T1WB 1PSKL 4HKXA 4F2MB 5FYJD 5L6YH 2IPTL 4PJ7E 5IBTH 5J3HD 1N26A 3JWDL 5DHYB 4ONHA 2H6PA 1B88A 2CLRA 3KDMA 5L0QC 1L0XA 4XMKH 2OBGA 3DUSB 5C0GA 1R3JA 3HZMA 4GG8A 1BFSA 1DUZB 4WI8A 1RV6X 3HC4L 3KHQA 2OJEB 1EXUB 3TEUA 1EEQA 1D5MB 2HRLA 4PP1D 1HHJA 1Y0LA 1IGYA 4UNUA 4JPKH 3SDYL 3TCXA 4AL8L 4UT7L 1F11A 2SEBA 3OG4B 5CUSH 3WJLC 3RGVC 3VXRA 3BZEB 5AG8A 4NZDA 4R8WL 2HVKA 3EOTH 1FNSH 1TZHB 1A6UL 1MCOL 3QUYB 4EJ1C 3MRHB 4JJHA 3S88H 5ITFA 4G6KL 1YYLH 3CNKA 5SV4A 3WNLA 5JZ7D 5GRXG 3O3DA 4S1SH 1CG9A 2EDEA 4F57H 4FQXD 1HINL 5CZKA 5IW6A 4EUPB 3F5WB 4P23D 1X5XA 3LV3B 5DVNA 1S78C 1ONQA 3SO5A 2WLZA 2YD3A 3DX6B 4E0RB 4LRIC 1IQDA 5C0NC 4S1DD 1NBQA 1QO3B 2ADIB 1SYSA 3OX8B 4LNRB 1YMMA 1A1OA 5JOPE 3UTZA 3GFUA 1HKLL 4U2YA 5K9KB 1KEML 4P2OC 3LQAC 2JB6A 2X40A 1H9VA 2VXQH 1A5FH 1SYVA 4MCYA 3H8NA 1Q9OB 3T0AA 4NQVB 1WT5A 4D0BA 3L3HA 2BSSA 3U9UB 2J8HA 3C8HA 5EIIB 3VWKC 2VDNL 3DETC 4BZ1L 4M7LH 4JQIL 1DQML 5GZOD 4ELMA 4Q6IA 1WCBB 1E28A 4M61B 5BOZG 5D1ZD 1DQDL 2MWCA 4RAHA 1FRGL 2ZKHL 5D7LB 3L5XL 4GMSL 4PJ5A 4JY5H 4IJ3B 3P4NA 3TN0B 3RHWF 3TYGL 4M7ZB 4Y16D 4LARH 3SKNB 2W07A 4UB0H 4XPFH 5JLZB 3RL2A 1CDGA 4P4KD 4PJXA 1HI6A 3QXTA 4HUVA 1L6XA 1NCBH 3UO1L 2DIAA 2F5BL 4U1HA 1FN4A 4XPTL 4I0PC 1T21A 4F8TA 1JZ2A 2E27L 5FYKE 3IAPA 1BVZA 3VFSB 2EH7L 5DR5L 1CXKA 4W68A 3C60B 2RQ8A 1A0QL 1S5HA 1HQRA 1HYRC 4OM0L 5LGHL 1AI1L 3B9EA 4MD4A 1MJ7L 2EKSB 4ALAL 4U6XA 1T2QL 4X7SL 3GKWH 3MRQA 1FGNL 2G75A 2YBRA 2X70B 2QKIB 3SGKC 2EC9T 4JO2H 4N8VG 1BEYH 4LCCA 3DX9B 2GSGB 3NZ8B 4R97C 4KKLD 1AGBB 1CQKA 4J3UA 2IH3A 1OOAA 4NGHH 3OKDA 2Q7YA 3ROOB 3PHQB 4OB5H 5ANME 2XA3A 4WV1C 3MODL 4MQTB 4OF0A 4WHTB 2XTJE 2YXFA 1PVHA 4HFUH 5C2UB 4PG9B 5B8CC 3DO7B 3TP4A 3BI9X 4MA3B 5I76B 3WDJA 5DUML 2EO9A 3HC0A 4GLRI 3VXRD 2V9QA 3ZKNC 1JWUB 2V2XB 4LDOB 4WNQB 1FNLA 1JE6A 1MCCA 2Q8AH 5DJ6B 4PLOB 5EA0L 1A7RL 4OGZA 3F12A 1QSEA 5IQ7H 2ZWLT 4ERSH 2IAMB 3FMGH 5BCAA 2XY1A 1K85A 4EIGB 5I1JL 1YY8B 2W9DL 1U95B 5DHVA 1N59B 2CK0H 4JZNA 4K9EL 4K2UH 2AJSL 1KJ2L 2VDKL 1J0ZA 5AAWA 1JWMA 1KJ2A 4JFPB 5T1LB 3T4YB 3PWVB 4F8QA 3ULVH 1YMMD 3KPQB 1J18A 2LV4A 2NW2A 5D2LF 4BZ2L 2QLVB 2WANA 5EWIL 2OTUB 2XRAL 4TSBL 4HUUB 4YDVB 2DWEB 1D5BA 4HK0B 4KRLB 4UINH 3VXOA 1PEWA 3QEQA 3KPOB 4HX1B 1JYVA 1BQLH 2CK2A 1MCRA 1MEXL 4KHXL 3REWA 3MLVL 1FL5B 1ZEAH 1RIUH 3LKQB 2JE8A 4XI5C 1U8LB 1YEHH 4H5SB 4G6MH 4M1CD 5T5NF 1FFPB 4OKVA 5EU3B 4F3FA 1I85C 5EN2B 1LP9B 2FGWL 3GMNA 5GGTH 3QQ4B 1NUGA 2MQCA 1TNMA 4OZIF 2BNRA 5FA3B 4PJ5D 3QXAB 3BN9C 1T1YB 4K3DH 4I5BB 5I66A 2YHGA 3KLAA 4RMRA 4PJ7A 4FG6C 4HUMB 3W39A 2JJVA 2EIBA 1LO2H 1YN7A 1KB5L 1KB5A 2VDQL 4NFDA 3GMLB 1MLCB 3BPNC 1J8KA 4L3EA 1BHGA 5DJZB 2HT3C 1R3IL 2XWJB 4IOFC 1D5ZA 4W6WB 3MLWH 5E2VL 1U2HA 4KHTL 2GT9A 3KLSA 3U79A 3INUL 2CJUL 3DVIA 3C08L 1MF2L 4Z8FL 3QZWG 4PREB 1ZLVH 4RWYH 3NFNA 3WUWB 1NKOA 1IL1B 4YJZL 4NKOB 1N5YH 4DZBB 4YDJA 3P73A 2PXYB 1T20B 3VE0B 1MRDH 1IGCH 2R69H 3JSSA 1M71B 2DQDH 1Q0XH 3FN9A 1UQSB 3MV8D 1BF8A 1CI5A 1HHHB 3RIAK 4ODWB 5A1AA 4V1DA 4O58L 1AY1L 4LKCA 5I73B 1RK0A 3MNZA 4RMVA 1A6ZA 2DQHL 4DGVL 5IB2B 5I1KH 2NMSA 5DT1H 3EFDH 5EIQA 5IJKA 4OLYL 1A64A 4TSCH 3VW3H 1NCDL 4YXKH 4LSRL 5J8OA 5E9DB 2J8UF 4HKJB 4LEOB 4LSQH 2GAZB 4JY4A 4QYOB 1I3VA 2VDOL 1TPXB 2QEJA 2JK5A 4YBQD 3I02A 4Z7NF 1KGCD 4WU7A 4U1GB 4IDLA 4NPYA 4GRMA 2VQUA 2CKBL 3ZE0E 3C5JB 2CKBA 4MWFA 2IFFL 1QSED 4JCMA 4LCWE 1OGAA 4OCWL 4ZS6D 1KULA 5EO9A 1NBVL 2YMXL 1OQOA 3TT1H 1DN0A 1MFAH 1CD1A 4WTXA 2IANA 2ZCKH 1VSCA 1F4YL 3T08A 1N7ML 2EECA 3G5ZB 2GTWA 2A73A 1QKZL 3EJYD 3SE9L 2A74B 4HHAA 3MRBA 4BH7B 1OAQL 1JGUL 3MACH 4AM0B 4HC1L 3PABB 3IDYC 5CSZA 5TQ2L 4HC1A 5J6HB 3AMKA 3IFPA 4KVCL 4ZUSB 1PLGL 3D3VB 5TH2B 1H3PL 1F3JB 5GZNC 1SHMA 4NKMB 4NQDB 4KK8D 1N0LA 4QRTB 1SVZA 1A7BA 5IT2H 3U82B 2DL9A 3F7QA 4NQXB 4FQHA 4YBLC 1B6UA 2VDML 5HDBF 4PGEA 5JXEC 4MDJB 3FFDA 1OWWA 4RFOL 1RU9L 4HJGA 3DMMB 3F6LA 4JO1H 3TVMC 4W6YB 3P9WB 5FYKL 1QBLL 4XVJL 4UTAL 3B9DA 2BNRD 2YRLA 4Y8AA 4C56E 4ETYA 2H8PA 3HMWL 5DRWA 5I8KL 3Q1SH 3QCVH 5DJAB 5GRUH 1QD0A 3FT3A 5K9OB 4NZTH 5BS0E 1U8MB 1TDQA 4K7PH 3MRRA 1UB5B 5F96L 4L3ED 2YXMA 4HPYH 3QUMH 3R0NA 4YR6B 3L3OB 5D1QB 1AHWC 4YZFF 4G5ZH 3CU7A 4L3CB 3WXVH 3L5WB 1NBYA 2AJYH 4NHUB 4EI6A 4LF3B 1S7QB 5ANMA 1FL3A 1WSST 5KJRH 1WQVT 2R8SL 2QQNH 1YNLL 4JAMB 1FVEB 3GSQB 4X7TA 2DKUA 4PJ8A 1MQKL 1WFUA 4PJAA 5D71H 5HI5C 5DUPL 5F7UA 1S9YB 3VG9B 3MLTB 1QYGL 1HHIA 1CGUA 3LVEA 1ITCA 4IMLB 4N1CA 3TZVB 4V1DD 5D6CB 3V0AC 3F58L 3G08A 4XNQA 3EYUH 1GGIL 3ET9F 4OCRH 4QY8A 4GAGH 5KZCB 2O5XH 5BO1H 4KKCD 4LIQH 5JA9A 3JV4A 2HWZL 4MAUH 3QPQC 1V7NL 5TFSH 1AP2A 2HMID 4DW2L 4GUPB 1WZ1L 5JR1H 2Y5EA 3TH2T 5JOPD 4BQ6A 4LSUH 2HN7B 2BSRA 3SDXF 1G7IA 5F9OH 3F7YB 3QUYC 3UCRA 1EGJL 1BFVH 5ACMA 1EGJA 1F3DH 1OGAD 2R56L 4JKMA 1MHCA 4Y8DC 4UV4H 5HYSG 4NWTH 4CVZB 1ZGLA 1F2XK 4Q74A 4XCEB 3O3BA 3CXHK 2IAND 4OLEA 1QACA 2EDBA 4Z77B 1D7FA 2PETA 4DTGL 1T7VA 4GO6B 3ZSSA 4OCXL 5D7IA 5GGRB 3S97C 5TGBB 4HWZA 3V0WH 3MROA 3BMVA 4QHNB 3JUZA 5IEKB 3X14B 4ODSH 3QDMB 2ICWI 1MAKA 2CGRH 1DQQA 3RQ3A 1T4KA 2VSDA 5HHOB 1JGLH 3KXFB 3T8XB 5K9JL 3NCMA 2NQCA 3BXNB 3EBAA 5GRWA 3HN3A 4FQIH 4ZUUA 4MQ7A 3L95A 5GS0L 2C1OB 3X13A 3UC0H 2X1XR 3HNSH 1P5UA 2EH8L 4ZDHB 4OIBA 1Z3GH 3HAEA 3OGCA 3V7AG 5BZDB 1L0YA 4HF5H 4L4TB 3TBYB 4XPAH 3N9GH 4XB7A 3P9LA 5FYKD 4IHOA 3WIHH 1MCHA 2VDPL 4DZ8A 1MFCH 3QNYA 5FYLE 5DQ9A 1AR1C 4OLXH 5IMMB 2CXKA 4XCNB 4JR9H 3MLSL 4IJ3C 3TN0C 3DX8A 5ISZA 4TNWK 3QIBA 1OD7A 2P1YA 1RUKH 2ZZUT 4N9GA 2V7NA 4C58B 3I3BA 3EO1B 2MQ3A 3LH2L 4QRPE 2YWYA 1D6EA 3I3DA 4X5XA 1QSFB 1CE6B 5F44A 3ZHKA 2XTJD 4KXZI 1MUJB 1RUQL 3MLYH 5HHME 5BV7L 2Z4QB 4RBPK 2NY5H 4MMZC 5GIRA 5HGHB 1JPTH 2VXTH 3OF6A 4ZXBB 4EBQL 4MVBC 4Y4HB 2XWTB 3MA7B 2CIIB 1IZKA 2ZUYA 3C87A 1CL7L 3CXHJ 4KK5D 4UT9L 3UZQA 1IC5L 1FLRL 3C60C 1TTGA 1UKSA 2R1XA 1DQTA 3T3PF 3CC5A 5ESQB 4CBPA 3KGRA 4B0MM 4GG6E 3V5HA 2XKUA 4ISVA 5FB8B 2HTKD 3I2CL 3OJMB 2M8XA 2P8PA 1SJVA 2PW2A 3BDXA 4PJDF 5SWZE 1ZLUK 3EYFA 1G7QB 4LCWA 1JHLL 1RHFA 4HWBL 4NM4L 3FQUA 3VGHA 2A83A 3OKYA 1TVBA 4QOKB 3BIKA 1I9RL 4OGXL 2YR3A 1M1SA 4KKBC 1IBGH 4QXGH 3SDCA 1MJUL 5C07E 3QHZL 3GSOA 1KCVL 5A2KH 3VFGL 3QWOB 3T2QA 3VXTB 3VH8B 3VFMA 4BSVA 3VFPA 3OBAA 1YEJL 1I3GH 4B53A 4D0CB 3KPNB 1ZHKB 5TE7L 3S35L 1DEEB 1HWGB 3DURA 4F7EB 2D4DA 1OAZH 1RHHB 1CGSL 3IT8D 4L8DB 5GGUB 5DLML 2IAMC 3CSBA 1PG7W 1R3KA 2H45A 4AEFA 5M94B 1G9NH 4JM4L 2B4CH 5EU6E 4OCLC 1ZTXL 4YGVA 3ZE1F 1GC1L 3RVWC 1DBJL 1GIGL 2FJHB 3FRPA 4DUXA 3RKPA 1PKQB 4WI2A 4O5LH 2Q76B 2AJXL 5DMGC 5IIEA 3RKDC 2IPKA 1HOCB 3TBTA 5BS0A 5ADPL 1JGDA 1YN6B 1OAUH 2WBWB 4LNVA 2R1WB 4BJLA 2RR3A 4XC3H 3PV6B 3LKRB 1TCRB 5GS0D 4XPGL 1E4JA 2DQUL 3CFJB 4PJ9B 4HMEA 3RUGF 43CAB 3VGBA 4ELKA 4OCSL 4ORGA 3WKMH 1I8IB 4OZFA 1ORSB 1LDSA 4MHHI 3LB6C 4XPHL 1BZ7B 1A7PL 5D2LE 5B4MD 1REIA 4XXDB 1U8KB 2AI0H 4M4PA 3MRLA 1KXTB 2XPGA 1X5AA 1YNKH 1HXYB 2VH5L 4NO3B 2R2HA 3NOIA 3TLRA 8FABA 5ISZD 2FLRT 3G6JB 3PWNB 5D9SA 2OTPA 3QIBD 5HJ3A 3VGAB 4Q9QL 1ZVSB 5DD6A 1UWEH 3NIFE 4YXHL 2Z35B 2Y06H 4WDIB 5FECA 3I6GA 1OP9A 1CDJA 4RISH 5E6IB 1S3KH 5F1IB 1SJEB 1FE8H 3UAJC 3K46A 3G6AA 1RJYA 1YEKL 4IOIB 4OV5A 1JF5A 1JHKL 3UYPA 1PEZA 1T04A 3OF6D 5L7XL 1FYTB 4XNUH 3ORJA 2AK1H 1WWBX 4XH2B 2M26A 4PJGE 3PNWA 3F7RA 1NEZA 5D70H 2C7UA 1SY6H 1E0OB 2X09A 3SE8L 5DMIL 3D9AH 3WFBH 2RCSL 1KFAH 2KH2B 4YK4B 4UV7H 2PXYC 5FGCE 1K8IA 3MBXL 4XP1H 2BHYA 3MCG1 4XVSH 2R2CA 3ZT6A 4IMKC 4LCWD 2VO5A 3VXPA 1S9KC 4LLYB 4JO3H 1G84A 1OB1B 4O2EB 2A0LC 5I73C 1Q9LA 1U3HB 4OV6F 3VXQB 2V9TA 4QRRB 3HFML 3MGTA 4CN1A 5DWUH 1HZHL 1OAXL 4P5TA 4LHQB 5GRJL 1A9BA 3SDCD 2AK4B 1AC0A 1FZKA 4LEXH 3KPRE 1YMHB 1TPXC 3WMSA 2A77H 4OD1H 1MLBA 1BFOB 3KPLA 4XVTL 1IAIL 1AXTL 5F9JB 4XMLL 4U1GC 1FG9C 3E6HB 3PP4H 5HGDA 1EVTC 3D25A 4X99A 3BHBB 1CWVA 1CLZL 4PTTB 1TJIH 4UOW0 4EZMA 5DDHA 5KS9E 1JNHA 2WNGA 3MCKA 4PUBH 5ESAB 5F97E 1ZANL 2WUBH 2J6EH 2LVCA 4OI9A 5EBWA 3O41B 5AZ2L 3SBWC 2MTPA 4GLRH 1EDQA 1X44A 4AEEA 1O7VA 2HLFC 5IR1A 1YC8A 4MJ5A 4QKXB 4Z7NE 1IT9H 5DFVC 3EFFB 4HZAA 2PW1B 3Q3GB 1LEGA 3CIQA 3LEXB 2MPAH 2FEDC 3MRKA 3F8UB 1HKFA 5FYLL 2YWZA 4JG1H 2KQMA 4NO0B 4H25B 2FZ3A 5BS0D 1A6VL 1I7ZB 3LY6A 3QA3B 1WIUA 1G6RL 3I3EA 5C7XL 3IVKB 1G6RA 3NCCB 1JZ7A 4MXWH 5CJQL 4UIKL 2PCPB 2VOTA 1K6QH 4P3DB 4P49A 4U05A 1UM6H 5DC0A 4NQSB 3B5TA 1BWWA 4M6OL 2GHWB 3V4VH 5T5FL 4AIZA 2NZ9C 5E1HB 4XTRC 1AXSB 2A6JA 3QFDB 2E7BA 4FZ8H 4MCZA 3PHSA 2AGJH 4HEME 4I3SH 4JY6B 3D48R 4CJ1A 5D93B 1CXFA 1NDGB 5AAMA 1KBGH 1ERNA 4LLQB 3C09B 1P4IH 4GG6A 1JHTA 1MI5B 3U0WL 5SWZA 4CDHA 4OUOA 5CSBA 4Z0BL 5E00B 4N90E 2FATH 3V8OA 5D1QC 4O2CA 2AV7A 2P7TA 3GGWB 4I48A 4HMDA 4Z7VF 3RL1A 2QSQA 2NPLX 4RGOL 5E99L 3MRDA 1MFEL 2FYYA 4XBPB 4RGNC 3FCTB 4U6YB 4ACPA 2XACC 2JCCE 2GK0B 3P11L 4R4FH 4LKXA 1NCCH 2FX7L 5C07A 3IAGC 3G9VA 1CE1L 3V95A 2DLFL 4YHLH 3BP6B 4LLMA 2XZAH 5F7LB 1KCKA 2BVYA 3EO9H 4Y4FB 5CKGA 5KW9L 2PUQT 1KB9J 5INCB 1CDIA 1QQDB 2IC2A 2QQKH 1DBAH 5I17B 4M1GL 3EAKA 4HK3N 4OF8A 2VN4A 1Q94A 4X83A 3VG9C 2D4FA 3ZDZF 4QXTA 3TZVC 3O8XC 3NAAL 3H9SB 4YXLH 1SEBB 1FLTX 2CUIA 5EOTA 3EDDA 3GI8L 2R0WL 1Z5LB 1IEBA 2VLRE 4OGAD 4XAWH 1HDMB 4HGWA 4P5TD 1VACB 3FO9A 4P2YA 2FHCA 4XWOD 1I9JH 1AGEA 3PP3K 5EU6A 2X4TB 3CFIC 5C0JA 4M8QA 4Y4KB 4I0KA 2H32A 4YNYA 3TIDA 3MYZA 5DJXB 3X12A 4ZS7L 4X9BA 1HH9A 2ICES 3LQMA 3GJEA 3BQUA 1QR4A 4QLRA 5DK2A 4O4YH 1NANI 1L9NA 4JHWL 5JOFB 5KVGL 1YYMH 2OQJA 3KPSE 5AWNH 1T22A 3MJ8A 5B38A 1D6VL 4TULH 2F19H 4MDIA 1T5XB 4P57B 3QJFB 1MFNA 1UJ3B 1U91B 4X9GA 3UBXB 5T1DL 5LGKA 5GPRA 5I74B 4I2XE 5IV2A 1RVFH 3MLXL 4XP6H 3OJVC 2OSLB 3DTXB 4H26A 5D2LA 1QTYT 5GISH 2ICEB 1B9ZA 3CFKA 5FYLD 2HT4C 2Y5TB 1T2JA 3ETBF 3DUUB 1XGUA 4YHKH 4OZ4B 2A9ML 5IKCA 3LOWA 1X4ZA 3FB5A 3ECBB 3EOYG 4DN4H 1DE4B 5BVPL 4BSWA 3QEGL 1NUNB 1UWGL 1IAOA 5HHMD 2BNUB 5IB4A 4P23B 5E8DH 2NNAA 2H3NA 1DBKH 4PJGA 3KVQA 1LE5A 1CD8A 5L2KE 1L6ZA 2DLEA 1XGPA 5D7JA 4PRIE 35C8L 5CEXB 1LMKA 1R5IB 4WW2B 4M6NL 4KTEL 5IOPB 2YSSB 5KVDL 2PYFB 1XF2A 2BRRL 1BBJB 3U2SA 3UMTA 4DGYL 5SWZD 3W5NA 3EYVA 3MRIB 1PZ5A 2V7HB 4MJIE 3T1FB 3QQ9C 3O0RL 3VGDA 1MCKA 1LILA 2X4QB 3L1OL 3VI4F 2ADJB 1S9VA 3T04D 2I9LB 3RWCA 1N4XH 5GRZA 5MEOA 5L8LB 3S4SG 1SMAA 3ES6A 4RAVB 4DAGH 4GW1B 3BO8B 3Q0HA 4XX1E 3U4BL 5I16A 3P30H 5C07D 4ZXBC 1N3NA 1FNAA 5I1AA 4Y4HC 1IGMH 3KG5A 4FFYL 5DQJB 4GW5A 4CNIB 4KMQA 1W8NA 4EDWL 3OXSA 3T77B 1NMAL 1FFNB 4ZNCD 4KJWC 1KTLB 1WISA 4Y16B 2GJ6E 5EU5B 5KS9A 5FCUH 4HQQL 1I75A 1QLRB 1KUMA 1WEJH 1R3LA 3WN5B 4P4KB 3I6KA 2YZ1A 2R4SL 4RA3A 3O6ML 4U1JA 5A2LH 1TETH 5EU6D 2AJZB 1UB6A 4H0GA 4UAOC 4ZFOB 1RIVL 5LBSL 5I1HL 5EPMA 3T3PE 1C5DA 1LP9F 1GZPA 4N0UB 4A6YH 2ORBH 1NAKH 3BQUD 4G3YH 5LG1A 4UT6L 2OI9B 1FC1A 1FCGA 1KCSH 4PJDE 3K2MC 4ONHB 2H6PB 2IF7A 3MFFA 2CLRB 3QUMB 3KDMB 3S5LG 2AERT 4C54A 1MHEB 5C0GB 5TJWK 5IFHH 5FHBL 5J9PB 5DD3L 3VRJA 4Q2ZA 1M7DA 2Q8BH 1JWSB 3IF1A 5FGRA 3QWRA 4HD9A 3BE1L 3MV9E 1IMHC 1HHJB 4JJ5B 1Y0LB 1KJMA 1WV7T 4GAFB 3H3PL 4ZQKB 1IGYB 4DK3A 3U0PA 4HS8L 5J1TC 1EZVX 1F11B 2A6DA 2SEBB 2R4RH 2DDQH 1AXIB 3VXRB 1KPRA 4Y5YB 3B2VH 3SQOH 4R4BA 1EFXD 3U4EA 4S11A 3VFTA 1CFBA 3L3JA 4PY7B 2XFXA 4NRYB 2DAVA 3VG0L 1CG9B 4GQ9L 3W11D 3LKPA 4R26H 2FB4L 2K1MA 4ZYKB 1RIHH 1HHGA 4PJ9C 4KVNH 4KJYA 3ZE1E 2NR6C 3CDCA 2N7BA 4KKNA 2ZJSL 4QO1A 2DQTH 1IQDB 2Q86A 5CZVL 2BVTA 1P7QA 5D7JD 3RGVA 1SYSB 5CBAA 8CGTA 1YMMB 1A1OB 1T89C 1N0XH 1WC7A 4RSVA 3UTZB 3VRLE 3VXMB 2P5WA 1I1YA 5J06A 1PX3A 1DDHA 1AJ7L 2PTUA 2BDNH 1SYVB 3MXWL 3TC9A 3UDWA 3V4UH 5MENB 1VFAA 4B7LA 3MLZL 4PLJD 1CIDA 3L3HB 1E4KA 1BECA 3K2UL 5MEPB 3MA9L 1KC5H 5E6IC 3S4SA 4YPGB 2CDEB 2Y36H 4JCLA 3WHXA 4ELMB 4Q6IB 3NIGE 4GH7B 1E28B 2P44B 4F58L 1F58L 3RPIB 1ZV5A 5H94A 4J3XA 2RBLA 4ZO7A 5A3ID 4PJ5B 2DN7A 4DCQA 3RVVD 2AJVH 3P4NB 5L88H 4MJ4A 4YK4C 3MLRH 2NXYB 4KXZH 4ONGH 5C0AA 5HPOA 4JPIA 3RL2B 4M7JH 3I50L 3N85H 4URTB 4PJXB 1HI6B 4C4KT 1NGPL 4LP4A 4HUVB 3S36L 2I60L 3VWKA 5ICZB 1U3HC 1B2WH 3WLWC 3C9NA 3MOBL 1CYGA 2EKJA 4K8RH 2Y07H 4D9QE 1FN4B 3H42L 1T21B 2YPVL 3R06B 2XKSA 3K74B 3SDXA 1S5HB 1HQRB 1KIPA 4NZRH 4MD4B 1SM3L 3O2DL 4U6XB 3TJHC 3O2DA 4YO0A 1ZT4B 3MRQB 5DEFA 5BQ7A 5A43C 2G75B 3TBVA 3MV8B 1U58A 1FBIH 4LCCB 1T6WA 4TN9A 5F88A 5DYOA 2IH3B 2VUYA 4JKPH 4HFWA 3W5MA 5E95B 5HD8C 1V3JA 4DK6A 1JPSH 4M48H 2HT2C 3GI9H 3QWRD 4WEBL 1IEHA 4H20H 3GSUA 4ZTOH 3S96A 2P43B 3LEVL 1EJOH 1NCWH 2BVOA 4C83A 4OI7A 3NCJL 4MNQE 1CXEA 1FGVL 1I7TA 3UJJL 2GCYA 3TM6A 4FQJL 4H8WH 2H41A 3B5GA 1S7SA 3CGTA 4PRIA 5I1EL 3IJHA 4KKAC 3UPCA 1ZLUH 2DQCL 3BT2L 3MGAA 3SGKA 5K93A 1U8HA 2C4XA 3D2UA 3F12B 3M8OH 4MJIA 2V6HA 2L0DA 3SQBA 4FP8L 1G7MB 4P9HL 4KK6C 1X9QA 3VMNA 5GGVL 4UMGA 1WLHA 4M43L 4JZNB 2EYRA 3K8LA 4OFPA 5DGRA 4LLWA 5B8CA 2R39A 5ALBH 1KJ2B 3C8KA 2C3HA 5F89A 4NZUL 3D87B 1J05A 1BLNA 3A6OA 1P7QD 5IWLC 3RGVD 4M7KH 1J5OH 2P48B 4K7PX 2NW2B 4Y5VA 2OTWA 5ID1B 1XGYH 3L3KA 4UIMA 3MRMA 2XWBB 2P5WD 2ZNWA 4JQVA 5D93C 3HNVL 1D5BB 5J1AA 4J6RL 5C6TH 3C09C 3REWB 2NY6D 2ZCLH 4FQLH 3UJTL 2WWMD 3N0PB 3JWOC 4QHKI 3CDGA 1S78D 3AS2A 5CMAA 1C7SA 4NKIL 2VDLL 3SKMB 2J3SA 4OKVB 5DD0L 3QIWB 4H88L 1FCCA 2W0PA 4NDMA 3ULVC 2WP3T 1R24B 2BNRB 3QHFH 5IMKA 3L6FB 3F7PC 5I66B 2EXWD 1ETZA 4DGIH 4PJ7B 3HHRB 4J7RA 2IG2L 4OCYH 4Y4FC 3QPXL 3W39B 2F5AH 1YN7B 4PJDA 1U8JA 5C0AD 1H15A 1KB5B 1UJTA 5E5MA 4E41E 2YN5A 2C26A 4Z7VE 4LASL 4R7NB 4K94H 3VWKD 2I24N 1D5ZB 3NACH 3WDHA 2ATPA 2BY1A 2GT9B 4QHKJ 2GFBB 2YK1H 4UDUA 3GHBH 3MV9A 2AV1A 3IFNL 2IH1A 4MSWA 4Y4KC 3HKFA 3O9WA 3WXWH 2G60H 2CR3A 4AEHH 4YDJB 3P73B 1T0NA 3QAZB 4AG4L 1NCAH 4Y2DA 2F8OA 1I8KA 1ZS8B 2E8ZA 4I9WE 4CUCA 5J3HC 3PQYA 5IJVA 3WLBB 3QO0A 3C8DA 3MXVH 1RK0B 2YEZA 5HDQH 1A6ZB 1YJDC 3V9FA 2WIIA 3MLUH 4WWID 4FOMA 2O93L 1IM3A 4OKDA 1UJ3C 1KIRB 5E2TL 4BQCA 1T03H 4Z95H 4YQXH 3REVA 3KNBA 4U1SA 2P46B 5I74C 3NCFB 3WFDH 1A1NA 2JK5B 4XCCL 1Q0YH 3MRGA 3A0OA 3BD5A 5L2JA 3WS3B 1J1PH 4WU7B 4L5FH 4ODVH 4PRID 4NPYB 2V2TB 4QWWD 1NC2A 1NAMH 3GMRA 4X7CC 1U8IB 4Q0XL 1JPGA 4MWFB 3D2UD 1I9IH 4PJIE 2QHRL 4MJID 5CLTA 1UCBL 2VLME 4JPVL 1TENA 5EO9B 1CLYL 2AABL 2APWA 1ROWA 1UXSB 1BOGB 1DN0B 2W9LA 1CD1B 3IU3B 5JW4M 5GRYA 2GTWB 2XXCB 3T0WA 5FM4A 2W38A 4P23C 4N0YH 4HHAB 3MRBB 3MRNB 2J2ZA 3T0DA 4EIZC 2VXUL 2A6KA 5CSZB 2EEAA 3GSWB 2HP4A 3SDDA 1PSKH 3IFPB 1C12A 4FHBD 2ITCA 4WW2C 2KUTA 2LVEA 1FDLL 1N6QH 5EB9A 4I13B 4UQ2A 3DBXB 4LPYA 1W72L 1Q1JH 1W72A 1ZT7A 4FQHB 2UV3A 2BY0A 4XP4L 4YHML 1DSFH 1ZKAA 1MY5A 1U8OA 5ILTL 3FFDB 1UXWA 3CFCH 2WBKA 2VAAB 4HJGB 5I8OH 5GS1C 5IM7A 1HIMH 4YHZL 1BD2A 5GZOC 1S7UA 4YC2B 2CO6B 2H8PB 3CVIL 3IDUA 4B7IA 3LKSA 3IGAA 2YPKA 3FT3B 4P2CG 4D8PA 4XNXL 1W0WA 3P0GB 5K33A 1LEKA 4GAYA 1P69B 1OAYH 3VI4E 4Y16C 1MIML 3IFOA 1NBYB 4YFDB 3WN5C 3MRJA 4P4KC 4EI6B 2W59A 4GRWE 2ZG1A 3R4DA 5ANMB 1FL3B 3WUZA 4JG0H 4NYLA 1OCWH 2XTJB 3MV9D 3TVMA 1F90H 3BEWA 3GK8H 2ZUQB 4OIAA 5L8KB 2IBGA 4MNQA 3O9WD 4X7TB 1GGUA 5EOCL 4QCIA 4P46A 1T0MB 1UA6H 4U1KA 4F7TA 3X17A 4O9HL 4Y2DD 1HQ4A 5KSBE 4BKLB 5HYQB 3PQYD 3VFNA 2OI9C 3ULUE 1AGDB 1HHIB 2EDOA 2HT3D 1DQLL 1AHWA 4XNQB 3Q2CA 2G9HA 4IOFD 4CMMA 5DI8A 5D1XB 3WFCH 4KKLC 4ZPVA 2FD6L 2ZSWB 5DA4A 1BQHA 3PGFL 4YHPA 3X3FL 3W9DA 4AEIH 1RURH 4XGZB 4WI3A 4JQIH 3RTQB 1NANH 4WTZG 5BVJA 1AP2B 2E7LA 1EEUA 3H7BB 5JDJA 4LSTH 1TNNA 3NBNA 1FH5L 2GYSA 2BSRB 1DQDH 3HR5A 3GBML 3ARFA 4XCFH 1NC2D 4Y5YC 4M7LT 4XBEH 3HNTH 3HC3L 3QNZA 1FVDA 2FEEL 4Q9RH 2VNCA 1MHCB 2CO7B 2Q6WA 1ZGLB 3FN0L 5I1IH 4GXUN 1DBMH 2DLIA 3VRIA 5EORH 3O3BB 5I18L 4P48A 3PP3H 4Z7OF 5DEGA 3CLEL 1KPUB 4RMQA 4NC0B 1UYWH 3MROB 4TQEL 2NY0D 4S10A 2ATKA 1FHGA 2E27H 3I9GL 5KVFL 5E2WH 3SDDD 2DB8A 1DQQB 4YIQA 4MXVF 3QNXA 4ZFFA 1NGXA 1TZHA 1AI1H 1INDH 3TO4B 3LPGA 1MPAL 1ND0A 1SJXA 4LQFL 1PFCA 1UZ8A 1GGYA 4ZUUB 4MQ7B 3L95B 4E41A 1KNOA 4Z7VA 1RZ7L 3THMH 1WT5C 3OR7A 1C08B 4X4XB 4U2ZA 2NY7H 1KELL 2X7LA 4EUPA 3F5WA 3HAEB 1J87A 3OGCB 2P24B 4D9QD 3ARRA 5HHQA 1QLFA 3P9LB 3LHPH 2BERA 1BD2D 1WFTA 4LGSB 3UZVB 3DX6A 4IHOB 4Q6IC 3ZTNL 4U3HA 4NNYA 2ADIA 2A1WH 4EOWH 3OX8A 1O0VA 5DUMH 2Q20A 4LNRA 4DZ8B 3QNYB 5I19L 5DQ9B 5GZND 3BYTA 2ADFL 4UU9B 3QIBB 2NXYC 2D0HA 1FZJA 5FUOL 4HUKB 3PDOA 3RJDA 5CJ8A 4JZOB 1NJ9B 1QNZH 1D6EB 4X5XB 5EOQL 4U1IA 5I1JH 3TVMD 1RZFL 3JTSA 3U30B 2G2RB 5GIRB 5BV7B 5F7KC 2E9BA 2QQQA 4MNQD 4HIEB 12E8L 4P46D 1XIWB 4WFFE 5LQBH 2GW5A 2R1XB 3CC5B 1EHLL 2JTDA 4PIRF 4IM8A 1BOYA 2YUXA 3EJJX 3IFLH 1KJVB 3V5HB 3ZTJH 4P9ML 2NW3B 1INEH 3SKNA 2P8PB 2PW2B 1B4JL 3EYFB 3RDTA 5LKNA 4ONFL 4LCWB 4L4VE 1EZVY 4LCCC 1KCUL 3FQUB 1RZJH 5DF0A 1CR9H 3TA3B 3V6OC 1UCTA 1KCRL 1F8TL 1OM3H 4Z7UE 2YKLH 4X80H 5ERWB 3Q5OA 4IIQA 1MFDH 4PR5A 1NFKA 1WCQA 3LCYA 2H2SC 5HI5D 3GSOB 2K7QA 5ICYA 3ULVF 3GNMH 2PR4H 4YBQC 3WUWG 3ARFD 4OQ1A 1A47A 3VFMB 4KQ3L 4BSVB 4XNZC 3RBSA 4C57C 1F00I 1WWCA 3RU8L 2QKIA 3S3SA 4XC1L 4R96B 1F3RB 2VZTA 2J4WL 3DURB 3PWJA 5DFTA 1AGBA 4KY1L 1GSMA 3PHQA 4ZS6C 3TGXA 2MCG1 3QPQD 5HDLA 4RGNE 5E2VH 1JGEB 1H3TA 5CZXD 4YGVB 1OW0C 2X10A 2AQ3A 1A6WH 1UZ6F 5IEHA 1LO5B 3EJYC 3FQWB 3IDGA 1X5JA 2IJ0C 4C56B 1B4RA 3CJJA 1KJ3H 4KQ4H 4WHCA 2V2XA 4HKZA 2IGFH 4ZTPL 1UH4A 3L7EB 3MREA 2IPKB 1BWMA 3DXAE 5BS0B 5FCSH 4ENED 1K4DB 4JB9H 5FA4B 3KR3H 2FO4A 2BY2A 4E41D 1X5ZA 3CLFL 2VXVL 2XZQH 4X7DC 4KK8C 3UP1A 1GL4B 5F3BB 1A7OL 3LIZH 1U95A 2DQHH 4OLWL 4HPOL 4NBYB 1MWAH 3OGOE 3GIZH 4ORGB 1OLZA 4RFEA 4OZFB 1J1OH 2DQIH 4LSRH 4NQCE 1YEFL 4WFHE 3CMGA 1DLFH 4KAQH 5T1LA 5TQ0L 3T4YA 3QIWC 2KDGA 1QSVA 5JMRA 1NGQL 2AQ1A 4YE4L 3O6LL 8FABB 5KSBA 5HJ3B 4ZNEE 3ULUL 4YDVA 2HVJA 1NCTA 4F7PA 3UYRH 3KPOA 1DVFA 1PGRB 3T4AB 2BRQA 1FL5A 4D3CL 2DL2A 1C5BH 1XMWA 2Z92A 3HB3C 4OCWH 4GW4A 4YHNA 1GCFA 3G6AB 1U8LA 1RJYB 3WNOA 4H5SA 1T04B 3Q6FA 1FFPA 4UOJA 3UTOA 4RIRA 1F4YH 3FQTA 3MJ7B 5EU3A 4GKZB 2F74A 5EN2A 1LP9A 1NEZB 5EUKA 2C7UB 3KJ6L 5DZLA 5FA3A 1RMFH 3QCTH 4ZFGL 2VISA 3GB7A 3QXAA 1T1YA 1UACL 4I5BA 1KEGH 2IFGA 1T7WA 1K8IB 3QAZC 1Z9MA 4WW2F 5HHPA 3ARWA 1NSNL 5GSVB 1DANT 2V5RA 4K3HA 3BWAA 4Y19E 4RRPA 2WWKO 3GMLA 3RDTD 4KI1A 3VXPB 3UROR 1XCQA 1YY9C 2VLMD 5I2IA 2XWJA 4HJ0C 1Q9LB 5EG6C 1OVZA 3EOBA 4CMHB 2YUVA 4ODXB 5IJKC 3MGTB 3ZL4H 3QCUH 1MELA 2YD7A 4MVBD 3ZKQD 1NGYA 3WO4B 3FO0L 2JB5H 4P5TB 4KKCC 1CVRA 3IKKA 3ZZ1A 1Q72L 4LCIL 4DN3H 1ES0A 1FZKB 4AJ0A 1T7YA 1G7HA 2L7JA 3WUWA 4DEPB 1AO7B 2HMIC 4NKOA 4DZBA 1VEMA 3SJVE 5HGDB 2EICA 3D25B 1M71A 4NC2B 4X99B 2Q7NA 4GXVL 4ORZC 1TTFA 3STZB 4YHIA 1CFSA 1UQSA 5DDHB 4IMKA 4I4WB 5GHWH 4ODWA 3MCKB 5EBWB 1IAMA 4JN1L 4K7PY 3DX7A 1U3ZA 5IB2A 4KROB 3FQNA 2B7DT 3QB7C 5CEZH 2CMRL 4HWNA 5ITBH 5IR1B 4OF6A 4LEOA 4MJ5B 2R8SH 2DI8A 4QYOA 4LMQE 1LEGB 2BFVL 3B9AA 4OCNC 2Y7QA 1ZVHA 1A7NH 5A40E 3K7UA 2YD4A 3MRKB 4W4NA 3S9DB 4AENA 5FAAA 3C5JA 2Y9RT 4GMTL 1G6RB 3WD5L 4GRLA 2W92A 4KV5F 4KUZH 3HI6L 3LPWA 5C0CE 1V5JA 4UBDC 3U48A 4E42A 1I1RA 1WBXA 1RK1B 4QRPB 1JNNH 2ZUUA 5CIPA 2YD9A 3PIQB 1QPPA 1YUHA 4OIIL 5HHMB 1S7VA 5GQBA 2VLKE 1JFQH 4S0TD 4MCZB 5KTEL 5DD5L 3AGVA 5DMGD 3ARQA 2EDTA 2FECI 2B8OT 2OJZH 1JV5B 3PABA 4YC2C 3ZYZA 2L7UA 3KYKL 5LWYL 4Z7WB 2ITDA 3OKOB 2HYMA 3ULUD 3D3VA 3SDAA 4MXQD 1F3JA 4GG6B 1JHTB 1DVFD 4UQ3B 4X5WB 4YUEL 1QBML 4QRTA 5SWZB 2VLLA 5EZJA 4O2CB 2AV7B 2P7TB 2G5BA 4I48B 3IJSA 3RL1B 2E6JA 1C16B 1CBVL 4NO5A 1RUPL 3RGHA 2FYYB 2FJGA 3LKOB 2XTJC 2FL5A 3P4MB 3QUZA 4OCXH 3W9EA 1CTOA 5I6XC 2ZUQC 2J88H 5F93C 5C07B 2ZOLA 5IUSA 1QLEH 4WEMB 4LRNL 3D39E 1JNJA 1FNGA 2JELH 1ZGLM 1JNLL 4LLMB 2B39A 1RJZA 5ACZA 3LS4L 1S9XA 3BDYL 3FFCE 1JZ6A 1MY7A 5K9OA 3MV01 1VFOA 2WMPA 1Q94B 4JKWA 4QXTB 3IS1X 5BW7A 3BJLA 4K23H 5D1QA 5EOTB 3K3QA 2HTKC 2R29H 1CD0A 4M1DL 1WBZA 3MX0A 3L5WA 5HHVL 1R0AL 1MJ8H 1IEBB 5IFAL 5D1XC 3KJ4C 4M03A 6FABH 2FX8L 4HGWB 3FO9B 5FDYA 1AGEB 5KOMC 3TNNB 2W65A 3SGEI 5EU6B 4JAMA 3BGAA 5E7FA 4M8QB 4CKVX 1NLDL 4UTBL 2ZUVA 2FJFA 3RTQC 4YNYB 4ELMF 3X12B 2X4UA 3BH8A 5ELIA 3SN6N 5CKAA 1HH9B 4YDLB 1T83A 3GJEB 4TRPL 2CPCA 4HUWA 3BQUB 4PV8A 4K3JL 5JTWA 2X89A 1BREA 1MAMH 1RUMH 1S9YA 2WLYA 5DK2B 4DVRH 3GSNL 4IMLA 2DQGL 3DXAA 3W2DL 3GSNA 3O8XA 1G7PA 2OQJB 4R7DA 2XNAA 5LCVH 1P1ZA 4OFVA 4M8VA 5B38B 4MDIB 2H1PH 3NABL 4G6FD 4AQOA 1ZK9A 1OARH 1TLKA 4MS8C 5HVGB 3P40A 4PJXF 4KZDH 2XIDA 2F58L 4MGXA 5IROA 1LE9A 25C8H 5IV2B 5H35A 3SKJH 3LRGA 2FX9L 3BSZH 4Y2OA 4NQCA 3WIIL 1XZ0B 5GJSH 1FO0L 3QDJE 5F7EL 5D2LB 1FO0A 2CRZA 1NLBH 1QFUL 2A9NL 4GUPA 3CFKB 2FLBT 4YH6A 4CGTA 4IOSD 1Q9KA 1XGUB 3VH8G 3K1KC 4K07A 1MHPH 5IKCB 3F7YA 4NP4H 4GRLD 5CILH 3TO4C 5KN5B 4HH8A 1EFXB 3O11B 1JRHI 2ED7A 3LZFH 5IVXE 3FB5B 4J3TA 4JFXA 1C5CL 4CVZA 3CVHH 4F7CA 3K8MA 4HWBH 4QRRE 5IB4B 2DBJA 2NNAB 2EYSA 2YD6A 1GHFL 3SOBL 4PJGB 3RWIB 2FEDD 4QHNA 4V2BA 1OPGL 3IAQA 4MXVE 4M93B 2Z9TA 5IEKA 4WFFD 5B4MC 3QDMA 4PRAA 2EDKA 2J1KA 5MP6L 5HHOA 3D3VD 3SDAD 1XF2B 1FP5A 4WO4B 5FGCB 3U2SB 3K8KA 2D3VA 4Y19A 1KACB 5J7CC 5AZEL 3QIBC 5C8JA 1PZ5B 4TOYL 1BP3B 4TSAH 2DM2A 5E94A 4XMPL 1CGSH 1S9VB 4KUCF 4ZDHA 1LDPH 4P3CH 3RWCB 3L3DA 1OD9A 4BQ8A 5MEOB 4Z76A 3BPLB 1VPOH 4NJ9H 3FB7A 3PE9A 2OL3L 3ES6B 3QUZD 1JN6B 2OL3A 1H5BA 4OGYH 1PD6A 3U30C 4I77L 1UG9A 5BV7C 2OZ4H 5I16B 4XHJD 5D7SH 1N3NB 4ZOEA 1ZHLB 3KPRB 3ZDYE 1YECL 1XIWC 3MNWA 5CLWA 5L9DH 4GW5B 2VABB 5HGBA 5DC9B 3EYSL 1ZE3C 1BM3H 3OXSB 4XXCA 3D18A 5D72H 1N64L 3FTGB 5D1QD 5KS9B 2N7AA 4HIXL 5LXGH 1R3LB 1IGJB 1MCEA 5JQ6H 3I6KB 1F6FB 3NMEA 4U1JB 4RGND 1CF8L 2XZCL 2X05A 4ZSOB 1OF2B 3OAUL 2Z4QA 3TA3C 3EO0A 3P0YL 4ZXBA 5EZIL 1UB6B 4Y4HA 2XWTA 2EYTB 5FF6A 1M05B 5EPMB 2CIIA 4BH8A 5F6HI 1GZPB 5JW4Q 1KENL 4OLVL 2C4FT 2UZIL 4NJAH 3WHE0 3F7VA 3DXAD 3MFFB 1GH7A 3O8XD 4I18B 4PGBB 5C2BL 1MJJA 5FB8A 4NM8L 4Q9QH 2ILLA 4A2MA 3DROA 4ZUVA 4Q9CA 5C0CA 2ZCHL 3VRJB 3Q5YA 4O02L 4M5ZL 3IF1B 4H0HB 3WYRA 1YEEL 1FQ9C 4NQCD 4WFHD 3ULVE 2FO1A 5EC2A 3GM8A 1GC1C 4OD2A 3FB6A 3TJEL 2A6DB 2EE6A 2ERJB 3A67L 3QWOA 3SE8H 5GJTL 1KPRB 2NTSP 5DMIH 1G1YA 1GAFL 5JXAH 4KPHH 4Q6YA 4R4BB 3QUXC 1I8MA 3L3JB 2XFXB 3JVGA 4WCYL 1MCFA 3K0WA 4QTHB 5GGUA 3LKPB 5DQDL 4BA8A 2FWOA 4JO4L 4OSUL 4JFQA 4KJYB 1UZ6E 3R8BB 4AQ1B 3HMXH 3V5DA 3A6BL 1E4XI 4NKDB 2FBJH 5GRJH 2JCCB 2Q86B 5KSVB 3DJ9A 2HT4D 5L6YL 3X11A 1P7QB 5CBAB 3QDMD 5IBTL 3OR6A 3GHEH 1G9MH 3ARGB 3NVQA 3GM0A 4XVTH 1YNTA 5ECJE 1HOCA 3TIEB 1VKXA 4XMKL 1JMZA 4Y19D 3FFCA 1I1YB 1BQSA 4KMTH 1YN6A 4FXKA 4X6BA 4N9OB 2E7CA 4N8PA 3PV6A 2NY6B 5DJ0A 1PQZB 4DUVA 2VLJE 2VLRB 1IAIM 5HBBA 3BP5A 3WHXB 1BVKA 5CUSL 5F1SA 4XXDA 1T89A 3KYNA 4XT1C 3EOTL 1FNSL 3N06B 5DEZA 4JFYA 3O81A 4DCQB 4NO3A 3TYFA 1R5WB 2DQEH 4LBEA 3IDXH 4KRPC 1YYLL 4TVPH 5B3NA 3ZHDA 3QQ9D 5FO8A 1JZ3A 3V4PH 4BK5A 4JPIB 4S1SL 1ACZA 1I8LC 1ZVSA 1C1EH 5C7XH 5FO7A 4ZD3L 3RWHB 2Z35A 3KPSB 4WDIA 3QHTC 5JHDE 2Z8SA 3CZFB 4LHUA 3EDEA 4CMHC 3VD5A 2AXHA 4S2SA 4RNRA 3QEUA 3C2AH 4ZXBD 4I2XB 4OGAC 5C3TA 4Y4HD 4LK4A 4P5TC 4GS7C 1QUNA 2D7PA 2QSCH 3QDJA 1JJUA 1KTDB 2R2EA 4DEPC 3BFOA 5F8QC 3VWJB 5I1LB 1KIPB 4KJWD 2VXQL 1CDYA 5DEFB 2FNBA 3RWFB 3PL6A 1A5FL 5BQ7B 3TBVB 1U58B 4ODTH 4MZ2A 1CZ8H 3EDFA 5F88B 5C0CD 5IVXA 5DYOB 1MCLA 1O7SA 4LLYA 2VZOA 4HFWB 3CK0H 5IHZB 3PG2A 4MMXC 4W4OA 1U3HA 3VXQA 1D5XA 4M7LL 3G5VA 4KROC 4QRRA 3GSUB 3S96B 2CSPA 2D9CA 4K8RC 2XOTA 1FVCB 2VKWA 2BVOB 4C83B 4POYA 2AK4A 5I71B 2C1PA 2GCYB 1H8SA 4JY5L 2RAMA 5JIPA 3BN3B 3EKCA 4JVPA 1S7SB 5L2KB 1EV2E 2I07A 4PRIB 1YQVH 5IMOB 3IJHB 2IBZX 4LARL 4UB0L 1MCIA 4XPFL 3C2SA 2B20A 4MJ2A 1OY3B 1U8HB 3QRFM 3G5XB 4R3SB 3D2UB 4BFIA 5F8RC 3EZJB 4MJIB 1YEIH 4OTXH 3VMOA 3H6JA 1QFPA 1S7TA 1MRCH 3GMMA 4PB0H 3UBXG 4LLWB 3KLHC 1MRFH 3C8KB 5F89B 1J05B 3EFFA 2PW1A 2ZUXA 3Q3GA 1XGQA 3LEXA 2B2XH 2MKLC 3D39D 4OLZH 4Y5VB 5IW3A 3L3KB 4UIMB 3GKWL 1CFVH 4H25A 3FFCD 4HV8A 3TF7C 4JO2L 1BEYL 2MCPL 5J1AB 1EO8H 1SBBA 1CDUA 1TITA 4RFNB 5BRZE 1YEGH 4NGHL 2GJ6B 2H2PD 3HZYB 1WBYA 4OB5L 2HJKB 4HLZG 4WWKB 4YEFA 4P3DA 2NR6D 4JEGB 4HFUL 4QRQA 1RULH 5IWLA 1AXSA 1NGZB 3V2AR 4NDMB 5I8EA 2MHAA 4OF7A 5KVMC 1DR9A 5FM8A 3VFUA 2COQA 1EMTH 1A6TB 1ETZB 4PRBB 1QFWI 1NDGA 4HT1H 3MOAH 4PJDB 1U8JB 4M6MH 4LLQA 1H15B 3OG6B 5IQ7L 4ERSL 3FMGL 1WITA 1K3IA 4LAQL 4KC3B 5E00A 1Q38A 2CK0L 2R9HC 4LHUD 4LSSH 4K2UL 5AEAA 2ATPB 5E6ZA 3SY0B 5EU7E 5FDWA 3T3ME 3ZO0A 3FO2A 4PB9H 4XBPA 4UDUB 2NLJA 3FCTA 3ULVL 2AV1B 1U8QA 3QDJD 4IRJA 4MSWB 3O9WB 1XR9A 1V3KA 3VXME 5HXMA 1T0NB 4LGRB 2D9QB 1BIIA 4UINL 1OSPH 4Y2DB 4YDLC 1I8KB 3CSYA 3PL6D 3RIAF 1BQLL 3BQUC 5ICXB 5IJVB 1OTUC 1ZEAL 2AQ2A 3QO0B 1CDBA 1RIUL 1UM4H 2VZ3A 1RZIA 4DGYH 2LAAA 5MENE 1L7TH 4HXBH 3GMQA 1RZ8B 3H9SA 2YEZB 1SEBA 1U3HD 1LNUA 4JFFE 3CDFA 3WLWD 2WIIB 4G6ML 3L3GA 4QRRD 3T2NH 1IM3B 1S9WB 1Z2KA 1FSKB 1HDMA 1VEOA 3REVB 3KNBB 5GGTL 2AK4D 5GGTA 4L8SA 1A1NB 2X4TA 5J12B 3O2WH 4Y4KA 3G5YA 2UY6A 3MRGB 5L2JB 1OL0A 4K3DL 1U8PA 4LU5H 1FZMA 2NY3D 3O4LE 4X7FC 1FIEA 1LO2L 5EUOE 4NUGH 1Y6NR 4PJFE 3FQXA 3GMRB 3RY4A 1R5VA 4NHCH 2XN9E 1JPGB 1PY9A 4LLVA 3ZE0F 2BSED 3S36X 1FPTH 3K4AA 1YJDL 3EGSA 1MCSA 3RWDA 1WF5A 3S98A 2MQ0A 3MLWL 4HIJB 4P57A 3QJFA 1U91A 3U7WH 3UBXA 2DJUA 3W11C 1MCBA 5EC1A 1KLFA 2ZUSA 5FKPA 3VCLB 4RWYL 1VFBA 4HS6A 1N6UA 3MTRA 3DTXA 1N5YL 2NY0B 3FB8A 1MRDL 1IGCL 2R69L 4M93C 1Q0XL 4POZC 1IFHH 3SDDB 2WUCH 5ENWB 1X7QB 2DI7A 3DUUA 1C12B 3CFBA 5F72S 4OZ4A 3ALXA 4JDTH 4WO4C 4AMKH 4UQ2B 3RNQB 3HPLA 4KJQD 2ICCA 4PGCA 5I1KL 2VUOA 4O2FA 5DT1L 3NTCH 4TSCL 3VW3L 3D0VA 1CDHA 4YXKL 1DE4A 5EBLB 2E9JA 5HYIA 1Q9WA 4PLJC 1U8OB 4LSQL 1YA5A 3AVEA 3QZWB 3D5OF 3BPLC 4X98A 4GFTB 5IM7B 1II4E 5E8EA 3EDJA 1S7UB 5CS7A 2EE3A 4KJPD 5CEXA 3QFJE 4WW2A 2Q3AA 2EDJA 5I9QC 2YSSA 1SQ2N 2PYFA 5A3IC 4FQQA 1BBJA 3RVVC 4D8PB 1F97A 1W0WB 3HZKA 1LEKB 2AEQL 4OZGE 3E2HB 4JFDE 3T1FA 4NFBA 3TT1L 1MFAL 3B3IA 1BX2A 1PY4A 3GMPA 3MRJB 2V5SA 5KSAA 3BEWB 3ULVD 3N1GC 5GS1A 4JVWA 4EEEA 4IRJD 4CVWA 2AS5M 2XXMB 1S8DB 1A02N 4MNQB 1KT2B 1T1ZA 3JV0A 1IC4H 4P46B 4QCIB 5JHLH 5IMLB 1EAPA 4U1KB 4F7TB 1HQ4B 2IALA 2HFEA 3VD3A 3WCYA 3VFNB 2CXGA 3IXTA 5E24E 5IT2L 1EIBA 1FFNA 1KTLA 3STLA 4I18C 3SGEH 3H9SD 2D7TH 5I75B 4WGVB 4CMMB 5DI8B 1AJ7H 4CADB 5E8OB 4ZPVB 3QRGH 3MC0A 5DMKA 4JO1L 4UILH 1BQHB 5HYFA 5JPMB 2BC4B 3W9DB 2Y23A 4Y4KD 2AJZA 5BVJB 1FIGH 3Q1SL 3QCVL 3ZMRA 4F58H 4N0UA 1KF9B 3D0LA 5GRUL 1FAKT 4FQCH 3HR5B 4NZTL 2AJUL 4ONOA 3HCVA 2YUWA 2ERJC 2X4NA 3ARFB 1A3RH 2HH0H 4K7PL 4PJHE 1CGWA 3LQAH 3IU4H 4OBRA 4HPYL 1ULVA 3QUML 3QNZB 4R9HA 5F71A 1FVDB 3QUMA 4G5ZL 1MCPH 4YHOH 5BRZA 2EIEA 3GBNH 1MHEA 2AJYL 2BVPB 2LABA 2XA8H 4X6CE 2Q6WB 5AYUH 5J9PA 3VRIB 3NFSH 5BJTB 5KJRL 3MV7E 2QQNL 1NGPH 1JWSA 5DEGB 1KLUA 1RFDH 4FMFA 4QTIL 4JJ5A 4ZQKA 4J4PA 2ATKB 1JRHH 5D71L 2KZ1B 4E5XA 4CN4A 3BVNA 2BOCA 4X5LA 4YIQB 2DYPB 3PV7A 2YD2A 3QNXB 4Y5YA 1VGKA 1NGXB 4RA0C 4ZFFB 3RX7A 3ARGC 1ND0B 4LDEB 2FGZA 1CK0H 3EYUL 1MREH 4OCRL 1UZ8B 4GAGL 4PY7A 1ADQH 2C3WA 2O5XL 3IDMB 4NRYA 4E41B 1KNOB 4Z7VB 2W9EH 2NY6C 3UDWC 4LIQL 3U4AA 5INDA 3OR7B 4ZYKA 2WWMC 1E4KC 4MAUL 2X7LB 5F1OB 1RJLA 5TFSL 4RZCB 5HHQB 3E6FA 5FHAH 4CL7A 1QLFB 4KU1A 4TYUA 2NYYC 2DLGA 5JR1L 4H0IA 3DHMA 4KWUA 1AH1A 2EE2A 5JO5B 4NNYB 1FGVH 5T33H 4LCYA 4C59B 1JPST 5IVNA 5F9OL 3VXMA 4IRZH 1BFVL 4TNWF 3RWEA 5FGSA 1KCLA 1E6JH 2EXWC 4UV4L 1E27B 1FZJB 3PDOB 5MENA 2KPNA 3DSNA 3EYOA 1BBDH 5MEPA 3TPUA 4FZEH 4HK3J 4U1IB 2Z93A 4YPGA 2CDEA 3JTSB 5GGVH 3KS0J 5KSAD 3V0WL 5I15H 2UVEA 4BSJA 2OS7A 4X6EB 3T0BA 3BIBX 4ODSL 2CGRL 3RPIA 4R90H 1JGLL 3O4LA 4YX2H 3VWJC 3R0MA 5EUOA 4BUHA 1A4KA 2DMKA 4Z7WF 1BZ9A 4FQIL 3BKCL 3KWWA 4PJIB 3V52L 1XGTB 1JTOA 3RDTB 4GG6F 2X9XA 3HNSL 1P4BH 5T3ZH 7FABH 1Z3GL 5ICZA 4XPAL 3N9GL 1J8HE 4LFHD 4QT5B 2OM5A 3WIHL 3WIHA 4IIQB 4JHAH 5DD0H 3R06A 4PR5B 1KG0A 1MFCL 3ME0A 3S3JA 5I71C 5ICYB 1JZ5A 4OLXL 2X42A 4JR9L 2WBJA 5MEQA 3RA7H 1RUKL 5KOVC 1ZT4A 2YPLE 4QWWC 5BRZD 3MV8A 4PY8J 2V17H 2R0LH 1RD6A 3PWJB 1CQYA 1YEDA 2UUDK 3MLYL 3Q5TA 3DYMA 5JQHC 3V6OA 4P9HC 3T0XA 1JPTL 2VXTL 4QHLA 3ARVA 4G8GE 2AW2A 4J4PD 5IEHB 5GS3A 5MI0B 3IDGB 3BESR 3RZCD 4FXLA 4OJFH 3ULSA 4Y5VC 3WNMA 4HKZB 3IETB 3QFJA 3MREB 3I84A 4JQVC 5MERA 2FO4B 2PYEE 2D31A 4RFNC 1E4XH 1QOKA 5DSCA 4NN5B 4ODHH 3UJIH 1G7MA 2APVA 4WWKC 2VXSH 1XCTA 4WTWA 4YDKH 4MA1B 3JXAA 4OQTH 2VKXA 4GRWB 3T65A 4QXGL 1IBGL 4OF3A 4RFEB 3RBGA 1OW0A 3AROA 5IESH 4IS6A 3W82A 2X5PA 5ETUA 1J0IA 4WFGE 3B9KA 3VXMD 5ID1A 3E8UH 3RAJH 1LO3H 2CKNA 5KSBB 1I3GL 2XWBA 5B39A 4BELD 2HVJB 4NCDA 4F7PB 4F80A 1OAZL 4YWGH 3U7AA 1HHKA 3TO2A 1DVFB 5MEND 4Y5XB 2Z92B 2DM7A 4JFFD 4P2QE 4GW4B 4YHNB 1G9NL 3NIFF 3NZHH 4JPVH 2B4CL 2MNUA 3SKMA 5GRVK 5EO0B 3FO1B 3Q6FB 5F1NA 1DTUA 3VXUE 3UPAA 4YFLI 4RIRB 3FQTB 2Z8RA 1Z9LA 3QIWA 3GSVA 2F74B 5HHXH 3MRPA 4O5LL 4U3CA 5EUKB 4Q97A 4G6AD 1C7TA 1R24A 1S5IH 1MVFA 4ZMAT 4LSVH 2DRUA 3O4LD 4PJGF 3O9WC 3L6FA 2VISB 2R2BA 3GB7B 1UKQA 2LU4A 2NXYD 5HHPB 1OAUL 4Y2DC 2MMXA 2XN9D 3BWAB 4XC3L 1OWRM 2X6MA 1FDLH 3DSFH 3TH4T 1U42A 3FOLA 1XCQB 3CSGA 3AM8A 5I2IB 2X9WA 2O5YL 2XQBH 4R7NA 1P5VA 3EOBB 3WKML 2JJTA 3MV7A 1LO4H 3MUGA 5HHNB 1AGFA 2IBZY 3VGEA 1TIUA 3BKYH 1NGYB 2GFBA 1FSKC 2APTA 2AI0L 4P4RB 5HSFA 2FR4A 4CU8A 1ES0B 4OUUB 4QXUH 1YNKL 5J12C 1G7HB 2BMKA 2WBJD 2DIJA 5HTSA 4PRDA 5CFHA 1ZXQA 1VFMA 1ZS8A 2ZOKA 4YHIB 1UWEL 1CFSB 4OF5A 3WLBA 2Y06L 1T7XA 4RISL 1TZGH 1Z9OA 3HUJF 1S3KL 2B0SH 4I0CC 1FE8L 3BGFB 4FXGB 5KS9F 4X8JA 1TZIA 3DX7B 3H0TB 1UFUA 2EDXA 3FQNB 2IMNA 4G6FB 4QRSA 1TJGH 4XNUL 2AK1L 1KIRA 3GZKA 5D70L 2H2SD 1SY6L 4Y1AE 1SY6A 2YA1A 1SVCP 3D9AL 2Y7QB 3WFBL 4F37K 2W1NA 1ZA6B 1KFAL 3WS3A 2DJSA 4UV7L 2NY0C 1E4WH 3QFJD 4XP1L 5J89A 2V2TA 3C5ZB 4XVSL 4AENB 4LVEA 3SDDC 3UZEA 1NMBH 1U8IA 2WAHA 4GRLB 3QH3A 4P5KA 1IQWH 4KUCD 1DLHA 4F9LC 2DD8H 4G9DA 4E42B 3DRTA 4N1HB 1WBXB 2EO1A 3HE7A 3SCMD 5DWUL 1UXSA 1BOGA 1A14H 5CIPB 1YUHB 3IU3A 3DVFA 1EFQA 1U3YA 4LEXL 1S7VB 4O51A 3PGFH 2A77L 4OD1L 3X3FH 4FABH 3MRNA 3O6KH 5IW1B 3B9KD 5J57B 1EERB 2AJ3A 3PP4L 3CFDB 3OAZK 3GSWA 2GITA 2ITDB 1TJIL 2UZYB 2FIRT 5F6IC 3SDAB 3WHE1 4PUBL 3KPTA 3TESA 2WUBL 2J6EL 1FORH 2XI9A 2J6EA 3DBXA 3HC3H 2VLLB 5EZJB 2CIKA 5D7KD 5JORB 3E2HC 3ZSTA 2OR9H 4L4VB 2G5BB 3FN0H 5CWSA 3IJSB 1N6VA 4S1RH 1L7IH 1IT9L 4NO5B 1QFWH 2VAAA 1J8HA 1IILE 3QIWD 2FJGB 3HAEG 5DK0A 2FL5B 4X4YB 4Z7UB 4Z6AT 5AYQA 3QUZB 3W9EB 2ZOLB 4TQEH 4JG1L 1FNGB 2JCCF 3B5HA 3F6IA 1F4WH 4P46C 4RX4A 1DEDA 3B6SB 3L5JA 1RJZB 5ACZB 2J12B 1S9XB 5TE6H 1Q8MA 5FUZH 4MXWL 5DRXA 1MVUA 1ORQB 2ZUTA 3L5HA 2YPLA 4QEGA 1AE6H 3HB3D 4KDVA 1WGOA 3S37H 1UM6L 3H7LA 3TNMB 5I75C 1WBZB 3A6CH 3GJFK 4FRWA 3V4VL 1UVQA 3MV7D 1PYWA 2D7OA 3I6LE 4RGNB 4FZ8L 2MSPA 4KRMB 2P8LA 2W65B 2AGJL 1J1XH 3WS6A 3VFRA 4I3SL 1GGBH 3BUYA 2FJFB 2E7LC 3RRQA 5ALCH 4U0RB 2X4UB 3BH8B 1T0MA 5FM5O 3ZTNH 1KBGL 4HUWB 4PV8B 1P4IL 1JK8B 4BKLA 5HYQA 1BJMA 3ARFC 1MCJA 1AGDA 2YD5A 2ADFH 3DXAB 1Z0NA 3GSNB 3O8XB 1G7PB 1YY9D 4R7DB 4FS0A 2XNAB 4HJ0D 1P1ZB 2PYEA 1MCQA 2VR9A 5D1XA 4HKBA 3DWTA 2DTMH 1K8DB 4WHYG 4JN2A 1SBSH 2ZSWA 1LE9B 4R4FL 5H35B 4PJBE 4JHBA 2VRAA 5H2BA 5T3XH 5GGQH 1NCCL 4W81A 4XGZA 3LMJH 4P3WA 1A7QH 4NQCB 5CZXC 3RTQA 4PLNC 3H7BA 1FO0B 4YHLL 2XZAL 3EO9L 3NA9H 1S7XB 3S34H 2QQKL 1AFVL 5I1CL 4LPTA 1Q9KB 3BP4A 4UZGA 1FV1B 3JWNC 4HGKC 2CRIA 4FQ1H 3BH9A 4ENEC 4JFXB 3BISA 4LVNB 3HE7D 1EH9A 1B4JH 4N0CD 4XAWL 4F7CB 3EOAA 4LVOB 5E6YA 4P2QA 4TUJA 1I9JL 3ISWA 4F7MB 2F54E 1QRNE 2VIRB 5CJXA 1KPUA 2EYSB 1B0GA 5ID0A 3OKMB 4DKFH 4TPRH 1AO7E 4ETQA 1P9MC 5F7DA 1N8ZA 3MO1A 3FRPG 4JANA 4PRAB 1EBAA 4NRZB 5DUBA 3MYJB 2XQYG 4MQSB 3ROLA 1YYML 4JKLA 3TO4A 5CAYB 4NSKB 5AWNL 1JF1A 5A16A 4Y19B 4UBDD 2JIXA 4TULL 2F19L 5C8JB 1LWRA 4PJCE 3JV6B 2J4WH 4TUKH 3SE3C 5E94B 3QYCA 4MB4A 2EDWA 5GSRA 1Y6MR 1C08A 4X4XA 4B41A 1RVFL 4XP6L 3L3DB 1J8HD 4Z76B 1JP5A 2OP4H 2B1AH 2P24A 4GSDH 3FB7B 4HJJH 2OL3B 1H5BB 3CUPB 4OZFG 5GISL 4KZEH 4BUGA 2LFGA 5DD1H 3VD9A 4NUJA 2I5YH 4RX4D 4MX7A 5D6DC 4YHKL 4DQOH 4J3WA 3MNWB 3OPZH 5E08H 3BP7A 5JUEH 5HGBB 3SJVB 3D18B 4RDQG 2YPLD 4UU9A 4ZAKD 4DN4L 4LOUC 2ZG2A 5SWSE 2R23A 3QI9C 1ZHBB 3RDTC 3OJ2C 1BGXH 1I4FB 4JZOA 1NJ9A 5E8DL 4XWGH 4K7FA 1DBKL 4G80B 1QR1A 2F8XC 4J2XA 2YZ8A 3T2PA 2G2RA 1D5IH 3EO0B 1TXKA 2KKQA 4Y1AA 1VERA 4HIEA 5FF6B 4IIQC 1XIWA 4BH8B 2Q87A 3AS1A 5C6WH 1NEZG 2P49B 4Z7WE 1FL6B 4NC1C 4NQTA 3F7VB 1KJVA 4OFYA 1MJJB 2NW3A 2PYED 2E9IA 3DROB 3Q6GH 4ZUVB 1MIEL 5D1XD 5C0CB 1N4XL 3S3PA 1ZVYA 3CU1A 4DAGL 3TA3A 2F53E 4AIXA 1JTPA 4FQPA 3P30L 3LKNA 1LO0H 4UAOB 5DTFA 3RTQD 5ERWA 2VLKB 1IGML 5EC2B 1HSBB 3IB4A 2Y4SA 5C1MB 4OD2B 3FB6B 1WK0A 4WFGD 5MI0C 4FFZH 5GS2H 1CGTA 1FC2D 1U41A 1G7JA 3OXRA 2AXFA 3WFEH 5CJ5A 5FCUL 4M00A 1TQBB 1WEJL 1SEQH 3VGFA 1I8MB 4XPBH 4J3OC 4R96A 2BJMH 1ACYH 4G43A 4MS8D 4NN6B 4QHMB 1XF3A 4P2QD 2R0KH 4NN5C 2FWOB 1TETL 4JFQB 2D0GA 1BVLA 1I1CA 3QUKB 4MA1C 1QSZA 1JGEA 3VXUD 2VR4A 3V5DB 5FGBC 2X9YA 2K3TA 1U6AH 4XBGA 4A6YL 4TTDD 1LO5A 2ORBL 1NAKL 4A6YA 3X11B 3FQWA 4G3YL 4C56A 3OR6B 3D39B 3B2UD 1KCSL 2HRPH 1CIUA 5J6GB 3TO4D 1YNTB 2DKSA 3L7EA 3OZ9H 3QUXA 1VKXB 3VRLF 3FFCB 2JIXD 3B8SA 1K4DA 5FA4A 3MQIA 5IFHL 3AS3A 3ULUC 4FXKB 4G8IB 3PHOA 5FFLA 2WWKT 4X6BB 4MXQC 5M7QA 3BRGC 2D0FA 1DVFC 2Q8BL 4Y5XC 5DJ0B 5F3BA 2VL4A 4KK9C 4PJEF 4BFGA 1NL0H 1WIPA 3BP5B 4M6AA 1BVKB 1S7WB 2R4RL 2DDQL 3IDIA 1TQCC 4D0DA 5H37G 4CW1A 4Z78A 3KYNB 3B2VL 3SQOL 1RZKH 3NIGF 4JFYB 3TYFB 4LBEB 1XH3A 2APXA 4X6FB 3FJTA 5SWQA 5FO8B 3PWLA 4XVUD 5FO7B 3T4AA 1AD9A 4R26L 2RGSA 1M7IA 1RIHL 5CHNB 1HILA 1OSZA 1ZLWK 2ICWA 4OLUH 4XP5H 4OT1H 1ZLSH 4LHUB 1T3FA 4PP2A 1ZAGA 2OMBA 3BKMH 4S2SB 5IHUH 4RNRB 3DIFB 3QEUB 3QG6A 4PJBA 3MJ7A 3MGOA 4GKZA 4OIIH 4OFKA 4Y1AD 1G7LA 5HPMB 1EPFA 3BEVA 3Q48A 3DPBA 4HH9A 1XIWD 4HW6A 1N0XL 2BNQE 3QDJB 3U1SL 4G6JH 4IDJH 1JCKA 4NNPH 2R2EB 2Y6SC 3BYYA 3UPRB 4FA8A 1RZGA 2X4SB 2NTFA 32C2A 5L8JB 4OFYD 5GSVA 3PL6B 5IGXH 1FAIH 1I8LA 2BDNL 3UTQA 3V4UL 4MHHG 3CX2A 2O5ZH 3D69A 5IVXB 3LRHA 4YUEH 4K3GA 1KC5L 1JUFA 3C5SA 2VQ1A 2Y36L 3BGFC 3UEZA 1D5XB 3TA3D 1EEYB 3G5VB 4ODXA 2G5RA 2W91A 1YPZF 4QF1A 1NKRA 2F54A 1IGIH 1QRNA 5IFJA 5J56B 1F4XH 4PYHA 2VZUA 3IYLW 1U9KA 2C1PB 1X6LA 2AJVL 1AO7A 5L88L 2I07B 2NY3B 4YDIL 3MLRL 4U7MA 1MFBH 1WVZA 4ONGL 1ZWIA 3C5ZC 2HFGH 1FFQA 2AEPL 3KLDA 4Q9BA 3HUJE 4KTDH 3STZA 1CD9B 2XG4A 4M7JL 1KN2H 4R0LB 1QBBA 4I4WA 3N85L 4BFIB 3NH7H 3I85A 3D85B 4GRLC 4WUUE 1EUTA 4PJCA 1B2WL 5B38G 2D03H 5JPNA 5I1GH 4K8RL 2Y07L 1SJHB 1S7TB 4M9PA 3GMMB 4ZSOE 1KB9K 1PDKA 2IQAB 4ZO9A 2FH8A 5IVZB 5CINH 1M6OA 1XGQB 1IJ9A 4C56D 3QQ3A 1NLDH 3HS0A 3P3YA 3O2VL 3QUXD 4TRPH 4HV8B 4PGZA 4PRNA 4GAJH 3SDAC 4DKAA 3AAZB 1KYOK 2UUDH 4JKPL 1JPSL 4FFWD 4M48L 4WRLA 1WBYB 3GI9L 5SWSA 1UADC 4H20L 4ZTOL 1RK1A 4NQEE 4QRPA 2Q1EA 1EJOL 4P2RE 3PIQA 3I6LD 5T5NG 3G04A 4LCUA 4QRQB 4M4RA 3OB0K 5TE4H 4H8WL 3NCYS 5I8EB 2MHAB 3QUZC 5F7EH 4PBWD 1CFQA 1JV5A 3HG1E 4XHJC 1TTUA 3VFUB 3EYQC 3L3IA 1MNUH 4U6VH 3DV6B 4Z7WA 3OKOA 5F70A 5JOEA 1ZGLP 4P59H 3M8OL 4UQ3A 4X5WA 4G7VH 5DJ2B 5I1DA 1IKNA 5BW7C 1NFIB 4KDTC 5E7BA 3LS5H 3RWJB 3WO3B 3R1GH 3RVXD 1C16A 2PF6A 5ALBL 5FDWB 4MA7H 2F53A 1IGFH 1KN4H 1LK2A 3FO2B 2NLJB 4WHDA 3LKOA 4M7KL 1U8QB 3P4MA 2Y72A 2B1HH 3ALWA 1Z9SA 4IRJB 3DARA 1XGYL 1XR9B 2UWEF 4U0RC 1A2YB 4KRPD 5CBEA 1BIIB 5EZLA 1T83C 5C6TL 3CSYB 3PDGA 3BX7C 1EHAA 2ZCLL 1EK3A 4RMWA 1RZIB 1PG7H 3GMQB 1LNUB 4DOHE 3OAYK 4LPUA 3L3GB 1JF6A 4XMPH 2F54D 1QRND 1ODAA 4ODBD 3VGGA 5IROC 2CDGA 3TNNA 3P4LA 2PTTA 1KYOJ 4L8SB 4APQC 3QHFL 3G5YB 2CLVB 1AO7D 3HI5H 3MR9A 1U8PB 4DGIL 1FZMB 4CVXB 4HAGA 1DZBA 5I30H 1DBBH 4OCYL 2UVFA 3KHOA 1T5WB 5JIHA 1RJCA 4QHUA 2HLAB 3FQXB 1U93A 1R5VB 3FRUA 1UH3A 4MNGE 5C0BB 4CJ0A 3BKJH 3EYSH 1JYXA 2Z31A 1EEZA 4LLVB 2JKXA 4NOFA 3MRCB 4K94L 2X1QA 3EGSB 5F7NC 3RWDB 1KSRA 3NACL 4PJIF 4KROD 4LVNC 2DM3A 4K8RD 2VLJB 4LVOC 2YK1L 3GHBL 1XR8A 5EC1B 5DA0B 2MKWA 4HBCH 5FKPB 3HI1B 2DF3A 1VFBB 4HS6B 4QNPE 4L8BB 1T6VN 2VWEE 3WXWL 2G60L 2VL5A 1XZ0A 1F3DJ 4AEHL 3RY5A 3FB8B 3OJDB 1NCAL 4KRNA 4X7EC 2O26U 4J3SA 3CFBB 3WSQH 2EDRA 2QR0A 3GSRB 2FHBA 1PAMA 2EZ0C 4YLQT 1TJHH 5KN5A 1EFXA 3O11A 1QSEE 5HDQL 3HPLB 2R0ZH 4PGCB 5SWSD 3MLUL 4O2FB 4GJTB 5HYJE 3D0VB 4QRPD 5BXFA 1T03L 4Z95L 1AQKH 3U9PH 4YQXL 5JHDB 1Q9WB 3KLHD 4WFEE 4ZOCA 1F6LL 3WFDL 4DKEH 1I1FB 1NDMA 1Q0YL 2AP2A 4BQBA 4X98B 1J1PL 4M62H 4HIIA 4L5FL 3JTTA 4ODVL 4OM1H 1H5BC 3RWIA 5E8EB 3SGDI 3GIVB 2BNQA 3V6ZA 4NIKB 4RWHA 4JRYE 2Z8WC 2NY2D 4XB8A 1NAML 4U1LA 3V7MA 1NAMA 4OZHE 1I9IL 3MJ9H 4FQQB 4WO4A 3QEQE 3HZKB 4XXCC 3FOMB 5IBUB 2ZPKL 3LEYH 5TDPA 2CRYA 5CCKH 3AU1A 1AKJB 3NIDE 2EXYC 1QA9A 3B3IB 3DO3A 1BX2B 4JGMA 4Q58C 5C6PB 3GMPB 4I8DA 3VFVA 2X1OA 2F53D 4N0YL 4JO4H 5IF0A 3ZT5A 1PZUB 5ABDE 4KDWA 5KSAB 5GS1B 2W0KA 4GRWF 1JN6A 1A4JA 4XAKE 1INQA 3MRFB 4B5EA 3OAZH 1T1ZB 1ZHLA 3KPRA 5F7YC 3T0EE 3WFZA 1EAPB 2IALB 4WEUD 2HFEB 2VABA 4HWEH 1N6QL 5F1KC 3IXTB 4LL9A 3HUJA 5KSBF 4UI2A 4DJMA 2VDRL 1Q1JL 3STLB 4L3EE 3FTGA 1KTRL 3ULUF 2R9HD 3RVTC 1DSFL 4WUUA 4KI5F 1T66C 1IGJA 3BW9A 3CFCL 3DI2B 3ILQD 4RQQA 5FYJU 2WK2A 5DMKB 5I8OL 4ZSOA 1OF2A 4U6HA 1HIML 5HY9B 2W0LA 1XFPA 1U92B 2EYTA 1T0PB 1M05A 5TPWH 3D0LB 1UKTA 3DNKA 3HCVB 2X4NB 1OTUD 5IQ9A 3HA0A 4QRUA 3QJHA 1OAYL 2Z31D 5C92A 4I18A 1H3WM 2BCKA 4PGBA 4V1DE 1J0JA 1XF5A 1TQBC 5CEYA 3GJFH 3WEXB 5BRZB 3QT2A 4IEFB 4ZD3H 3JVGC 4FNLH 2NX5E 4NN6C 5FV1L 1KLGB 4JG0L 1OCWL 4JDVA 4LSPH 4NQEA 1F90L 1BJ1J 3BD3A 2X4PA 3GK8L 1KLUB 4P2RA 4AK1A 2FBOJ 1I1AD 3EHBD 5DRNA 4L8CB 4HG4K 1HCFX 4JFZH 4AYFA 1UA6L 3IXAA 3GO1H 4E5XB 5EDXA 3MUZ1 3BVNB 3HG1A 2BOCB 3RZCB 1VGKB 4ZO8A 1OT2A 1HN1A 1I7UA 4XP9H 3ZTJG 4PGJA 4HDIB 1OGAE 2WQRA 2FSEA 3TCLA 2W0FA 3WFCL 2ADGA 4QTHA 2H2PC 2IANE 5INDB 2XT1B 3G6DH 3QP3A 3TWCH 4OD3H 4AEIL 4M9OA 1RURL 1RJLB 1QEWB 1GGTA 2E3VA 1WWWX 3E6FB 1AIFA 1HEZA 4LSTL 4NKDA 1F45A 2JCCA 5KSVA 2BNQD 4POZD 5C3LD 3I75A 4XX1G 1P4LA 4LCYB 4XCFL 4K3EH 15C8H 5EH1A 3CPLA 4XBEL 3HNTL 1DANU 3ARGA 4WO4D 3RWEB 4Q9RL 4HS3A 3TIEA 3TFKC 1CU4H