43C9B

Crystallographic structure of the esterolytic and amidolytic 43c9 antibody
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
118
structure length
118
Chain Sequence
GQVQLVESGPGLVAPSQSLSITCTVSGISLSRYNVHWVRQSPGKGLEWLGMIWGGGSIEYNPALKSRLSISKDNSKSQIFLKMNSLQTDDSAMYYCVSYGYGGDRFSYWGQGTLVTVS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural basis for amide hydrolysis catalyzed by the 43C9 antibody.
pubmed doi rcsb
source organism Mus musculus
molecule tags Immunoglobulin
molecule keywords PROTEIN (IMMUNOGLOBULIN (LIGHT CHAIN))
total genus 25
structure length 118
sequence length 118
chains with identical sequence D, F, H
ec nomenclature
pdb deposition date 1999-03-10
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 43c9B00
1Q9KB 2Z8WC 4FQXD 2WIMA 3MOQA 4ZO6A 3KLHD 3SKUD 5F21B 4F9PA 2A1WH 4G7VH 2W65A 5E2WH 1BGXL 3U36B 4XCCL 1D5ZA 3OR7A 4JZNA 2P5EB 5MERB 4YGAB 4MJIA 3ARWA 1B6UA 3JTTB 3WLBA 5AZEL 2VL5B 3RWEB 4KRPC 1S3KH 4NRZB 3IDMA 1Q0YH 3CDYA 4RFEB 3BD4A 4XPHL 1DQDH 4WEBL 1AI1H 1HKLL 1IM9D 5TE7L 1ZVHA 3KS0H 4C4KT 2XNAA 1G9NC 1FAIH 2Z35A 4DGYH 2FHFA 5JZ7C 2Y9RT 4Y88A 4FFWD 4CDGC 1MFCH 3GIZH 1S7RB 4LCWE 1PG7H 3ARED 4ZFFA 3LEVH 3T0EA 1NGXB 1K6QL 3S35L 2NY3C 2NQCA 4DKFH 1NUGA 4I0PC 4JFQB 2GYSA 1NCAH 3GJFH 4JZNB 5C0RH 1I3RB 3ZTJG 3ARGA 5DD1H 3MA9H 1SYVB 3MRFB 5IHZB 3SCMB 1AKJD 4GKSA 2AQ2A 1OB1A 4ZPTA 7FABL 3ZHKA 2WBJB 3GMOA 2EH7H 5DJ2B 1XIWB 4V1DE 5HD8C 3NPSC 4MNHB 4JY5H 1NSNL 5JPMB 5KANI 1MI5D 3L7EA 3I6LD 2VLRD 1UB5B 3IDYC 3I3BA 4Y5VA 1JK8A 3ARDD 3ME0A 5DD5H 1EHAA 4LIQH 4HDIB 2Z4QA 4MAYD 2BXZA 3IJYA 3KJ6H 1AGDA 4MLSA 4PJDA 5DEZA 5B3JF 1BQHB 1SM3H 4R4FH 3IDYB 1INDH 2D0HA 4YDIL 2KH2B 4XPFH 3SDXA 5I15H 1IT9L 2I60L 5D1QB 5E6IB 5EIIB 3DV4B 1XGTB 2CR6A 1D3CA 5E08L 5KAQG 3P9MA 5TF1H 3VGDA 3V0WH 3GSOA 3IDXH 1U9KA 5GGUB 3QPQD 4JFYB 1HYSD 3QNXB 1N6QH 3G5ZA 3H9SE 3LRSA 2EIZB 3T0EE 1LNUB 2V9QA 3T3MF 3AMLA 4FQIH 4J3VA 5HVWA 4WFHE 4HCRL 2VN7A 3L3KB 1OP3K 1VACB 2B1AL 5D1XD 4Y5VB 2QSTA 1DL7H 5DT1H 2XWTB 1ND0A 2R1YA 4X4ZA 1UJ3C 5D7KE 3MXWL 3UAJD 5TDNA 4Y16A 4EN3A 5KZCD 5DRWA 2EDNA 2B5IB 4J1UB 1T04B 2QLVB 4XPTH 5IB2B 3ZDZF 5EIIA 2VTFA 1Q9LA 3GMQA 4U1JA 2P8PB 1HWGB 5FYLH 5D71L 5J13C 1I9JH 1KG0B 1NLDH 1F4WH 5FEBA 1IAIM 5CEXB 1FRGH 2DM4A 5D2LE 5KSAC 4Y16D 1WBXA 2YPLA 3D3VA 1VPOL 4EEEA 1NEZA 4OIIH 4JFZL 1F6LL 5FM4A 4KRPD 4POZD 1LD9A 4IBLT 1NEUA 1YDPB 4JKPL 5C08E 2J6EL 3FOLA 2IG2L 3T3ME 3VXMA 3TFKD 4Y5YA 1X44A 3G08B 3FO0H 3RGVC 3WKMH 3CSYA 5E1HB 1T4KB 2VLRE 3GKZA 4Q9QH 1UCTA 4W6YB 3O2VL 2HFTA 1AGCB 4KAQH 4ZOAA 3DV6A 4X6DF 4PFEA 2X89A 3CZJA 1KB5A 3MNWA 2XA8L 2BC4A 3VFVA 1HINH 1FN4A 2ADFL 3RX5A 4GSDH 2CUHA 3UPAA 4P9HH 3VD3A 5C0EA 1LO4L 3QWRA 2Q6WA 5BV7H 5FYJU 5FGSA 2EIBA 2HG5A 5I0DA 1F8TH 4I5BA 4D0BB 4KI1A 3I9GL 2YUWA 1WTGT 1A3RL 4C57C 4XB8A 3KXFA 3GSUB 1NMCC 1S78D 3MFGB 2DF3A 3KDMA 5T1DH 4HUWA 1MFEH 3EYFA 4PB0L 4Y1AE 5M95B 1V3MA 3UZEA 3LKRA 1GGBL 1TXKA 4XX1E 3ULVC 1A2YB 3TT1H 1Q38A 4NUJA 3V6OC 1HILA 3QAZB 2HVKA 1CVRA 5GGTL 4P2QA 1HH9B 4H0IA 3DV6B 2BP3A 5ALBL 4RFNB 4AH2A 2XN9B 3ARFD 1MCQA 1JHKH 4YXHL 1A7PL 2AJ3B 3DYPA 1OM3L 4GXUN 5DURB 1I1AB 5C08A 4ODBD 4YR6A 1RUAH 4MSWA 1HIML 1HHKB 3M17A 4UUJB 4K2UH 2LU3A 3MRBA 4JFDB 2OK0H 2CIIB 3T1FA 3AUVA 1AH1A 1A6VH 1BBJB 2QQNL 4YHKH 4KTYA 1HYSC 3HR6A 3CSPA 5FYKE 2APWA 1UM5L 3OKEA 1IKNA 1RJZA 1T0PB 1MFBL 5DQDH 4OF7A 2FGWL 4GAGL 5KVFH 3QWOB 2ED8A 1AO7E 3TJHD 1C8PA 3ULVE 4WVRA 1JF6A 3CFBA 3L3OB 1ZGLM 3I2CL 1UWEL 4F15B 1DQDL 1R3IL 1EEZA 1I9IH 1JHLL 1QSEE 3T2PA 3D85D 4PJHA 3U4BL 3MCLL 3BSZL 4KTEL 4Y5XB 2IAMB 4FP8L 3MTRA 3B8YA 1CICD 1BOGA 3RNKA 5ICXA 3L3GB 3NPZB 5HGBB 5CJXC 2NY1C 3QDJB 5HDQH 2DTSA 2F53B 4KMQA 1EFXD 3PGDB 5FHAH 1SBBA 2FGZA 4AG4H 1G9MC 1BECA 2VQUA 3U2SB 4IHOB 2FL5B 2BERA 3Q1SL 4TRPL 1R5IA 4BK5A 4JDTL 2P49B 1IKFH 2EH7L 1HXMA 1RIUL 5IEHB 1JYNA 3RIFF 3NZHH 3HZVB 4JPIA 1I7RB 2XZAL 1HI6B 3O8XC 1RSFA 4OF3A 4O51B 3MACH 5D5MF 4KJQD 1R5WB 2GTWA 1B0GB 2EC9T 1FNAA 2E6PA 5C07E 1XF2B 2BVPA 2EC9U 4M4RA 4JQVA 1AGFA 1K3IA 1X5AA 4XXCC 1MIEL 5DR5L 5EBWB 5CGYD 3KJ4C 5EU4B 1CQKA 5C0BE 3BFOA 4LCYB 4PJ8C 2UY6A 3MGAA 1IT9H 5KJRL 1CD1B 1P9MC 4M7JH 1WFOA 3U9UB 4BSVB 1HNFA 4L3EB 2VZ1A 3O4OC 3OPZH 3KLHC 4JO1H 4KKCC 3VXRE 2FL5A 1IAKB 4QRQB 2OJEB 3B5TA 4JFPB 4GKOA 5T3XE 3RTQC 3QXAA 5DGRA 4BFIB 4X0KA 4FZ8L 5D1XA 1FCGA 1U3HB 2DQJH 1FLTX 1KNOB 1QFWH 5IBTH 1S7WA 5IF0B 4LRIC 3L5XL 4KRPB 2YUZA 4PJCB 2P45B 4UV7L 5E99H 2APVA 1R5WA 2J4WL 4PG2A 3ARYA 4CMHB 4EBQL 1XF2A 2ARJQ 1OD7A 4JFEB 3AS2A 4R4BA 2UV3A 2V5TA 1U8PB 3TIDB 3NFNA 2OP4H 1YMMD 5A3IC 1JNNH 4NZUL 4S1RL 4P4RB 3ROOA 5I73B 4XPGL 3B6SA 5HHQB 5L8KB 5EOTA 5EO0A 3MRRB 3V52L 4OZHA 5F1SA 4OIBA 4P46A 4NCDA 5C6TL 4LK4A 2NY4D 1F4WL 2Y72A 2DJ4A 4G6AD 4JQXC 3EYQC 1W0YT 2Y6SD 1IRAY 5ERWB 2Z91A 3X3FH 1U3HC 3G5XB 4M62H 2A83A 3U1SL 4U7SA 1ODAA 3TJHC 5I18H 3BO8B 1JTPA 4TOYH 5IF0A 4DWHA 2V5SA 3FTGB 4FQLH 3T3PE 1D6VL 4CU8A 1SMAA 1W0VB 4CNIA 1GGYA 5J89A 2J6EH 3E2HC 5ADPL 1UACH 2XWJA 4NN6B 5D7KD 4LASH 1CT8B 4WWID 4X6CA 1AGEB 5J7CC 1AO7B 1CBVL 5KW9L 3SGDH 1EZVX 3U4EA 1DBML 2W91A 4L8BB 5JW3L 1CICC 2PKDA 2Q3AA 1MJ7H 3QHFL 4X7TB 3QCUL 4D9RE 1FZMB 4JFDD 3AREA 4KXZH 4LKXA 3DURA 3QNYB 3BKJH 5D6CA 5SWSE 4KUZH 4KQ3H 4NT6B 4C59B 4CKVX 5F3HA 2IMMA 3IU3A 4JGUA 1YEJH 3BHBA 3MJGX 3NZ8A 4NHCH 5F93C 5D1QD 5IBUG 3U9PL 1RJLB 3GJEA 2CKBL 2F54B 3O2WH 1S5HA 5I76B 3P4MA 1XIWD 2QHLA 4FQCL 1JRHL 2AI0L 3C5ZC 2V17H 5I1JL 1VADB 1MHCA 1TIUA 4YXLH 5J1TC 1NGYA 4WU5A 1E6OH 5DFWH 3GJFK 3B3IB 2P8LB 5F89A 3BD3A 1CXEA 3BPNC 1NAMH 2VQ1A 3VRIB 4D8PA 1AJ7L 3O3DB 3IJHB 3C08L 4TUKL 3PWPD 1CFQA 1NH6A 1NDMB 5DJ8B 1H15B 5FM8A 5E5MA 2ZZUT 4BH8A 3IGAA 3QDGA 4ZO9A 1RUAL 2B0SH 4WEMB 5SWZB 6FABH 2NNAA 2MKWA 1IM3A 1TQCB 3RPKA 1C08A 1MCOL 2WP3T 5E4IA 3MLTB 3GSWA 3U82B 1JZ7A 2X10A 3WNOA 2YZ1A 4I2XE 4OLWL 2KPNA 1GGIH 2W38A 3GSQA 3H9HB 4WI4A 1GAFH 3TPUB 1A64A 1QSEA 4Y2DD 5IWLC 2X1PA 4NNYA 2VH5L 5TGBA 3N9GH 5GS0H 2C3WA 1R5VB 3RHWK 5F7HA 3PHQB 2AW2A 4EIZC 1CDJA 2FCBA 1JZ3A 1P4BH 3V6ZB 1GCFA 4PRAA 1KJ3H 2P24B 3FAWA 4BA8A 1HE7A 1FNHA 2JB5H 5FO9A 3MCLH 3CCHB 2E9IA 2AJYL 4XP9H 5E4EB 2P47B 4N5EC 2ZKHH 2NZ9D 1I1YA 3WIFA 5TH2A 1MLBB 4MDIB 5FIEA 3V6FB 1QO3A 1FFNB 1Q8MA 1ZA6A 3BEVA 4HF5H 4OZ4B 4HG4J 1OLLA 4EZMA 3U6RA 4Z78B 5JNYB 3CAFA 1V3JA 2VR4A 2DLEA 2FHCA 3BQUD 4YBHA 2ZCLL 4OGAC 4PJ9B 3QNXA 5J57B 1XF5B 3BYTA 1MCCA 1RZ7H 3CK0L 4LSSH 2UZXB 4JDTH 5IMOA 2FH8A 5EC1B 3QIBC 1NMAH 1PX4A 3AS0A 2XXCB 4J23A 2X41A 1J1OL 1H3TA 1RUPL 4M6ML 4ELMB 5EFIA 1U42A 4WI5A 43C9A 3T0EB 4Q97A 2P1YA 4OD2B 4Z7WB 2ICWA 2C1PB 4I3SL 4P4KC 4KRMB 5TH2B 5FF6A 1A7NH 4JRXD 3LAFA 1ZA6B 1P6FA 2D03H 3W5MA 3S4SG 4YHNA 4KKCD 1MFNA 4RMVA 1Z2KA 1TMCB 2CKBA 1RZIA 4QHKI 4R3SA 4OZHE 1AC6A 4G6FB 4KVNH 2DIJA 3D1MC 1XF5A 3G5VA 5J9PB 2V2XB 5IIEA 1YZZA 4MNHA 1MAJA 2DKSA 3G6JA 2QSQA 4E42A 1JPST 4HEPG 1EBAA 5AZ2H 4MQ7A 4Q58C 3DHMA 1FO0L 3KWWB 1RULL 3T0VA 5L8JB 2WUCH 2Z8RA 2KZ1B 1BF2A 2BSTB 3TO4A 3OB0H 3DV4A 3O4LA 4AENB 4OLEA 2BJML 4PJBA 2BVTA 1FGNH 3FO2B 2J8UA 3GSOB 2VDKL 4J4PD 3SJVD 2ZUQC 2AEWA 2VLRB 3QCTH 5GGUA 4I8DA 3NACH 5IJKC 4JHAH 2B2XL 2GQHA 1Q0XL 2E8ZA 4NGHL 2C7UB 4L5FL 3DX7A 5CJXA 4G6ML 2ZG3A 1VGKB 2R8SH 1VFOA 5ADPH 1NBYA 3GBMH 3W2DL 5ID0B 2XQYK 4J3XA 4LASL 4JDVB 1JGLL 4MX7B 4ZUVB 5FGCB 4OCSL 2IQ9L 2Z31B 4F9PC 1LE9B 1ETZA 1SJXA 4L29B 5C08B 2D7NA 5I8KH 4JRXE 5IB3A 5BS0A 5DQ9B 3EFFB 1BIIA 1CF8L 3S97C 1WICA 3B9KC 5IR1B 4JQIL 4N0RA 4Z7UE 5DMIH 5LXGL 4HHAA 5LVEA 1J05A 3V5KA 4WNQA 1CS6A 4C83A 1LEGB 2A6DB 3HAEG 4QHMA 2QADD 1AI1L 2IJ0C 3F12B 1CGSL 2HJKB 3EDJA 3CSGA 3FQUA 1TITA 1YN6A 4JRYB 1NBYB 1NC4D 2FR4B 3UYRL 5B39A 5EU7C 3MLSL 3BW9A 2XKSA 5TE4L 4NCC1 1H5BB 2NY1B 4KKLC 4PD4K 4NO3B 3CFIC 5CLTA 3E8UH 1OP5K 4YC2B 1CFNB 3QZWB 5FUOH 4ZSOE 5C08D 1AJ7H 4Z7WE 2YUVA 4X4YB 1BFSA 5DHVB 2GJJA 4JFED 3HRZA 4TVPL 4Y1AB 4AEIH 3K4DA 4NRXA 5I1LA 3FT3B 2V2WA 1YEKL 1T1ZA 3VXMD 2CLVB 4KPHH 5D7LE 4M7ZB 1WCQA 1H0DA 5DJ6A 4R97B 5D7SL 4X6EB 1PVHA 1OTSD 4BH7A 2OL3A 1R5IB 2HT3D 4TVPD 3OXRB 3IRPX 1D9KC 3PWVA 4PGBB 1XF4B 1NGZA 3LKQA 5LG1A 4JPWL 35C8H 5HHNB 4OGXL 4OLUH 4RMUA 1ZHBB 4FQQA 2AKRA 2HFEA 3CC5A 2FD6L 4CN4A 1P1ZA 4DQOH 4L4TB 3SKNB 4YR6B 5BVJA 5LGJB 5C0AA 4YX2L 2H32B 1FGVH 3IAPA 4ZD3L 1QQDB 3EUUA 5FUCE 4XCNB 4BSWB 1D5MA 4NKDB 4OBSA 1VKXA 4UIKH 2NTFB 3I50L 4BSVA 4HF5L 3OKEB 4CU7A 5DRNB 2NY6D 2X4SB 5DQJA 3SBWA 2BXYA 3B9KB 2VITB 1IAKA 1QLFB 2CLRB 2Z93A 2DICA 4MQTB 4PGBA 2IPUK 2P42B 5EORL 5C3LD 5F72S 5CWSB 2QL1A 4GMTH 2BVUA 4LCIL 4NM8H 4PRIA 4ZAKA 1HEZA 1P1ZB 5LBSL 4Y4HA 5J6GB 4Y2OA 4WTWA 3GIVA 4PJDE 2P4AB 4Y0GA 3IVKA 3OZ9L 1I9JL 2ADGB 2H32A 1RUPH 4HUKB 3MRDA 1N6VA 5MHSE 3O3AB 4BFEA 2FH6A 3U4AA 3UO1H 1JHTA 4YH6A 4N8VA 1VPOH 2D0FA 4WTZG 2NPLX 3MRRA 3C09C 5MEPB 2XQYG 3MLVL 1U8QA 1RK1A 3I02A 4PJXF 4AEEA 5LQBH 1IC7H 4GRLD 5I1AB 3TC9A 3AS3A 3UPCA 2PYED 4EVNB 1FDLH 1HH6B 3KPOA 1EHLH 2EDFA 5TJWK 3VFWA 4PIRF 1EFQA 1J7VR 4JREB 1QSFD 5IHLB 4JN1L 1NCUA 3WBDA 3PG2A 4GXVL 3BO8A 2DIAA 2X44D 3L3JA 3QZWG 4ZUUA 2ZNWA 1XCQA 4I1NB 1LO4H 4R4ND 4P4KA 4RWYL 3T0ED 3RZCC 1MF2H 3UTTD 8FABB 5JMOC 2DKUA 4YZFE 5ANMA 4EQ2A 1TJGL 5KSBE 1JHTB 3HN3A 1MLCB 3EBAA 4OZIB 3T65B 4OCRH 3WIHL 2P5WE 4DCQB 5CINH 1KGCD 4R7NB 4FXLA 5GS1C 2HFGH 4I18C 4FQPA 3QUMA 5F88B 4LARH 1X7QB 2ARJB 5CZVL 3O4OB 4XC1L 1KCRL 4EVNA 2DLFL 5F3HB 5GJTH 3RKDC 1UH4A 1UVQB 2BFVH 3ARQA 5IMKB 1I1AA 2F58H 3HNSL 1YECL 5BRZD 4DGIL 3DX6A 2Z31D 3BZ4A 3BEWA 5I30H 4PRPE 3U7WH 4FQXA 1UKQA 1T0NB 4NC0B 4NN7C 4H26A 3PXJA 1HIMH 4L4JA 2Y7QA 3NABH 3QIWC 3H6JA 3QXDB 2DIBA 3HI1B 4U6VH 3TP4A 3FO1B 4YZFF 3P0YL 1EA9C 3CFDA 1XCTB 1UM5H 1GZQB 3LKOA 3UEZA 3FFCE 3QDMD 3FCTB 3G6JF 4ZAKC 1EAPB 4QLRA 1MFDL 1BD2D 1IVLA 1H3PH 5JXEC 1MRDH 3R1GH 2JJUA 3ARDB 3O81A 3RQ3A 1TJIL 5LXGH 4XT1C 1UVQA 4KV5E 5EH1A 2BDNH 3DVGB 4U7MA 3IDNA 3MLZL 3BZ4B 4ELKA 2IALA 5FYKD 4PJCE 1LEKA 3FQRB 4NQCB 4QRPB 3VRLE 1AQDB 5FYLD 2BY1A 1JGDB 4N90D 5E0QA 2Z92B 3TBSA 4PP1C 1HZHH 4MD5B 1RZJC 4RGND 3OKDA 3PGDA 1HXYB 1QFOA 3SDAA 3MLRL 2AGJL 1W2KT 3UAJC 3E8UL 3U2SA 2RBLA 2EYTA 3ZL4H 4N0CC 3I6KA 5CJOL 1PKOA 1YPZF 1U8KB 4KY1L 3VXQB 4MXWL 1HSAB 4QXUH 3OHXA 3VCLA 4TVPH 5CD3A 4R7DA 3QJHA 4XTRC 4IS6A 4MDIA 2AVGA 3V6FA 3ZT6A 2P5WA 1OPGL 4M8QB 4OLYL 1IKFL 2EDYA 2KQMA 4NDMA 5FKPB 4JFHD 5T1LA 3SDXF 1SBSL 2XZAH 3VFRB 1D6EB 3T4YA 1AGFB 5BRZB 5JW4N 2R0WH 4PJGA 4Z0XA 4AJ0A 1I75A 3DTXB 1XIWA 4PTUB 4P2OA 4PJCF 3S3JA 4XGZA 1DUYA 1MIEH 5FKAA 1SJHA 5CBEB 1LE5B 2ICEA 1MCWW 2HJLA 35C8L 3ZKQD 2O5YL 2D7QA 5B3JE 1AO7D 5F9OH 1SQ2N 4NNXA 1V3KA 2BVEA 1T66C 3EOYG 2CRYA 2JCCF 5CD3B 2CR3A 2OXGA 1YPZE 4G6AC 2R9HC 3VG9B 1T83A 1JFQL 5EA0L 2H26B 3JWDH 1NLBL 4NBYB 3I50H 5ESAA 4D3CH 4G43B 5EU6E 1FLRH 1OAKH 5GRVK 4Z76B 2DQCL 2M2DA 2G60L 5I1KH 2NY6C 4LSVH 3DX8B 2J3SA 3MYZA 3G5VB 1B4RA 1ZANL 2E7MA 3C9NB 1MWAA 4XZUB 1CLCA 4F3FB 1S7VB 4GOSA 3CDCA 2I5YL 2OL3H 3EOTL 3LSOA 3QH3B 1YNLL 4U1IB 4ORZC 2X4QA 2X9XA 3CD4A 5L6YL 4YEFA 2VISA 4S1RH 4HXBL 2VUYA 1HWHB 3T2OA 5E8EA 4OT1H 4LLYA 1F2QA 3RUGE 2B20A 3KWWA 4JB9H 4BZ2H 1JCKA 5IVXF 1GPOH 4JQVC 4PLJD 1ACYH 3MA7A 5GIRA 5IROA 4RAUB 3BH9B 3IT8D 2WUBH 3O0RL 1T7XA 2HT4D 4N9GB 2OTPA 2XZCH 3QULB 4YHIB 5GRUH 1SY6A 4PJ9A 4KK9D 5KOMC 4OZFH 2XQBH 2DQIL 4F3FA 4XX1G 1UZ6F 4GW5B 1TDQA 4DKEL 4GG8B 2CIKA 4JANB 3HPJB 3RWGB 3PL6D 3RWFB 5C2BH 5GJSL 3PWPB 2O5ZL 2X7LB 5C07B 2R15A 4A6YH 4U1GB 1M7IB 4XVUD 4PV9A 4ZFFB 1S7UA 4F7MA 1ES0B 3QHTC 3LY6A 3QHFH 4HKJA 4FN0A 3ZYZA 1R0AH 3EHBC 3VFPB 1V5JA 2OXHA 4UIMB 1LVEA 4JZJA 2C1PA 4HFWA 4KQ3L 1QHPA 1I8KA 2VE6A 1XR8B 1MWAH 5FYKH 1FVCA 3QIWB 15C8L 4RAUA 1ULVA 4GKSB 3ET9F 4JKKA 3KYKH 3QEGH 2H3NA 2C3VA 2AJXH 5DEGA 3OBAA 4R3SB 4BM7A 2F53E 4M6OH 1I4FB 3DROA 4Z7NF 2QEJA 1CXHA 3OKOA 2DLFH 1SVCP 4YDJB 2HLAB 1D5BB 3UBXB 1H15A 4DN4H 1ORQB 2V7NB 5EN2A 2YN3A 3QDGB 1UZ6E 4PJDB 1BQHA 4H8WC 3D0VB 1ZK9A 4BZ1L 5D8JH 5JTWA 1JPGB 2Z31C 1K85A 3RPIB 4EOWH 3U0PB 2IBZY 3ZKND 1E28A 4UIMA 1A3LL 3KPLB 3TIEB 3O8XB 1W0WB 1XGQB 5H94A 1RD6A 2J5LC 3K2MC 4XVTL 4U6VL 3QYCA 3BKML 1U95B 4RZCB 1CTNA 3U79A 4R0LB 1HHJA 3LEYL 1EX0A 4LLDB 3MRJB 4J3TA 5ISZE 4QTIL 2ZOKB 3QI9D 2NXZB 3CMGA 5AD0A 5FECB 1NGPH 3W9EA 1JPSL 2ADIA 3O2DH 4HZAA 2P24A 4LLMA 4U31A 4KQ4H 4WCYL 3PDOB 2GCYB 4BKLB 5F1KC 2W9DL 3QFJD 4LP4A 3A67H 4MA7L 4XCFL 3VH8A 1KJ3L 1YNTA 2EDTA 3WFCL 1MCBA 3MJ9L 1LO5B 4LCCA 2L7UA 5A16A 3F58L 4JFQA 2HH0H 2Y5EA 4NO5B 4KWUA 5EZOH 4J6RH 3NIGF 3WS6C 4Z78A 4XNXH 5DSCB 5MEQA 2EXWC 4CN6A 3BVNA 3ARGB 4V1DB 2VLLA 1HZHL 4OKDA 4RIRA 5F70A 5IVNA 2PO6B 4HC1H 3DARA 5EO1B 2ZCHL 4Y4FC 5CAYB 3TN0C 1CFSB 3OKMB 1LDPH 4N0YH 3WUWA 3T04D 5DO2C 3K4ZA 3DMMB 3TEUA 1CFVH 2FJFA 4KY1H 5DZLA 4PBVC 2I9TB 1FIEA 3MA9L 1YC8A 1Y0LB 1QR1A 1H3UA 4FZEL 5EZIL 3VFGL 3S96B 1GC1C 1WBYB 3P4LA 2QKIA 4XNQB 3L9RB 5L2KE 1XAUA 1MJJA 5GS2D 4JY5L 3GSXB 2BRRL 4FABH 1DEDA 1N4XL 2HWZH 4XNZC 5D2NE 4U1MB 3MNWB 1MVFA 3STZB 5JR1H 2FSEB 3PQYE 4JGJA 3VG0H 1A7RL 1AXTL 2YMXH 4H1LG 3HZVA 4JPIB 4HH8A 1IAOA 2UY7A 3DX9A 3QZWA 5T1KB 1YEHL 4JG1H 4UMGA 3ZO0A 1I3GH 1T66D 5EOCL 4XXDA 1PBYA 1A9BB 4PREA 3WHE1 5JO5A 4NKMB 3EDKA 5JDSA 2ATKB 3OF6D 4LVHC 2LAAA 4X8JA 3S4SA 5KSAD 4Y16C 4IRJA 4F37F 4WDIA 5EU4A 4PJ8B 4ZDHB 1ONQB 2VMFA 3IDXL 4WFHD 5IESL 3EYVA 4KK8D 4L3EA 1XR9B 4U1LA 3FN9A 4UT6H 4FMFA 2L4OA 4LHUD 1JNJA 4G9FE 4I9WE 4OFPA 4NQTA 5K9OB 2R1WA 5KSAA 4BQ8A 4LSVL 2G2RA 1RULH 2J8UF 5ACZA 1K8IB 1MNUH 4OCXH 3L3IB 2DLIA 5SX4I 3AFLA 1J0YA 4U1KB 4XP1H 3L3JB 5I1GH 2Y06H 3GJFB 4PJFF 1J8HB 4NUGL 3UJJH 3MRKA 3S37X 3RWHB 5ALCL 3U0WH 4QRRD 1IJ9A 3RVVC 4NJ9L 4MXQD 2XTJE 4XP4L 4F37K 5AZEH 2XYCA 3IRZA 4OT1L 4BSJA 4G6JH 2Y36L 2X4OB 2J88L 4CADB 2A0LC 1JWSA 1Q0YL 5I17B 5EO0B 3T2NH 4Q2ZB 4JFDE 3WNMA 2IBZX 2IH1B 2X4SA 3GI8L 4FNLH 1U8NA 4NZRL 1UH2A 3B9KA 5GSVB 4YIQA 2PW2B 5J12B 1C7TA 1YMHB 2F9BT 2OR7A 1LMKA 1UXSB 3MPCA 3TN0A 4M61B 2K7PA 4M7ZC 1EAJA 3MNZB 2XI9A 4S2SB 1EIBA 1XT5A 1PEZA 4ZXBD 5IB3B 1EUUA 1BREA 3RAJL 5GJSH 5L2JA 3MRKB 4GAYA 2YC1B 2ICES 1WBZB 5GRJL 3O3EB 1D5IL 1QRNE 5CEYB 3EYSH 2Q7YB 4EUPH 3LKPA 1FFOB 4WRLA 5EOCJ 4E0RA 1V7NH 2DBLL 1KPVB 1HQ4B 5HHXH 3MYJB 4PRBA 1A2YA 2HJFB 5BJTA 2UZIH 2IH1A 2VZSA 5F7DB 2LVEA 3ARVA 3V4VH 2XWBA 3SBWC 1IM9B 1T0MB 3GI9H 1U41A 4JHZA 3PABA 4L4VB 3QUZC 3IXAA 1KC5L 4CL7A 3SCMD 4ODVL 3F7VB 3QFDB 5LWYH 4XBPA 3TO2B 1KT2B 3LQMA 3H7LA 3RZCA 4LEXH 3EYOB 4FQHA 3WDJA 4YDIH 1F4YL 1VFBA 5EOQL 5ALBH 4NSKB 3DBXB 3HE6B 2ZUQB 1BJ1H 4JM4H 1E4KC 2V2WB 4UT9H 3GK8L 1SYSA 5KSVA 5DJZA 1AXSA 4MAUL 2Z92A 2PYEE 5ETUA 5HPMA 5KN5B 1QFWM 2DWEB 4HJJL 3MRMB 3HB3D 4APQD 3GB7A 5TDPB 4DCQA 1F97A 2A6IB 3CH1B 4PJXB 4XMKL 1RZKL 3SN6N 3X3GL 4YHKL 2O26U 1FL3A 1FIGH 3HPLB 4HH9B 3V5DA 3PABB 3S36H 3SDDB 3EZJB 4QEGA 2XKUA 2FGWH 4RAHA 4ZUTB 3VD7A 4KZDH 4KDWA 3TA3B 1I3UA 3VXME 3WN5A 1M6OB 3QAZC 4P2RB 1KCUL 4QY8B 1RQ5A 3Q48A 4ZFOL 5GGVY 3GSRB 2AJZA 3OX8A 1EJOH 3SO3C 5GZOD 3QDJA 3BPOC 3MXVH 3OR6B 3JV6B 2G9HB 4WHYH 1G9EA 4WUUE 5F6HI 1HDMA 4NFBA 5C8JA 4HWEH 3AROA 5MI0B 2F5BL 2RIKA 4Z7UB 4GKNA 3GMMA 3TN0D 4HGMA 5D93C 5J56B 5HHOE 1OAXL 1B4JH 1RVFH 1R3KB 3CLEL 5F7WC 5FOJA 3B2UD 4GBXB 2PW1B 1GVIA 4LCIH 2BVPB 2GK2A 3D2UB 4WUKL 1RIUH 4JFFE 3QIUC 3CXHK 4UTBL 4P2QE 3BZEB 1Q1JL 2AXJA 4M1DH 2ZOLA 2GJ6D 4HS8L 2AK4E 4MQXD 1U8LB 3QO0B 5A2IH 4X7TA 3UO1L 1I7TB 4R8WH 3VG0L 2W9EL 4LVNC 1IEAA 4U1SA 3G6AA 1FQ9C 4JVUA 1XF3A 4CVXB 1WCBA 4TSCL 3RX7A 2E27H 1RIVL 9CGTA 5C09A 5LQBL 3MBXL 2CRIA 1QKZH 1YNKH 2A38A 4OD2A 3VCLB 1AGBA 5E2TL 1U3HD 2DN7A 2R56L 3DIFA 4JO1L 2R1XA 2ZNXA 3X13A 4UI2A 4IRZH 2Q87A 4GXVH 3LV3B 3B2VL 5CFHA 3D2UD 4I48B 1DQML 4P49A 5IT2H 4UT6L 5I0ZA 3WE6B 3FRPG 4UOW0 5IFHH 5KG9B 5D7JA 1JYWA 1B6DA 1U6AL 3MRGB 3N50A 5C9JB 1E6JH 4PRHE 3MRPA 3ARFA 4YDKH 1E4XH 4OV5B 4QYOB 4YDVA 4JPKL 3O8XD 4HKJB 2NY2C 4MQ7B 2FJHA 5CZXC 4XPGH 1N64L 2DLTA 3HNTL 3QA3B 1UM6L 1HHGA 4P0DA 5EU6B 5DEFA 2OM5A 1XFPA 4YE4H 3WLBB 2VXVL 3FB6B 1XR8A 1U8IB 5EULV 4G8EA 1DBBH 3AAZB 4RMQA 1MCNA 3BN9C 3B9VA 4ONFL 2C3VB 5DEGB 3KYMA 4G43A 2E9WA 2P5WD 2VZTA 1YUHB 4PRDB 3U1SH 43CAB 4O2FA 1AIFB 3H8NA 4MHHI 1GGCH 5HVFB 4UILH 5L7XH 3B9EA 3OKOB 3CUPA 4PRAB 2OR8A 4G80A 4LLAA 4F9LC 2DMKA 5IOPA 1GZQA 4D9LL 2VISB 4Z0BH 4P2CG 4XTRD 5LCVH 4LKXB 4D9RD 3K1KC 3P0YH 2A1WL 4G8GE 1BGXH 5E8EB 2X89D 3BP4A 3D69B 1DBMH 3D85B 3S5LB 5T33H 5JW3H 4E5XB 2OMBA 1CDBA 4PRPD 4JDVA 3GJEB 4ZUVA 3F6LA 1F4XH 2G5RA 3OAZH 3N1MC 2EYSA 2Z31A 2OJZH 3IDGA 1P5UA 5GSRB 2WV3A 3MLYH 2OQJA 4HQQL 3FQRA 4NQCA 1HHJB 4QRPA 3WNNA 4Z7UF 4D0DA 4HPOL 5GZNC 3GMOB 4LSPH 3HTLX 4XHQA 5FYJH 2VDRH 3R0NA 4PRDA 43CAA 4F7EB 4PJFA 3TBSB 1JMZA 4YGVB 5DJDB 1RZKC 4MS8D 4KI5D 1M7DB 4YK4C 3CUPB 3HMXL 4KI5F 4FQCH 5GGQL 3LN5B 3O3DA 4PD4J 2P43B 4HV8A 1B88A 1JJUA 2GCYA 4NBZB 5FO8B 4ODSH 4K7PX 4LEXL 4ZS6D 1AGDB 4PJBE 2W0LA 1Q9KA 3KPRE 3S35H 3SDXB 2GJZB 3BYYA 1OAUH 2IFFH 2VLKA 1T7YA 4APQC 4P23A 2LU7A 3BW9B 4C56E 4K7FA 4LRIA 4YHYB 4P46C 1A1OA 5DD1L 1CGVA 3MLUH 4TQEL 4Z7WF 1JUFB 4OCMC 3TH2T 2GY7B 5BS0E 2B0SL 2VN4A 5JXAL 2YD5A 3IB4A 5GS0D 5IHUH 1EXUA 4MJ5B 3HLAB 1QACA 4U1NB 4WWKC 4TNWK 1U92B 2DI9A 4PTUA 4AIOA 4UV7H 4LHUG 1IGFL 1OQXA 4H88H 4M43L 1UZ8B 2XN9E 1KPUA 4LMQI 2R29H 1KN2H 4KKAC 4C58B 3C5JA 1YJDL 3PDDA 4X83A 5BW7C 5FK9B 3S3PA 1OT2A 3BP7B 1FFRA 5K59E 3ARBC 4Q0XL 3B8SA 2X4NA 4JFFB 4AZ8A 4PJBF 2I9LA 4KC3B 5SWSB 3RVWC 4NHUB 5FCUH 4R4NC 4WI9A 1IAOB 4AMKL 4NQDE 1JNHA 3UBXI 1O5DT 5E6ZA 2EEDA 2OZ4A 5EO9A 4LKCA 1ZLSL 1A9BA 1NLBH 2DI8A 4PREB 5F1IB 1M05B 1KXTB 1W8NA 2Q86B 1MWAB 2FZ3A 2DQCH 1NMBL 2XICA 4Y2DB 1L0YA 1UACL 1FVEB 5E8NB 3S9DB 5HVHB 3IAQA 1TETH 5E2UL 5KW9H 3BD5A 4Z7WA 1QBAA 5CJBA 3TBVA 2WINA 4GO6B 4KK5D 3QCVL 4JY4B 3PHOA 4L8CA 5D71H 2BY0A 2Y25A 4F7CA 5JQ6H 1Q1JH 4FG6C 4K7PY 2K7QA 3VXTA 2ZPKH 1BZQK 1A1MA 2YUXA 4WUUD 1AP2B 3G6DH 1MJ8H 2DQUL 1T1YB 5CUSH 5AUMB 1I8LC 1KELL 1G7MA 3RWHA 3WD5L 2ADGA 1FBIH 4RQQB 2AEPL 1NAMA 3O0RH 2D03L 3TBWB 3PV7A 2PYFA 5DTFB 3ZE1F 5GS1B 5JPNB 4OZIF 1S7SB 4OBRA 5IB4B 3QPXL 4OCWH 4F15C 4H0HB 2Q3ZA 3JTSA 1E6OL 1WIOA 2VSDA 2X70A 2YRZA 2Z0BA 1K4DB 3VI3F 4HKZA 3S96A 4Q9QL 3MRQB 3QUYA 4JPVH 3ZTNL 1MCKA 3W81A 3Q2CA 3NAAL 5BVPH 2DYPB 4K9EC 1MAMH 3LKSB 1WGOA 2MSPA 3BRDA 1UXSA 2EDWA 1RMFL 2K3TA 4PLOB 4HWZB 3PGCB 4IJ3C 5DZNA 1CFNA 3UTSB 2DQGH 1ZMYA 4O5LH 4PGCB 4OTXL 1CZ8L 4RFOH 3GFUA 5DD0H 3MRNA 3QJFB 5E9DA 5BZDB 4KK8C 15C8H 4NRXB 1AQKL 1YY9C 4AYFA 5KSBF 4GRWB 1OF2B 3TBTA 2GI7A 4JM2B 1CDHA 2AJXL 3O6KH 5ANMB 1D5XB 4X8JB 5J06A 4NQXA 1Z3GH 4M5YL 1MHEB 4M6OL 5HHOB 5CEYA 2B1HH 1FP5A 3IDIB 4LCWA 1OLZA 4OLXH 1A21A 1EV2E 3K8LA 2V2TA 1KFAL 2P8MA 3GDBA 1FL5B 3W39B 4K23L 4JZOB 4K3DH 4ZYKA 2DYPA 1BQUA 2XTJC 3CFBB 3LKQB 4HMDA 3DXAB 2HTKD 1EEZB 4OB5L 2F74A 1RI8A 2BOBB 5IVZA 1T6WA 4R0LA 1QP1A 2A0LD 3QJFA 3MV8E 5HHME 3V7MA 4QHLA 3PV6A 3QUXB 1UFUA 4KGJA 1MCPH 3RDTA 3KYOB 3MUJA 3CXHJ 4JO3H 3VFUA 1EMTL 3S34H 3SDYL 4AIZB 3CFCL 5DO2D 4BKLA 2EDLA 2ZCLH 1A6TA 2OX5A 2CK0L 4UTAH 3CH1A 1MCIA 1LK3L 5I8EA 3JZ7A 4XBEH 4WCYH 4CVZB 3E3QE 4DK3A 4U3CA 4LIQE 3I2CH 4NO5A 1EAPA 2HT3C 3QUYC 2VDRL 5IEHA 2PYEB 4ODWA 5DVNA 3MJ9H 1JHLH 3BVNB 3VFNB 2DQTH 4CW1A 2QHRH 4U6YA 2IFGA 1BBDH 4XPBL 1NCDL 3WFEL 5D7JC 3O4LD 5D70L 5TE4H 5CSGA 3RL2B 4FFYL 1JGUL 1HSBA 4I13B 4JRWA 4M1GH 3TV3H 4KK6C 1OSZA 3RDTB 1YEDB 3U83A 3JWOH 3V7AG 2J8OA 5IFAH 1CDYA 4AG4L 5GS0C 1RK1B 1KCSH 5E9DE 3I02B 2O5XH 1YY8B 4GW4B 4Y19A 1BVLA 1A22B 3BP5B 4JY6A 5F9AC 3PUCA 3OL2A 3GSXA 4JM2C 1JTOA 4G3YL 1DE4B 4HIHB 1IM9A 2CMRH 3VFWB 1NGZB 2YA1A 5A40E 3O6MH 1JZ4A 1U3HA 4FABL 1LILA 5B38A 4XBPB 1GH7A 1ZHBA 5D7SH 4IJ3B 2I27N 4GRLA 4PJCA 2UZYB 3B43A 2JCCB 3NFPB 1I9EA 1MH5A 2DL9A 3PHSA 4X80L 5C0AB 3IFPA 3VXUD 5ISZD 3D5OF 2ATKA 3BX7C 3NA9L 1QLRB 4OGYH 1L7TL 3RNKB 4PRPA 4PJ8A 4ZDHA 3VWJD 2YBRB 4YFLI 5EU5A 4RCAA 3QFJE 3MFFB 1JNLL 4ZD3H 5AAWA 5ECJE 1YYLL 5C0ND 5DA4A 4AMKH 3OTTA 2B2XH 2JCCE 2A73B 2GKIA 2DQJL 1BQSA 3RVUC 1NC2D 3SDCB 1HQRB 2ATPA 4G6MH 3JBG7 3QUZA 4XI5C 3RTQD 5C2UB 3LIZL 1H5BC 4M7LT 1D9KD 2D7PA 2BOCB 1MNUL 5ESAB 4WO4A 4OSUL 1GGTA 2NLJA 1ZHKB 1IGJA 4UINL 1JZ6A 4J8RB 2J1KA 4G5ZL 1TQCC 4JFXB 3CVHA 2H6PA 4KU1A 1EEQA 4NZUH 2EZ0D 5EBWA 1UKTA 5I2IB 5ALCH 3GMLA 4GG6F 3MLPA 3LRGA 1RPQA 3P40A 5LBSH 4FQXC 4NQSB 1H8SA 5C6TH 3PDGA 3V2AR 4JCMA 4Q2ZA 3QH3A 4U1IA 5J1SC 4XP5H 1XZ0A 3TA3D 2ED7A 3WV0A 3RUGF 2YD4A 1MHPH 2OJEA 5CSZB 2W60A 1SMOA 3K3QA 3NFSL 3GMMB 1MVUB 1FYTE 1NCCL 2AEPH 4I2XB 1T22A 1CGSH 5EU6A 4X7FC 4U7KA 1IC7L 4HSQA 1FFPA 1GGUA 2F8OA 5DMGD 3QUYD 3QPXH 1UWGH 4MZ2A 2FHBA 1GXEA 1QLEH 4O2FB 3DYOA 2AJUL 3LKNB 1RY7B 5I1IL 1EH9A 1S8DB 3PP3K 3WLWC 1U36A 3VD9A 4GG6E 5IQ7L 3PWPA 4XB7A 4KJPC 4QRSB 1TJGH 1S7UB 4F7MB 5KVEH 1YEJL 2RCSH 5JW5A 3QXUA 3BP4B 3SE9H 2UZIL 5C09B 2R4SL 2CKBH 4HKBB 4LCWD 1DUZB 3GI9L 3HG1D 2BVQA 1CN4A 4YLQT 3NCMA 2N7BA 4AL8H 4RRPA 5DLMH 3L5WA 5L0QC 1FFPB 3RWJA 2V17L 5C9KA 3BIKB 1P4IL 1T0NA 4WWKA 1B0RB 2VDPL 3WHXB 5D93B 1SYSB 4R90L 3C87A 2HTKC 3QG6A 1R5VA 1BEYH 4K3DL 3DSNA 5INDA 2ICEB 5ID1A 5I30L 3V6ZA 1G1YA 3IDJA 5KTEH 1S7XA 1DVFD 4OB5H 5D2LA 1FZMA 2VXQL 4KK5C 1MCOH 4O9HL 3QISA 3UTQA 4LLWA 5C0IB 3QUKA 2GJZA 5I8CA 1QYGL 3BEVB 4HGWB 1MCPL 1RJLA 3CMOH 3MV9D 3S36L 4PYGA 1BJ1J 3EYQD 4PGDA 5DYOA 2XY2A 4QY8A 4JHWL 4GH7B 4Z76A 1FZJA 4KZDL 1VADA 4U4BA 2QSVA 5C0BA 5T5FL 3OB0K 3GMNB 4OQTA 2ICWI 1YUHA 5F96H 3UP1A 5IMOB 1MUJA 4YPGB 4OZGE 1DN2A 2NY7H 3L7EB 1B2WL 3C5ZA 3BKCH 1FG2A 4EI6B 2FYYA 2FO4A 4H0GA 4M02A 4P57A 1JPFB 2GITB 1OW0C 1PGRB 1KIRB 4Y89A 3JV4A 5EFIB 2AV7B 4HDIA 4OFKA 2EEBA 3H7BA 1I1FB 2VZOA 4L8SB 1SHMA 4JRXB 4YWGH 4U1GC 4QRRB 4ACPA 2ICWB 3NIGE 4LDLB 4Z9KB 1R3KA 1CWVA 1REIA 3KPSD 1B9ZA 4X7CC 2CPCA 3S5LA 2H41A 4M8QA 2F5AL 4K71C 4DTGH 1T1WB 4M6NH 4TTDC 2Z9TA 1IEBA 4OZHF 4MJIB 5FKPA 1LEIB 3KGRA 5HHVH 4XP6L 2EDKA 2F15A 5IQ9A 1JN6A 2O5XL 3TPUA 3O9WA 2DQEL 4OD1H 4XWGH 3ULVL 5KBNC 4LSSL 3IDMB 1NCWL 1TVBA 2YD7A 4RFEA 5ACLA 3HZMA 3S37H 2AS5M 3I3EA 5AG9A 1Z5LA 2COQA 5DJYB 4LU5L 4UTBH 1HOCA 2HVJB 1AR1C 4IRJD 4MJ6A 4RWYH 1J1OH 1MF2L 1WCBB 2Z35B 4KJWD 4P46D 4S11A 2XPGA 2IPKB 5FDWB 3HHRB 4PGZA 2NTSP 3NCEB 4RNRB 5DRWB 4GUPB 2YA2A 1F3RB 3PWLB 1AE6H 3B9AA 4HT1L 1VFUA 3QPQC 4XVSH 3CNKA 4K7PL 5IBUB 4TYUA 5AUMA 3VGBA 4KTDH 2Z8VC 1F4AA 4ZPTB 4ELME 4QTHA 2F58L 1OVZA 3UXFA 4ZTPH 2ZCKH 3L7FA 3JWDL 1EEUA 3L1OL 5ESVB 2VKWA 1TTGA 4KZEH 3QRGL 4NC2B 4J3OC 5CD5D 1JK8B 3D9AL 3H9ZA 3JTSB 3MRPB 5LAXA 1UZ8A 5DK3A 2VAJA 3LDBC 3NGBB 1EFXA 4JAMA 1OOAA 4CGTA 2FJHB 4MAYB 4WU7A 4GUPA 5SWQB 5EIVA 1OGAB 3UCRA 4AM0B 3E6FA 5CJ8A 1EGJA 2H2PC 5I71C 3AAZA 3UTSA 4CVWA 4N0UA 3BAEL 1FORL 5TQ2H 1PG7W 3SDDC 3NACL 5E9DB 3UBXG 3SKOA 4XP5L 1UXWA 4JHAL 1F6AB 1OAYL 4P3CH 1FFQA 4JM2A 2EE9A 3BGAA 1OTSC 3UTPE 5ITBH 3NFSH 4JJ5B 2FZ3B 4ZOEA 5AAMA 1CD0A 2PCPB 4LHUA 4J7RA 2NW2B 4QHMB 3ZE0F 3FB8B 1RIHL 3GIZL 5HDBE 2F54D 3WSQL 5ADOL 4OUUB 2ID5A 2DQIH 1JGLH 4G42B 3OAUH 4HZLB 1IGMH 2VC2L 3MZTA 4IDJH 2X1XR 1YMHA 5D7IB 2IQ9H 3TN0B 3RY5A 3MV9B 4V1DA 1QEWA 1KTLA 2BSSB 5I1CH 5D72H 2AJ3A 2VSCA 5GSRA 1F4XL 4MSWB 4R2GB 1R3HA 3BESR 4S1SL 5L2JB 3MNVB 1MCJA 5HYQA 1DQQA 4RQQA 3OXSA 4HPOH 4G8IB 1FYTD 1I7UB 4DOHB 3NBNA 1WWCA 4AIZA 3MGOA 1KN4L 1A6TB 3BMWA 2HN7B 3LCYA 5I66A 1ZEAH 1G6RB 2OL3B 2HMID 1H3XA 2EDQA 4LIQL 4WI8A 5BJTB 3STZA 3VDCA 4U0RB 4IEFB 2ZUTA 4IMKC 1J8KA 1A9EB 5C0GB 3BN9D 1INDL 4HCRA 4DFIA 3L3OA 5HDBF 2I60H 3G04B 1DSFH 3TJEH 1XGRA 2XOTA 1BVZA 2BSSA 4XAWH 2W0KA 4NYLA 3NIFF 5J0BA 5D8JL 3V0WL 2Q6WB 3MLUL 4N9OB 3VJ6A 2ITCA 1WZKA 2ZSWA 5F1NB 3S4SB 1YEKH 4WEUD 1RUQH 2ICCA 2VDQH 5DHVH 4HIJB 4QT5B 1VKXB 3PL6B 5HPMB 1FZKA 1OARH 3PDOA 1S3KL 2HLFC 2DM2A 4F33B 2HRPL 3C5JB 5CKAA 2V2TB 2VITA 1II4E 3KYAA 4QTIH 1SEBA 5J6HA 3K4AA 1N5YH 3FN0H 1CLYH 2AXGA 5A16B 1A9EA 5C0GA 4MNQE 1LK2A 1QFWI 2FD6H 5FA4B 3H3PL 2GJ6A 1X3DA 1MFCL 5KAQF 2NY0B 1WIPA 1JNHB 3U7YH 1CQYA 2I25N 2JJSA 1MREL 2EDOA 1J8HA 4X6DB 3GIVB 1CLOH 3RDTC 3FMGH 3CXDH 4NN7B 1HHKA 3IFNH 3F58H 4YFEA 3O3AA 2WQ8A 2PNDA 1BP3B 5IW1B 4Y1AA 1NCAL 4I4WB 1NL0L 5DK0B 3QUXA 1MELA 3HC3L 1M71A 4Q9RH 1RU9L 4TN9A 2WUBL 2BHUA 4ZFGH 4DTGL 4FOMA 1EUTA 1RJZB 3KLAB 4JR9L 1NUDA 5DK2A 4LVHB 4YIQB 4XP6H 4PJIF 2DMBA 1CLZH 1V05A 1NSNH 2RAMA 1NAKH 4OF8A 5IKCB 1IE5A 5T5NG 2QQLL 3WS3B 4A6YL 3P77B 1HINL 4KKBC 2AKRB 4FQQB 3QCVH 4CW1B 4PGJA 1PQZB 3AB0B 3UTTE 3I6LE 4E41E 5FO7A 3EIFA 4NKMA 4XPAL 3QDJE 3IFLH 2BNUB 2OSLA 2MJWA 3FT4A 1HSBB 3R8QA 3RP1A 4OM0L 1C5CH 1G7QB 4X7DC 3ROOB 3KXFE 4YFLF 5GGRY 5C0FB 4P46B 3MRQA 3QUYB 4KXZI 1G9MH 3WKNA 4EDXA 3LS5L 1Y6MR 4LNRA 2EICA 3P9LB 5TFSL 4WO4D 1UT9A 4CMHC 5KSUB 1MCDA 3LVEA 1JP5A 3TLRA 2XG5A 5BRZE 1X6LA 2BZDA 4OZGB 2VDNL 3BPCA 2EKSA 4LLQB 4NQUA 3VFMA 1NUNB 3ARSA 2FIKB 5ELIA 3QRGH 4FQ2H 2IQAA 3QUXD 2HKFH 4LVOC 1B0GA 1A4KB 4F8QA 4K3EL 3RGVB 5DDHA 4QRRE 5JLZA 3PWJA 4MB5A 4XP1L 5IGXL 1AQKH 3X12A 3WIHH 3LDBB 2Y06L 3WFHA 4NKIH 1WSST 5C07D 3UJJL 1E4KA 1FRGL 2DQFB 2X4RA 1LO2L 3V4UL 4OD3H 5D1ZA 1MFBH 4KUCF 5ITFA 1N7MH 2EYRB 5J3HC 3ARBA 4M9PA 4KQ4L 3GBNH 1P4LA 4PR5A 5KS9F 1KLFA 5DGQA 2XRAH 3QA3A 1HQRA 5IV2A 5A1AA 2DJUA 4NZRH 1PSKL 4W6XB 1I9IL 1MCHA 1SVZA 1U8IA 3CU1A 1QR4A 3EGSA 3VXSA 4Q6YA 5D2NB 2CIIA 3T1FB 3MJ8A 4IRSC 2ZG2A 3HC0B 1MCRA 1G0XA 3KYMB 1UJ3B 5L2KB 3HB3C 3EO1B 2RFXB 4PG9B 1OGTB 5CHNA 4MVBD 4UDUB 1LDPL 4N0YL 4OGAD 2WBKA 1V8HA 4P99A 1BLNA 3AB0C 2LQRA 5DS8A 3I9GH 5GRJH 5D1ZB 5L9DL 4GKNB 4HLZH 1ZHNB 1HSAA 5DVMA 2CK0H 3Q1SH 5C1MB 2V7HB 2PYEA 1MFEL 4LLWB 4P2OD 3ZMRA 5C0IA 4IS6B 3UZQA 1H3VA 4PJ5A 5DJ0A 1F90L 5I8CB 4DZBB 1IGYA 2D7TL 3TT1L 2I24N 5HGAB 4PGDB 2HWZL 1WQVT 1MRCH 4P9ML 4PV8A 3T77B 1VFBB 1J12A 3BI9X 4F57L 3ZHDA 3W11D 2JJTC 3LS4H 5F7UA 2AQ1A 5JMRA 1G84A 4RA0C 4NQEE 3DTXA 2X1OA 2RFXA 5DR5H 1JHKL 3T0DA 3MLRH 5HHPA 1MCLA 1MQ8A 3U46A 2QQQA 2A6IA 3T0WA 4EN3C 4I0PA 3ELAT 2FX7H 1F58L 1YEGH 4WW2C 4XBGA 1X5GA 3QB7C 4WGWB 2IBBA 2WBJC 5HYJB 3TZVC 4NT6A 2H2SC 2VRAA 5IMMA 5JW5B 3UDWA 3IU3B 4PJ5B 4HKBA 1EBPA 1ZTXL 1A6AB 2R1XB 5F7LB 3X3GH 1KCVH 3RVTD 1OARL 3NTCL 2R0WL 1DANT 5ICYA 3G5YA 4XAKD 4DFHA 4WWKB 3WE6A 3W9DB 1YEEH 3RU8L 1JGDA 1CL7L 3WFDH 3HR5B 4BYHA 2YPLD 3D3VD 3MV7A 4OGYL 3BSZH 2C3HA 4MJ6B 3EHBD 1H3WM 5C9JA 2FEEI 2APFA 5HYSB 1EVTC 5DJ8A 2C4FT 4XBGB 1WT5C 2Z4QB 5EWIL 4Z7UA 1P69B 1IM3B 3D87B 4NQEA 3QJHB 1QG3A 1RJYB 2WW8A 3JVGA 3NIDE 3DUHA 1SEQH 4FNLL 2ICWJ 1Z0MA 4LSTH 2YSSB 1QBMH 1ZXQA 2ORBL 2QSCL 4TRPH 4IOSD 4QRUB 4Q6IB 1D6VH 1OP5H 5JHDE 5BRZA 4NFDA 5LKNA 4JFYA 1JV5A 4CN1A 3UJTH 4NZTL 1KYOJ 2EIZA 2V2XA 5IIEB 5SV4A 1PEWA 3SE4C 4RBPK 4G80B 1AHWB 1SJHB 5CBEA 4PRNB 4HXBH 3HZKA 5DD6A 4NQED 4EI6A 1PLGL 4D94A 3TYFB 3OKKB 1P6AB 1W8OA 1GSMA 3JSSA 4UV4H 1RURH 4KJYA 1GPOL 1MVUA 3RY6A 4KUZL 3DPBA 5D5MA 3PF2A 1ACYL 4PG2C 4WY7L 3OPZL 4UAOB 1FFNA 4HUNB 1NBZB 5LJYH 2EYSB 1K2DA 3U6RB 3HNVL 5I1HL 4NRZA 4Z7NE 3NIDF 4JREC 4K3JH 5HJ3A 4KK9C 3GMRA 1QKZL 1YNKL 2IADA 1GL4B 3MC0A 1FCCA 2MNUA 5I1JH 3O9WB 5I16A 2R39A 4PJFB 4BQ6A 2R56H 2HT4C 4DVRL 2G75A 5HY9A 4OF0A 1S8DA 5DJAA 5MEOB 1H3GA 3LN5A 5KG9A 3VI3E 2J4WH 3HUJF 4Y4KD 5I6XC 2MQ3A 3PGFL 3RWDA 5IB5B 1S9VB 1CG9A 3DRTB 2XFXB 3N1PC 4X6DE 1NGXA 3U48A 1R0AL 4LFHG 3K46A 5H37H 5IQ7H 5HYFA 4HJJH 3CU7A 4G42A 4KMTH 3V8OA 5J1AB 5KVEL 1P7KB 4WHDA 3TVMA 3AXLB 3DO7B 3ULSA 2APTA 4ZXBB 4OUOA 5EPMA 3MR9A 2VLJB 1BHGA 1MI5B 4S1DC 3DVNB 1OB1B 1S9KC 3F8UB 2VAAA 5C3TA 1B0WA 1N64H 3HNTH 2FATH 1UM6H 2QJDA 5F7MC 4KHXL 1UGNA 2BVOB 1KJVB 2IBGA 1IQWL 4O4YH 4TOYL 4D8PB 1WFUA 2DKMA 1D5XA 1CFQB 2UYLA 2XRAL 2DTMH 4LPYA 1T03H 2XZQL 3FB7B 1VEPA 4NQVB 4DW2H 3HUJE 1HILB 2JB5L 4X4XA 2CKNA 5C0DB 4P23D 5IB1A 2DLGA 4XP9L 1MCFA 4ZYKB 2GTZA 3QCUH 3HMXA 4QO1A 4YC2C 1KIUA 3QQ4B 4LSQH 3LEYH 3BKJL 2H45A 3K8KA 4CMMB 1LGVA 4HK0A 1J1XH 5A43C 3SE3A 1KACB 3OSKA 5E7BA 2R2EA 4P2RD 5F1NA 5F7FA 1ZHLB 2VXTL 2CDFB 1WV7T 1YQ2A 3VFUB 3SJVB 4OKVB 3MLYL 3ZSTA 4NQCD 4P2OC 4QRPD 5H8DA 3LPGA 3JWOC 4DGVH 1VEOA 4M3KB 3WFCH 5T1LD 2LE9A 3ULVF 3WO4C 4RGMB 2AEQL 3QWOA 1T20A 1G7LB 3GHEH 1FH5H 1FPTH 3HMXH 4J6RL 3S36X 1ADQA 1IGIL 3O8XA 2GJ6B 1JVKA 2YA0A 3VFNA 4X6DA 4HUVB 1RUMH 5TE6H 1LO0H 4OV6F 1PYWB 1HK6A 2H2SD 4MZ3A 4XXCA 2EDHA 5GGVL 1NC2B 4L3CA 1P53A 2WM0A 5E8PA 2F54E 3GRWA 3T09A 1JBJA 2DQEH 3FT2A 4WDIB 3L3GA 4HHAB 3ETBF 4OLWH 3TA3C 4ALAH 2HTLD 1I7UA 5MHSD 5GGSB 4UU9B 1A0QH 2Q1EA 3WHE0 5JUEH 2VLME 3MV7E 3VWKA 2BRRH 3OKLA 1KCVL 1CI5A 4IHOA 3HE7B 1JF5A 2J8UE 1NGWB 5IFHL 3QEUB 3RVTC 2R1WB 3BGFB 5A2LH 2E9BA 2XG4A 4PUBH 5IEKA 5IJVB 4HWZA 2X4UA 3VMNA 4Z7VA 1K8IA 1I8LA 3HI6L 4H8WH 4JPKH 3MRNB 1I3GL 5E6ID 5JA8B 3MREB 5F6IC 5J6GA 1BFTA 2EIDA 3NFPA 2E5EA 2NY1D 1OF2A 3L95B 4FFVD 4UBDC 2ZSWB 4L3CB 1N26A 4HXAH 2R0KL 2ESVA 3D48R 1UEMA 4LCYA 1OGAE 2SEBA 4LQFH 5I19L 4NUJB 2FIRT 4L5FH 4RFNC 1FL5A 3W39A 3O9WD 1KSRA 4HK3J 2QKIB 1CFBA 3DETD 3NMEA 1AHWC 1A1NB 4WU7B 5FB8B 2RB8A 1U3ZA 4LGPB 1U0QA 4XNYH 4HJ0D 3ZZ1A 4S0SD 1YQVL 3NN8B 3TO4B 1XF4A 2DDQH 4F7CB 4X99B 5TF0A 4Z0BL 3E3QC 4ODUB 1MPAL 5LCVL 5E8OB 4HW6A 1G6RH 2BHYA 4LLQA 2W92A 3FO2A 4M6MH 1TETL 2EH8L 3BUTA 1ZS8A 5JOFA 2P46B 3MRBB 4RISL 1AY1H 4PLKD 3IF1B 5IP4A 3BAEH 3BP6B 3ZKSD 1QRND 8FABA 1R3JA 4GW1B 2Y36H 2CO7B 4KKAD 4ODTL 2C7UA 4P3CL 3BXNA 4J3SA 1M71B 5GS2H 4P4RA 3DGGB 4PP2B 5CUSL 5E8DH 3UTTA 1UWXH 1ADQL 5ITBL 3EYVB 4LSPL 5CGYC 1HHHB 4MQSB 5JXED 3G08A 1XZ0B 5SV3A 3HAEH 3QUMB 5F88A 5IHBA 2PTVA 3QBTB 5GHWH 4CBPA 1OTUD 3AGVA 1RIHH 3MV9A 1QEWB 1YEFL 5EZJB 4D2NA 4ODSL 5ACZB 1MJUH 1IL1A 3P77A 4WV1A 1P2CB 4CUCA 1URLA 5D72L 1OAUL 4POUB 1RMFH 3LB6D 4AT6A 5ESQA 3EYSL 3L3DA 4O5LL 1BFVH 5JXAH 1DP0A 1LEGA 2A6DA 1V7NL 2DBLH 1FGNL 4CADA 5DMYA 3L5JA 4FQJH 3C5SB 2QTEA 3LPWA 3CFDB 3P30L 5D9SA 2P8MB 4KGLA 2QQKH 1XF1A 1JF1A 4PGEA 2RGSA 5I1AA 4U0RC 1Z3GL 3STLB 1TVHA 2PW2A 5F7NC 1J9CT 2OS7A 2FATL 1JWUA 3MLXL 4M9OA 1TCRA 5FA3B 3SDDA 1HH6A 2FJGB 3BHBB 3NZ8B 3TPKA 2GHWB 1ZWIB 4ETQA 5IVOA 3TVMD 1KJMA 4K8RC 2GW5A 3CPLA 4JKWA 3D25B 4MHHG 1DQJA 3DI2B 4Q0XH 3VE0B 4HUXB 1TZGH 3HRZB 2XZQH 4LF3A 3PV6B 5TDOB 3GK8H 5C0JB 4MD0A 4DW2L 1BZ7B 3OQ3B 3WNLA 2YPKB 5KVDL 1BM3L 2EC8A 3EO0B 1BBJA 4WFFD 4R2GC 3QG6B 3WJLA 5HYSG 4R26L 3ULUD 5CBAA 1QSFA 5I8KL 3RBGA 1T21B 3K0WA 4YAQA 3RVVD 3WO3B 1J11A 4X6EA 1NC4B 1RZKH 4I0PB 1Y18B 3WXWH 1J0HA 2DD8H 1HKFA 1U3YA 1KPRB 4ETYA 1F2XK 3K81A 4W70A 3CX2A 1J1XL 2GK0B 3IXAB 2XXMB 5I8OL 3DO3A 4S1QH 1N8ZA 4B53A 3HZYB 4N8CH 1WWWX 3VDAA 1X5KA 4POYA 5FGBA 1LK3H 3WNPA 1A6AA 2YR3A 1KJMB 5L88H 3RA7L 1IMHC 5DYOB 1DFBH 1D6EA 4X5LA 5KSBA 3VA2C 1G6VK 4LAJH 1DANU 3F7QA 3FONA 4W4NA 5E94B 5IK3B 4YXKH 4QCIA 4XCNA 4BSWA 2DQTL 4N1CA 3HR5A 1FL6B 1QBLL 4IMLA 1FH5L 3MUY1 1KF9B 4OCLC 5DHXB 3GRWL 2DQUH 4EUPG 5EU3A 2JIXB 3S5LG 2FO4B 1P7QD 3G6AB 4OJFL 3TYGL 3MGTA 5HYSA 4M1GL 2Q8AH 4MYWB 1NGQH 3RL1A 3MOAL 1KPRA 1ZLUH 3G5XA 1B4JL 1RVFL 1DQLL 5GGVH 1WTLA 1UYWL 4TUOA 4NQEB 1F3JA 3RTQA 3RWCB 4ENED 3BJ91 1J86A 5DJ0B 2V5YA 1I8MB 1MQKL 2WLYA 1OAZL 1KIQA 3QDME 5JNYA 2VLJD 1MH5B 3QIBA 1AD9A 3DECA 1JN6B 4X6CB 3O6ML 2NY6B 1L9NA 3UTOA 5E94A 3MBED 4P3DA 5IBLD 2DOCA 4XPAH 4NM4L 4XVUC 3TH3T 2AJZB 3OX8B 3IFLL 3VFTB 2X9WA 1RZJH 3FQNA 3VMOA 1GC1L 1KJ2H 4XNUH 3QNZA 5J11B 4OCRL 3SDAB 3ALXA 5CINL 4MQXC 4M5ZH 3OKKA 3DVFA 1HNGA 3U30C 3AM8A 2JJSC 1U8KA 5DC0A 1G9ML 3C2AL 3VXQA 5HYJA 4GT7A 2B1HL 3ZLQC 4KDTA 4XC1H 1HHGB 1F3JB 5B4MD 2JTDA 4Y5VC 2ZP0T 5EZLB 1KNOA 2YWYA 2AK4B 1Z0NA 3L5WB 2YPVL 2YD3A 3SY0B 4I3RH 3E0GA 3BE1L 4ZO8A 4LL9A 4I18A 2MHAB 2LU4A 4ONHA 1G7PA 1OWRM 3VFRA 2MQ0A 4IDLA 3CJJA 3MJ7B 2NY0D 4JM2D 4XNYL 4UQ3B 1YQVH 2DS4A 5DC4B 3VFTA 2CIKB 2X4RB 4JANA 4LCCC 4XGZB 3O3BB 1E6JL 3OZ9H 4X4ME 1CICA 3OB8A 4E41A 4KRNA 4G8GD 4U1SB 4R9HA 1AFVL 3O45A 3SE8H 2EH8H 2NNAB 3E6HB 4ZSOB 4JO3L 3V4UH 4X5WB 3GKWH 3WIHA 2Z91B 4PR5B 4U2ZA 5E03A 1SJEA 3MSPA 4OIAA 4UTAL 1MRDL 3R1GL 3MLVH 5DVLA 3ZDXE 4M7KL 1CXLA 1MCWM 4AENA 3OG6B 3OKYA 4ONFH 5JQHC 3VXSB 1BF8A 2H1PH 3WFBH 3PP3H 3DSFH 3H42L 4NNYB 5JIHA 1EO8H 1QSVA 1NCCH 4KROD 4KI5E 1N59B 3KXFD 3WFZA 4GJTB 1FG2B 3NH7L 4W68A 1IAII 3MX0A 3W11C 3ZE0E 2NY4B 2WBJD 1S7VA 4PJEF 1IAMA 5F9WC 2C26A 5JHLH 5HGDA 1PG7L 4HUUA 2NW2A 4GRWH 2AJSH 4I77H 4J2XA 1KLGA 3CFJB 3CCHA 1ZHNA 1A14L 5I74C 1YPZA 2V9TA 1I1YB 3ZL4L 4S0TD 3IAGC 5F9WB 2EDJA 3F7RA 1MLBA 2X1WL 2O61B 1P7QA 1QPXA 5HI4C 4ZO7A 1H9VA 1FV1A 3PP4H 5D7LA 1DLHB 2D7OA 3SGJC 1U8JB 3QFJA 3BUYA 3MRFA 4HS6B 3VRJA 5IHZA 4LARL 3SQBA 3F5WB 5DRZA 1NGYB 1AQDA 4WU5B 1SJVA 4HK0B 1R3HB 3GM0A 4LLUB 2NY5H 1PJ9A 4ISVA 3T4AB 5FECA 3HAEA 4OF6A 5INDB 4U6HB 5FV1L 3MLXH 3TNNB 3R4DA 3FQXA 2YD2A 1KXVC 4MS8C 3U7WL 2NY3B 1QZ1A 1R24B 3QI9A 4D0CA 2EYTB 3BRFA 4MNGB 2Y4SA 3MMEA 2JIXD 5E00A 4I3GA 1G6RA 4TTDD 5DD3L 2IFFL 4UB0H 1R3LB 2F19H 4CJ0A 1H5BA 2EDDA 4IIQB 4PLKC 3KPQB 4HD9A 1U8JA 3QFJB 3VRJB 2VL5A 1S78C 4NYLB 4HUVA 4N1EA 3H0TA 3IDUA 1AD0A 3VJ6B 5TGBB 1QYGH 1TZIB 4Z7OE 1RHHB 3LIZH 4X6FA 4ORGA 4QKXB 1C12A 4ISVB 4LPUA 3SEPA 3L3KA 3D18B 2MCPL 3WDHA 5I9QC 3NOIA 3DXAE 4OSUH 1KN2L 4HUMB 4HLZG 5F6IB 4S10A 3VXUE 1QFUL 4QHNA 5I75C 5L88L 4XNQA 4DGYL 3QDMB 2PR4L 1SEBB 1S7QB 5DMJB 5I9QB 2J8HA 5B21A 5C0DA 2EE3A 3PWVB 4FHBD 2ENYA 3C60A 4JB9L 1K6QH 2X4UB 3KPSE 2AEIT 2YSSA 4G9FD 1OP3H 4TNVK 5HHNA 2D0GA 1ZA3B 1MHHA 5E7FA 3ILPA 3CC5B 4YWGL 2VLRA 2CDGA 4P5KB 2YD9A 4GRWE 3ISWA 4QXUL 2QSCH 4P48A 3H0TB 4RDQF 2CH8A 1Z6JT 1BAFL 3K1DA 5IW1A 3QXWA 2PYFB 5DTFA 4N68A 1OAQL 2ZUYA 3PQYA 4ZTOH 2V9RA 3FO0L 3LPFA 4Z18A 2NTFA 2XTJD 2WLZA 4PJIE 1A6WH 4ZODA 1K4DA 2F8XC 1MY5A 1UM4H 4EUPA 4HC1A 3VH8B 5DK2B 4WFGE 4QGTA 2VXUL 3TVMC 5KSAB 1WAAF 4S1DD 3ZDYE 1RURL 2RR3A 1KTLB 4XHJC 4XPFL 4TPRL 5CP3A 5F9OL 3P2TA 4GKZB 4UQ2B 1DVFB 5HJ3B 3WD5H 1PQZA 3A6CL 4JO2L 4OFDA 4XNUL 3VXUA 5TF1L 3MNVA 5HYQB 1DBKL 3GHBH 4TSBL 4LKCB 5BZWA 2FEDD 5T1DL 4IMKA 2ZWLT 2FX8L 4G8IA 1RHFA 3Q5OA 3X14A 2FJFB 4GW1A 4HT1H 1C16B 4C83B 4GG8A 1NANI 2Y6SC 4N8VB 3L5HA 5T1MB 1VACA 2X4OA 1Y0LA 3F12A 5GGSA 1D7FA 4YPJA 5DMKB 5K33A 2B1AH 1JYXA 3VH8G 2VLJE 2IH3A 4DEPC 1OWWA 5BVPL 4ZTPL 3OKLB 3F7YA 3L1OH 5EBLA 3QEUA 1ZKAA 1DBJL 3HFML 2I5YH 4P2YA 4PJGF 1MFAH 2BVYA 4TSAH 3RZWA 4KZEL 2FLBT 2Z8SA 1XGRB 3GO1H 3FOMA 1U2HA 3DXAA 5L6YH 1G0YR 2A74A 3DVIA 5C86A 1CZ8H 4RFOL 3O6FC 3RBSA 2NY3D 3ESVF 2BCKA 4UQ2A 2CO6B 2OK0L 5DHVA 1NLDL 4UUJA 5T1KA 4MA1C 1KIPB 5D1QC 1S9XB 3P11H 2JKXA 3FT3A 4LPXA 5F3BB 3KYOA 4X98A 3TBWA 1JGEB 3GKWL 2HLAA 3EOBB 4IRJB 4DVBA 5KVFL 3TT3H 4XMLH 3CGTA 3DX7B 2SEBB 1W72H 3MRHB 3FB8A 2QBWA 4JKPH 3H3BC 5I8EB 1WC7B 3DYMA 2C1OB 3X11B 2W9DH 4U1LB 1JPGA 5B38G 1TPXC 1AGCA 1EO8L 5ILTH 3FB5B 1WLHA 4C54A 1LK2B 2WMPA 2NYYC 4V2CB 3WEXB 1U91A 2W1NA 1Q9WA 3QG7L 4PJHB 1WZMA 1QVOA 3MODH 4PGCA 2IMNA 4ONGL 4UDTA 5FFLA 3VXNB 1TTUA 4L9LB 2ZCHH 5F44A 1U8HB 4YHML 1OTTC 1TQBB 2AJSL 4I5BB 4YNYA 4D0BA 5HPOA 3CVIL 3PWUA 4NSKA 1NQBA 1BOGB 3ZT7A 4G7YH 4DUVA 4WIQA 5L2KA 1FJ1A 5DHYA 3SDYH 4XCEB 2XY1A 4HUWB 1BZ9B 3P4OB 2NMSA 1KB9J 3IDIA 4LCWB 3FRUB 4S1SH 2IAMD 3PP4L 5EZIH 3VFGH 4XI5D 5T3ZH 1K8DB 1TCMA 3S37L 2CLRA 2Z93B 3U7AA 3ARRA 4LCCB 4GQPH 5FUCC 3REWB 2FECI 4M93B 3SGEH 5SWZE 3GHEL 2N4IA 1GHFH 2ERJB 2PO6C 3AREC 1AKJA 1BD2A 4G9FB 4B7LA 5I6XB 3UJIL 4FFYH 2OYPA 4BFBD 4PV8B 1HHIA 4IM8A 1CU4H 4F8TA 5HSFA 3K2UL 2UUDK 1ROWA 5D7JD 4ZS7H 4YHZH 5DD3H 4IMLB 1RZ8A 3JUZA 3L3DB 2NZIA 5F8RC 1YY9D 4XMPH 2MPAH 3U46B 4LNRB 4P5MB 1KTDB 1I1AD 2LVCA 2ZCKL 4PYHA 3LEXA 3U0TB 4KKBD 3N85H 3VGAC 3RY4A 3L5XH 4WTXA 4ZUWA 5JXEA 2NX5B 2LTQC 2C4FU 3FL7A 1CXIA 4R2GD 3K8MA 3SDXE 4ETQB 4WUUB 4H5SA 1PKQB 2UVFA 2PW1A 4B7IA 4FQHB 3QIBB 3LHPL 1WEJL 1AD9B 3T4YB 3MUGA 3SO3B 1QRNA 5ICYB 3LOWA 4N0FA 1S7TA 2HH0L 2PN5A 2VLMD 3W9DA 2X05A 4Y4KC 4XP4H 1PZUB 3QI9C 1JNLH 3GBLA 4P4KD 2NY2D 3MV7B 3UYPA 4QHUB 1GOFA 5ITFB 4L9LC 3SQOL 3FFDA 1NL0H 5FHAL 2M8XA 4LQFL 5I19H 1RU9H 4LCUB 2YS4A 5EUKA 1TZHA 5DUBB 4PRHD 2L7JA 4X99A 3B2UC 3WNKA 5HVHC 3P4NB 1J88A 2ZUXA 1X4XA 3VI4E 3B5HA 4K8RH 2AK4A 2D9QB 4ZTOL 3MO1A 4H5SB 4JFOB 4LAQL 3X13B 2NYYD 4H1LB 4G5ZH 3HC0A 1OGAD 4LLVB 3SDCC 3V4PL 4G6KH 1CGUA 1AY1L 4Z7VE 3QDJD 4CDHA 4YBLC 1FL6A 5BOZG 4A6YA 3WCYA 4ENEC 2JB6B 3V79C 5CZKA 1X5HA 1F02I 3MRGA 4H20H 1ZOXA 1OQOA 1A02N 2IPUG 1OP9A 5IVXE 5LGHL 1OSPL 2D9CA 4P5TB 1W72A 2PTUA 3IETA 5EZJA 3OJ2C 4LPTA 2FEDC 3TFKC 3EKCA 5IBLC 2AAVA 4NKQB 3WDIA 3I75B 3BIKA 1I8IB 2X5PA 1QFWL 1MJUL 5HHOD 2NLJB 4MVBC 4ERSH 4R4BB 4ZNEA 2VDNH 1BWMA 3TJEL 4JFXA 1IARB 5I1IH 5IUSA 1JE6A 3X12B 4I9WD 5ID1B 1FFOA 1OW0A 3BISA 4FQ2L 4XVJH 3WFHB 5C7XH 4AQ1B 5EOTB 3C60C 1NDMA 3W5NA 4Z7VF 1AR2A 3U0WL 5BQ7B 3ARUA 2YK1H 3EFDH 3I6KB 1F6FB 3IGAB 3C6LD 1LP9E 4NJ9H 4P2QD 3V52H 1G7JB 3H9SB 2EYRA 3STLA 1ES0A 3SE9L 3J8F7 3ARBB 1JWUB 2R4SH 2YRPA 3BH8A 3D39B 2QQKL 1FIGL 1PW3A 3MLTA 5F7EL 4QHKJ 1KT2A 2A83B 3Q0HA 1A7BA 5IV2B 4OI8A 1MSPA 2E9JA 4P59L 3JTTA 3EYOA 1J5OH 3STBA 5T1LB 3D25A 1N5YL 1KXQE 1JI2A 4XMLL 4LQ1A 4WGVB 1IAIH 3QWQB 3RWEA 2FB4L 3V6OA 4NOBA 1UKSA 2JJWA 3VWKC 4ODHL 4OFIA 1RK0B 4KJWC 3ULVD 5DJZB 3ARFC 1MAKA 2HTLC 4W81A 1S9YA 2AK1L 3LKNA 4XH2A 5EC2B 5CP3H 3C5ZB 3S6CA 3RUGB 5B8CA 3FKUS 3NCCB 4JLRA 1J8HE 1BQHG 3IFNL 2VXSH 1A6UL 3AREB 4O9HH 1MJ7L 1S7RA 4Q9RL 3RVWD 4HWEL 2NY5C 1NPUA 2GK0A 2V7HA 1FSKB 4YHMH 3WIFB 5CKGA 3O11A 4GQ9H 3PWNA 4HJGA 5JORA 2ZG1A 2RHEA 2CXKA 3CLEH 3RFZC 5L9DH 1ZE3C 4YK4B 1EPFA 3Q5YA 2CUIA 4LPCA 3OMZA 1ZT1B 2HRLA 4MNQD 5LWYL 4HWUA 4CVUA 2AI0H 1YA5A 1B2WH 2BHZA 1IBGL 5L8LB 2J6EA 2VABB 2YHGA 3MV01 3T2QA 4P9MH 2H32H 3C6LA 3SJVA 5EOQH 1T3FA 1NAML 4JDZB 1ORSA 3HS0A 3QT2A 3MV7D 2DQDH 4LBEB 1OY3B 2AJVL 4URTB 3BMVA 3TCLA 3W0WB 2ERJC 4K8RD 4MAUH 2BSED 5MP6L 4L1HA 1D9KA 1K2DB 3QUZD 5MERA 4HWNA 3A0OA 4XMKH 1LP9A 3D2UA 1INEL 2MPAL 1CD8A 4P5KA 5GGSY 4Z0XB 1OAZH 5DRZB 3C6SB 4ESKA 5IMLA 5JOPD 4M4PA 1QA9A 4PRHA 1AR1D 4IRJC 2VDOH 1DQMH 5IT2L 4XAKE 3BT2H 4LU5H 5E8PB 2VDLL 3FT2B 1EGJL 3EJZC 1IC4L 4KROB 3JVGC 2JELH 5C6WH 4OM1L 3DRTA 2XNAB 3V6OE 5LAXB 4Z5RA 3FN3A 1FNEB 1RZJL 1VDGA 1FO0A 1YEEL 3ARBD 1U6AH 1T1XB 1I9RL 4OAWB 4MCYA 1ZGLB 4LGRB 3L6FB 5IW6B 4JRXA 2OZ4L 3PXHA 2ZSVA 5E24E 1YYMH 2WINB 3ZHLA 1IQDB 4JY4A 5IEKB 5IJVA 1UENA 2FSEA 2R0LH 4OZ4A 4Z7VB 5K9KB 5EWIH 1CK0L 5C92A 4OLVL 5KVMC 4Y8DC 2VAAB 4KTDL 1DBBL 1C5DA 1PY4A 3BOVA 2WIIA 1JL8A 4NRYA 3THMH 3KLDA 4PJIB 3VXUB 2C5DC 5IQ9B 3GBNL 1J1PH 4LNVA 1OAXH 1CE6A 4C56D 3DUUB 4DN3L 1A7OL 4X6FB 2IAMC 2ORBH 1ZT4B 4J3WA 1BPVA 3ARXA 4JO4L 5T1MA 4JN2B 4E41B 3F7PC 5BO1H 4WI3A 4WUKH 3KPTA 5J13B 3CFKA 1XR9A 3KPNB 3E6HA 4ZSOA 5HI4D 2Q20A 1TJHL 4KH2A 4U3XA 2VZUA 3F7YB 3BQUB 4HS8H 1NFDA 2H9GB 3ILQD 4HFUL 1PLGH 5D7IA 4MGXA 3FOMB 5B8CC 1ZLVK 4C4KO 2G2RB 4PJFE 5DJCB 5TQ2L 5C0EB 2EEAA 3LZFH 3OKNB 4L8SC 1RZGA 4NHUA 1DBAL 4R96B 1A7NL 1ZA3A 2C4XA 3H9YA 2OJZL 2WIIB 5BZDA 3ZKXC 2R2EB 3RKDD 3KHOA 5E2VH 1N59A 1F90H 3IF1A 3KNBB 4NKOB 1IZKA 3D0LB 1ZT7B 4PJ5E 4M3JA 5FGCE 1WFNA 5MEOA 3RIAK 4KVNL 3LH2H 4G6FD 3UC0L 4BK4A 4BQ9A 5HGDB 4Y2DA 1I1AC 4K3JL 5JOPE 1XGYH 5IOPB 2D31B 3PQYB 2P48B 2ZUSA 3LS4L 4IRZL 3WXVH 2B39A 5I66B 1WUNT 4R6UA 1G7LA 5JHLL 5EIQA 4F58L 4NJAL 2FDBP 2ESVE 5E6IC 4P2QB 4JZOA 3BQUA 4E5XA 1FZOA 2G5BB 4JZJB 1JGVH 1DDHA 2GT9A 2XN9A 4U05A 1NFIA 3AXLA 4I0CC 3DO7A 5HTSA 2PO6A 3E6FB 3W82A 1N3NB 4YDKL 5I75B 1QVOB 1CFSA 3OKMA 4IRSB 5C7XL 1IGTA 4MNGE 2H3NB 1GYAA 2ITCB 5CEZD 2BVOA 4FXKB 2UWEE 3D6GA 1KJ2B 4DZ8B 3ES6A 3WMSA 4GRLC 3GSNH 1KN4H 5LGKA 3C5ZD 3UZVB 3TZVA 3LKPB 5DJ6B 1WBYA 3CX5K 2AXFB 3TWCL 5FV2A 2X70B 4KHXH 4XCYA 3MYJA 1VGKA 1NGWA 3LQZB 3VG9C 1BVKA 4JPWH 1UADC 4UILL 5E9DD 4U49A 5CILH 4ODHH 4HKXB 1DSFL 2GTZB 3GBML 3W2DH 1A47A 4XAWL 5CZXD 5H94B 1A6PA 3KPQA 4D9LH 3SKJL 3MRLA 3ZKXB 1SYVA 3WJLC 3DUSB 1IGCH 4L4TA 5JO5B 3BN3B 3SKNA 5BVJB 4Y5XA 1AXIB 3MRCA 3ZYIA 1TZIA 5GISL 4ZOCA 1GIGH 1DQQB 4OFVA 4WHCA 3KXFB 3UPRB 5C0NC 4IOFC 3DJ9A 1ONQA 4KDTC 2XTLA 1NJ9B 4QWWD 1J05B 3V5KB 5IG7A 4LP5A 4OKVA 2H8PB 3FO9A 1A7QL 5MI0C 2HRPH 2UWEF 5F7KC 4G9DB 5IFJB 3INUL 3LN9A 2MCPH 3IJYB 4ZFZB 4JG0H 5FYJL 1YNTB 3BP7A 1VESA 1T20B 1U8MA 2HVKB 1VB9A 5H2BA 5D1QA 1OTTD 4JFFA 5B39B 2BNQA 1XGTA 1J18A 5HI3C 3C8KA 4AH2B 5JIPA 1SY6H 4W6WB 2VLLB 5MENB 1J8HD 4UV4L 4DKDC 3OAYK 4YBQD 3FMGL 3V7AE 5EBMA 3WS6A 3WUWB 4KUCD 4X4YA 1X5IA 5ENWA 4MCZA 1E4WH 2Q86A 3DXAD 3DMMA 4XWOC 3BGMB 3FQWB 3OJDA 1JWMA 4X5XA 4X7SH 5B3NA 2CLVA 5DHYB 4ZFGL 1EZVY 5E8NA 4HBCH 5H35B 5IHUL 2EECA 2CK2A 2B4CC 5SX5H 3DRQB 2HYMA 4AEFA 4K71B 1INEH 2UWEA 4MWFA 1L9MA 1J0ZA 1PZ5A 3SOBL 1MAML 4CRPA 2GSIB 2VXUH 1V7MH 2VDLH 3BZFA 3MROB 2AERT 3EOAA 4B0MM 2DQGL 2JELL 2I26N 4OLUL 2A2QT 4JFOA 4OM1H 4OTXH 5DD0L 2YKLL 4PUBL 1NAMB 3VWJC 3A6CH 4LLVA 1C5CL 3PJSA 4K94C 4Y5XC 1CIUA 4F7PB 3BZEA 1NBVH 4OQTH 3O6KL 3LMJL 1RZ8B 4Y5YB 4UOJA 3BDYH 2R0LL 3CSYB 4ZFOA 4OLXL 5E5RB 5TFSH 3BP5A 4OLVH 5KS9E 3JV0A 5F9DC 2BFVL 3I84A 4L4VD 3PL6C 4P5TA 4O02L 5CJQL 3IETB 4K94H 2W0PA 4X9GA 3ABZA 3L3IA 1AGBB 2BCKB 5EZLA 3EDDA 2VLKD 3GO1L 3VE0A 3QO1B 2HG5B 1K4CA 5E2UH 5BO1L 2R2BB 1PKQA 1G7PB 1S5IH 3BP6A 3LV3A 2DDQL 2GAZB 4X98B 5C0AD 5HI5D 4N0FB 5JQ6L 1H8NA 2DB8A 2F53D 4NWTL 1O0VA 2FBJL 1T21A 1A6ZB 3LKRB 2RQ8A 3IKKA 5EU5B 4F9LA 4OLZH 5D7JB 1WC7A 4PRIE 1CICB 4Q9BA 1M4KA 1CDIA 1DBAH 1FHGA 4OZFB 5EUOF 1FL3B 2BRQA 3FFDB 1W72L 4OV5A 4XBEL 3UTZB 5IM7B 5GXBB 2PXYB 3E1F1 4QRTB 3SO5A 3D39A 4M61A 2YD1A 3FFCB 1EHLL 3ZYJA 3P4NA 4DZBA 2BOBA 5ILTL 3DVGA 4HG4K 2CXGA 3A6BH 4TVSa 4EDWH 2QHRL 3UX9B 3NAAH 4GBXC 4YNYB 2BOCA 2IALB 4MA3A 1LEKB 3ALPA 4P4KB 1A4KA 4AT6B 2WSKA 1ZHKA 1YEFH 2GAZA 3B3IA 1JGUH 3TV3L 4PJEE 4IRSD 2HKHL 3OKDB 3OR6A 2JIXA 4FQ1H 2APBA 2VKXA 3MUZ1 5IVXB 4FXGB 1ZVSA 4KJPD 5IFAL 1X5YA 3IDJB 4MXWH 5C8JB 2HJFA 2OTWB 4UOW1 3EYUL 4M48L 5INCA 1FNFA 1T0MA 2HFGL 2DM3A 2NX5D 4OLYH 2DJSA 3F7VA 3QFDA 3D69A 3D85A 4UNUA 2RJMA 1D5ZB 1T22B 2WWMD 4NDMB 1MRCL 4OFYA 1MEXH 4ZPVA 1YECH 3MUHL