43CAB

Crystallographic structure of the esterolytic and amidolytic 43c9 antibody with bound p-nitrophenol
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
117
structure length
117
Chain Sequence
QVQLVESGPGLVAPSQSLSITCTVSGISLSRYNVHWVRQSPGKGLEWLGMIWGGGSIEYNPALKSRLSISKDNSKSQIFLKMNSLQTDDSAMYYCVSYGYGGDRFSYWGQGTLVTVS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural basis for amide hydrolysis catalyzed by the 43C9 antibody.
pubmed doi rcsb
source organism Mus musculus
molecule tags Immunoglobulin
molecule keywords PROTEIN (IMMUNOGLOBULIN (LIGHT CHAIN))
total genus 25
structure length 117
sequence length 117
chains with identical sequence D, F, H
ec nomenclature
pdb deposition date 1999-03-10
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 43caB00
4GXUN 2VQTA 4WDIA 2AXGA 5I15H 1PW3A 4IOIB 2EO9A 3OB8A 1BX2A 3QEHB 4NQUA 1U8OB 5C0CE 4WI3A 4ZNEE 4UNVA 3CDGA 5ESVA 4EVNB 4LU5H 3QO1A 1AHWC 4YHPB 2WNGA 4HD9A 4W4NA 4PB0H 4X6CE 5KSAC 2GFBA 4LSRH 4XZUB 3O4OB 3MRHA 5C09B 4UIMA 2CKBH 5C70A 1ND0B 4PIRF 3RWCA 4JFZH 5DD5H 3KPTA 3FQTB 3UP1A 2PYED 4AIOA 2WBJA 1HHIB 3JTTA 1CLYH 5JLZA 1BIIB 2E3VA 4K07A 5D72H 5GRZA 1ZS8A 3UBXI 1CVRA 1HHHB 3GMRB 5DEZA 5EZOH 1DQJA 3LEXA 4P2QD 4Q9RH 4X9FA 3D39D 3MROA 5FKPA 5AUMA 1T7ZA 5C7XL 1FZJB 3MA9L 3T0BA 3MV7E 4GO6B 4M1DL 1CL7L 4YX2L 2YKLL 5HYEA 5J1TC 1MI5A 3GKWH 3TA3C 5E5MA 1IGYA 1DBML 1CBVL 1OTTC 1TZGH 3S4SG 3HFMH 4KQ3H 2P4AB 2W65A 4I48A 1OAKL 2CD0A 1JHKH 4Q0XH 1S7QA 4N9GB 1R3JA 4ONFH 5L88H 1DFBH 1RZFL 2D2OA 5EUOE 4GBXB 4LSSL 1TNMA 2WIIB 3Q3GA 1E4XL 4JM2F 4NKMA 2NXZB 1A0QH 1J1XH 1FNAA 1OL0A 5T3ZE 2EIZA 2EYRA 3V7MA 3H9YA 5ADOL 3QXVA 5DEFB 1V3JA 2YC1A 4IIQB 3VFPA 3WE6A 1UADC 1M7IA 1UB6B 2D4FA 4PJFB 4ZAKD 1KGCD 2DQIH 4ZUTA 4XP9L 4UUJA 4CBPA 3CZJA 2IH3B 2YHGA 5J9PB 1IC7L 4ZFZA 4KZDL 4DEPC 1XGQA 4UT9L 5D6DC 3U7AA 1KCRH 3JUZA 1QBLH 4NT6B 3V52L 1SJXA 1EFXB 4JZJC 5HHVL 2DDQH 4D9LL 2AXFA 4OLXH 1KB5L 4F58L 4CDGC 1RK0B 4PG2C 4JDZB 5SWQA 3S35X 4UBDD 4WNQB 3DBXB 1H3XA 4UOJA 3L3DA 5LKNA 5FO9B 5CIPB 1DJSA 3NACH 2VH5L 3LB6C 1CXEA 4PJEE 5FA4B 3KYKH 1RIHH 1RIUH 1EBAA 3EO1A 5ETUA 2J8UA 3VRLE 4OZFH 3ARBC 1BPVA 4H0IA 4U1JB 1QTYT 3QDHA 1BD2D 1JHTA 2OL3L 5GGQH 4OZGF 3FQTA 4JRXD 4KV5E 5BZWA 3MRRA 1LMKA 4D0DB 1DL7H 4LLQA 4M6OL 3ULSB 4M5ZL 4K3DH 2CH8A 4NO0B 1E4KC 2VZUA 4DGVL 5LAXB 1BJ1H 1UYWL 5TE6L 3CFKB 1VEMA 3BZDA 3CLEL 5DC9B 5C9KA 5K33A 2ADIA 3LN5B 5C6TH 3CMOL 3H9SB 2JB6A 1KB5B 1EO8H 1CTOA 3IFLH 3KXFA 5DMKB 4YHMH 2VIRA 5HYSB 1FC2D 5HGHB 3IDIA 5FYKU 3B83A 3MBEC 3FB5A 3O4OC 1QO3A 3HB3C 5J12B 1BQHG 5DT1L 3T0AA 2A1WL 2QKIB 3BXNA 5GGUA 1KJMA 3VGHA 1FDLL 4JDVA 4LHUD 2IFGA 4NO3A 5FA3A 3WFHB 4LLAA 4L4TB 5BRZE 5IROA 4KRPD 3TFKD 5DQDH 5FA4A 4PJBB 1A6AA 3RKPA 1RZKC 5KVGL 1U93B 2R0KL 2ZUSA 3BN3B 3LIZH 3QZWA 1WK0A 5DR5H 1JGUH 1YC8A 3WLBA 3ZMRA 3AAZB 3ZYIA 5IW6A 3GMNA 3ARBD 4B0MM 3VXQA 2E7HA 1NJ9B 4TOYL 3T0EB 2ZUVA 2APTA 1FL5A 1P4LB 2YD6A 1UJ3A 2AJSL 4IRJB 2IPKB 1V3KA 1G7LB 2DQFB 4YUEH 4XNMA 4B5EA 4K7FA 3MCLL 1S7WB 4MA1C 3KWWB 4RGND 4PJHE 4UBDC 4XBGA 2MSPA 5DC0A 1HKLL 5MHSE 1Z9MA 3DRTA 3EFDL 1JGVL 3J8F7 1VFBA 3R4DA 4RZCA 4PG2A 3BPOB 5JUEH 3FQXA 2PYEE 1JYVA 5IJKA 4QWWC 2CR3A 2DM4A 2FYYB 2OXGA 3ROOB 1JYWA 4LBEA 1XT5A 3EO1B 4JFHE 5FYLH 3SCMD 4WW1B 1HEZA 3H9HA 4J3UA 1GIGL 3QO0B 4NNYA 4KKLD 1MJ8L 4MQXD 3ARDD 4OTXL 5HHXH 2B1HL 1VPOH 4Z7VB 4LHUG 2ARWA 4X9IA 2ARJB 3HE7C 3LSOA 4AM0A 5BVJB 1CD9B 3VXMD 1N6QH 3WN5A 4LKCA 3ARWA 1U8JA 4NBYB 3WEXB 5TF1H 1BAFH 3I2CH 4URTB 1I1YA 3L3KA 5DS8B 3ZKNC 2FSEB 4OLVL 4Y16C 3UYPA 4PJ5E 4WFHD 3KPLA 2IG2L 1S8DB 4QRQA 5JOFB 5C09A 5JMRA 3MV7B 4BH7B 1Q0XH 2X1WL 1MEXL 1ES0A 2WP3O 3ARSA 3BP4A 3RRQA 2QSQA 3S37L 2FIRT 4M48L 3WO4C 1JI1A 4GUPB 3MLXL 3ILPB 1N0XL 2DMBA 3NPZB 3VGBA 1IQDB 3MLUL 1Y18B 4UDUB 1YEDB 1LE5A 2YPLE 4Z8FH 3G5VA 2FO4A 4OKVA 1KJ3H 1FNEB 3AAZA 5IG7A 5EC1B 1TLKA 2JF1A 1RVFH 1J8HD 2ICES 1KPUB 2F5BH 5D7JA 2XN9B 4MS8C 5IW3A 1NLDH 1T1WA 4X8JB 1IAIL 3WFCH 1FJ1B 4OM0H 1QA9B 4E41A 5ADOH 2FX7L 4CRPA 2X89D 1M7DB 4RRPA 1MWAH 3LKQB 4S1QL 5ESAA 2HJKA 3VG9C 4F33A 1MFEL 2W9EH 4TUOA 1SYSA 1M71B 1RZJL 4PV9B 5FO8B 4RISL 1S8DA 5ICYA 1XH3A 4WFGE 3PG2A 4JO4H 1AQDA 2AJUH 3MRPA 4HS8L 2ZCHL 5FYKE 1IC7H 3QWOA 4QHNA 1XGTB 3ARFA 3U0WH 3PJSB 5IVZB 1QVOA 3L7EA 1EMTL 5TF0A 3DSFH 4GG6A 5I8CA 2D4DA 3MRBB 3GMLB 4F58H 3VXTB 1JWSA 2FBJL 5GRYA 1S5IL 5F3HB 4BYHA 1DQML 4U1NB 4LSUL 3L3OB 4Y4HD 4PLKC 3O6FB 1NEZG 2ATKA 3EDJA 1R3HB 3WKMH 4PBVC 2GJ6D 3OPZH 3SBWA 5CJQL 1FYTB 4OI7A 3CFJB 1S7UA 2NY1D 4R96B 5EIQA 2VE6B 4R4ND 5EZIH 4HGWA 1HIML 3HE6A 3V5HB 3QUML 3FMGH 2F53A 3MTRA 2J6EA 5GGQL 3NIGE 4WCYH 3HC4L 5DURD 4MAYC 2XKSA 1ORQB 4K2UL 4XVSL 5IW1A 2F53D 4JHAH 3L3HA 1EEQA 2WBJB 4TVSa 3RZCB 3PWJB 2DF3A 3PHOA 5ALCL 3SDAC 2ICWI 3HAEA 4DUVA 2G5BA 2YMXL 4AK1A 3MPCA 2KUTA 5LXGH 4UDTB 1FZJA 3IFLL 1LP9F 1SQ2N 5KW9H 3MO1A 4YHML 2EE9A 1HXYB 1CFSB 1MFBL 3DIFA 5JPMB 5HJ3B 1U95A 1T3FB 1UACH 2XN9D 2A83A 3U4EB 2ADGA 3S7GA 4P57B 5IP4A 1S7QB 2CRYA 4NHCH 2R2EB 4HWZA 5A40E 5HGDA 2FX9L 4XMLL 4HMEA 3TN0B 3GJEA 1S9YB 4U1LA 1DBAH 5FHBH 4X4YB 3PWPD 2BNRA 3BGMB 1UA6H 4MHHG 4P5KB 2UY7A 5D4QA 1BM3H 1QFWH 1LE9B 3BW9B 1H8NA 4OGXL 1RZ8A 3HG1E 3P11H 4UIKL 5I1EH 5DRNB 5C0BD 2VWEC 1ADQH 1F42A 1FE8L 5IEHB 2NYYC 3S34H 2CUHA 3ULVC 5HGAB 2BVQB 2YSSA 4X6CB 3EOYG 3PABA 3SGEI 2AJSH 1XR8A 1FNHA 1AFVL 4R90H 5EWIH 2EDFA 4G3YH 1ZVYA 5IVZA 4U6HA 4DCQA 3GHBH 4RFNC 35C8H 2UY6A 3C8DA 3VXSA 5B8CA 3EOAA 3VXTA 5HDQL 2IAMB 3SDYH 5IUSA 3SGEH 2HT4D 4HJJL 4NHUB 4D9QE 1LVEA 5C09E 5B39G 1JNLH 3O3UN 4NKIL 4ZPVB 2EYTA 3DX9A 4LCWD 3T1FB 4GS7B 5D1QB 3VRLF 1FH5H 5HGDB 1YN6A 3CFJA 2XWJA 4ZXBB 3RUGB 1C1EH 1H9VA 2NY0B 3FRUB 3ZDXE 1KULA 5CBAA 3PQYE 4OZGE 5FYLL 2MPAL 1PDKA 4ZSOB 1CD1A 3BRDA 5D93C 3MJ9L 3HC3L 3GSWB 4TPRH 4XAKD 4LARH 3WV0A 5GRUH 2VLKE 2JIXD 4I9WD 3BSZL 2IGFH 3PDOA 3UTQA 4G8GE 5HY9B 1MLCA 2AXGB 4QO1A 3SKOB 2FGWL 4LSRL 1HEZB 4S0SD 1DR9A 2YSSB 4PUBH 3RJDA 5DJDA 3Q5YA 4Z7WF 3PHQA 1NGWA 5FYJL 4BJLA 3RZWA 4Y4KB 1A1NA 1OARL 2NY5L 2H1PH 3LRSB 4NGHH 1U6AL 4WWKB 1KB9J 5CZVL 5E03A 4OFVA 1I8LA 3O9WC 5DWUL 4N8VB 1UEMA 1G9EA 4G6MH 4GW4A 2DYPD 4FQHB 5J8OA 4Q9RL 1ZVSA 3SOBL 3M1BB 4FG6C 5D2NB 3O4LE 1HHGA 4JJ5B 1QFWI 1U91B 5DI8B 4YX2H 1N0XH 1NBVH 4GKSA 1N5YL 2EXWC 4OUUB 4KMQA 4MAYA 3V0VB 5ERWB 4DQOL 3WS3B 4N5EC 2DQDH 3F58L 5C2BL 2FATL 2BVOA 4LLVB 1JNHB 4Z8FL 5DRZA 2Y7QA 1QR1B 3DVGB 5EOCH 3MV11 1A5FL 2R23B 1C5BH 2J88H 4YPJA 5KOMC 1KTLA 1AP2A 4JREC 1BQLL 1OAQL 1BOGB 4LOUC 1EX0A 5F6HJ 4XXCA 4U3HA 3D85A 1W72B 7CGTA 1X7QA 2C3WA 5IKCA 3HCVA 1MIEH 4Q2ZA 4DFIA 1GRWA 4PJCB 4JFDA 1UVQA 1NAMB 4TNVF 5I76B 2BHYA 3QDJB 4C83A 4UT6H 2YR3A 1OP3K 4H5SA 3VFTB 4ELKB 2GAZB 1GZPA 1YMMA 2H6PA 4MWFA 3RI5K 3MRLB 3HE6D 4PRPA 3L7FB 3G6JA 4ORZC 1NDGA 4W4OC 2YUVA 4QRTA 3HS0A 3WUWA 1ZAGA 1G9NC 2X41A 5LJYH 4FFYH 5HHVH 5C0GB 1A7NH 3QUZC 5I0ZA 4JJHA 4Y19E 1TMCB 5KTEL 4QEGA 5C71A 4OIAA 3TIEB 4RGNE 1S7RA 4JO3L 1FFOA 3CFCL 3WIHH 4PP1C 3OPZL 5HI4D 4PJ7B 5D7JC 4TN9A 1NC2B 2G9HB 2VISA 2AEPH 1B4JH 5IWLC 1TQCB 1VFAA 2Z31A 1A6VL 4XPTH 5EUOB 4MXVF 1FLRL 2JCCE 3GSUB 5F7KC 3STLA 1BVZA 3D39A 1RIVL 5MENB 5DMJB 5JOEA 1A3RL 2EYSB 3O3AA 3FQUB 3Q48A 1A1MB 5CZXD 1MI5D 1MCWW 1NBZA 5JNYA 4PJCA 5HYJA 2YUZA 4K71B 2AVGA 3L3JB 4K3EH 5ALCH 4Z7WA 4Z95H 4YEEA 2CLZB 3TO4A 3VXMA 1VKXB 3V4VH 2EIDA 5TE7H 2J8OA 5LXGL 3EHBD 1BD2B 4MZ2A 1K8DB 5KW9L 4QHKI 4G7VL 3VFRB 2FIKB 1NMCB 4EZMA 4O9HH 1CXLA 2I07B 2XA8L 4TVPL 1Y18A 1R3KA 2GK2A 4UDUA 1GJIA 2DD8H 3TO4C 1JZ2A 3DYOA 4YHOL 5LBSL 3MRGA 4RGMC 3HE7A 3V4UH 3QFJA 3OTTA 1NL0L 5IMMA 5DQDL 1EHLL 2VZ3A 3B9KD 1BREA 3H8NA 4HUXB 4NOBA 4XMPH 3STLB 3PQYB 4OZGB 5B4MC 1DQQB 3LCYA 3IU3A 2VWEE 5D96B 3QDJA 5TQ0L 2VXSH 3BPCB 3MV9A 1ZT1A 1U93A 3AB0C 2MKLC 1D5XB 4WI7A 1T2QH 3UDWA 1BFVL 5EZJA 1WBZB 2EKJA 4H88L 4E42A 4KRPB 4OIIL 1AFVH 2DBLH 2R56L 3NCFB 3WSQL 2CRIA 4G8GD 4R90L 1AC0A 1NCAH 4OUOA 2I24N 5DJ0A 4NO2B 3GHBL 2A9NL 3KPSB 3LEVH 3SY0A 5ESQB 3BZ4B 4LFHG 5CSGA 4KC3B 1CVSC 4HJJH 4P9HC 3D3VE 4KROB 3VXSD 3AM8C 5EU3B 3QI9B 1F5WA 5E94B 2AGJL 3AMLA 5CIPH 4WFEE 5D6CB 4JKWA 3QIBB 3WHE0 4WRLA 5ENWA 3LRHA 1WBXB 4FFWC 2JB5L 3RWHB 3PP3K 3EGSA 5K9JH 4P2YA 1PKQE 4YHYB 2AJYH 2BNUB 2AK4A 2NMSA 1G6RL 3RGHA 3ZLQC 3MJ9H 3BRFA 2CMRH 4JZJB 1OGAB 5FYLE 1CZ8L 3EOBA 4O2CA 1KPVA 4QY8A 2PXYC 4Y8AA 1PAMA 3MLSL 1KN2H 5IW1B 3ARDB 5I6XC 1L0QA 1V7MH 1XR9A 2JIXA 3HNVL 4IOIA 4ZO6A 1ZEAH 4JQIL 1N6QL 2GTWA 3HR5B 3JV4B 5C0AE 3QIWC 4K23H 5TGBB 4KZEL 3EJZC 4OZIE 5HYSG 4D8PB 2QQQA 5DJXB 1N3NA 4RIRB 2X4UA 1BQHB 4OD2A 3WXWH 5DJ0B 1BVLB 1FIEA 5HHNB 1N8ZB 1BOYA 1ETZB 4R26H 5TPWL 5F96H 1MEXH 2VKXA 1TQCC 1IILE 1K2DA 5SX4I 3GDBA 1U3ZA 1MRFH 2EE3A 2V5TA 5D7IB 3G6JE 1VEOA 3L5XL 1DE4A 3TO2A 3OXRB 5E9DB 4IDLA 5CILL 5E4IA 3T0EC 5K9OB 4HCRH 1NBVL 4H0GA 5HVGB 1MUJB 4MGXA 2UYLB 4HIJB 5SWZA 1ZWIB 2VL4A 5INDB 1FVCA 4YDJB 4H26B 4CL7A 1FYHB 4WI8A 3F7PC 3RVXD 1I1CA 3DECA 1A5FH 2DWEB 3ULUC 1GOGA 2R1YB 3MGOA 4HKXB 1H0DB 2Z8SA 1GHFL 3CX5K 4Y19D 5E08L 3GRWL 5F7YC 5J1SC 1GOHA 3IRPX 1KCUH 4GRLB 4J8RB 1LO2H 2QQLL 1JYNA 2V6HA 3HI1A 4X6CF 1QFOA 5F1KC 1JHTB 1G0YR 3C2AL 5IG7B 3AC0A 4M61B 2Y23A 5EIIA 1SM3H 1EUTA 3FCTB 1CL7I 3NBNA 2BVEA 4I3SH 1MFEH 3DXAA 2E9BA 4U6TA 2M1KA 4ZFFB 3QHZL 1NQBA 1MFNA 1F3JB 5DQ9A 1FJ1A 1U8MB 2RBLA 5DYOB 1K2DB 1NC4B 3FL7A 4P2RB 5ACZA 3CC5A 3RA7H 1WTLA 4NUGH 3AS1A 3FZUC 1MQKL 2B4CH 5H8DA 4LCYA 4M00A 3AB0B 5DJCB 5GGSY 4BFGA 4YNYA 1I1AB 5IB5B 1U0QA 3PHSA 3LKOB 1F4YH 3HS0B 4CNIB 3E1F1 1MHHA 4NT6A 4PJFE 2FEEL 3SHSA 4L4VA 3HMWH 4GW5B 1SJEA 5GZOD 3OAUH 4GAFB 1I85C 3UC0H 4X7CC 2ESVE 1A6VH 3TIEA 4OI9A 2AJZA 5FO9A 1C8PA 1UWEL 4GKOA 4HKBA 3DGGA 1EAPA 4D0BB 1KBGH 3SQOH 3PHQB 4Y4HB 1U92A 2XWTB 5E9DD 4NN7C 4P3CL 2Y36H 4JHAL 3S36H 4JFOA 1KELH 1XCQB 2E6PA 3G04B 3OV6A 1U8KB 2F53B 2WLYA 3DVIA 3BN9D 5IMKA 3MV9E 4ZTOH 1ZTXH 3FO1A 3QQ9C 3OL2A 1OAYH 4EI6A 5ITFA 5GHWH 5FGCB 3T4YA 2Z4QA 4LPWA 1J0HA 5FM5M 1MFBH 3VGGA 1LK3H 2NZIA 2UYLA 4GKSB 4HIJA 5EB9A 2PCPB 1NAKH 4WFFD 2AERT 3VI3E 5AD0B 2DD8L 3X13B 3HZMA 1A7QL 1RZ7H 4NSKB 3CVHL 3LKOA 4PTUA 2IANB 3SN6N 5I1LA 1G7PB 1OCWH 1OM3L 3CH1A 5IFHL 4NN6C 2ADGB 1HOCA 1HQRB 4E0RA 1TXKA 1I3GL 3UTSB 4ERSL 1NCWL 5BS0D 3P11L 4M4RA 2VKWA 3OKNB 4LF3A 3IU4L 1ADQL 4XH2B 3WIIL 5BS0A 3OWEA 1KJ2B 4OFIA 5D8JH 5ADPL 2WV3A 3KXFE 2GCYB 2Q8AL 4PJ8D 4ZAKA 1YQ2A 5TQ0H 3FOLA 2VJXA 1UWXH 3KPOA 1HHJB 1QRNB 3S3SA 4PJ9B 2BJMH 3AREC 4HIXL 2GSIB 1GPOH 1SMOA 1F4WL 1IGTB 2MQCA 2WK2A 1U8NA 3L1OL 3L5WB 3KHQA 4N0UA 1KFAL 4DN3H 4S0TD 4G3YL 5KVDL 4WY7L 2DI9A 3LHPL 3RVUD 5JHLL 2WLZA 3FOMB 4LLDA 4JFYB 1JWUA 5AG9A 1FRGH 1JK8A 1F4XH 1QSFA 3M8OL 2H9GB 3H42H 5D96C 1RZKL 4QXGL 4ZFGH 1TJIH 4PJDE 4Y2DC 1WFUA 4Y1AE 3VJ6B 1Y6KR 3HUJA 3EOAB 3BZ4A 3AREA 4NZUL 5K9JL 1SYVB 3U9UA 1MCFA 2V7NB 3MNZB 4OM1L 4Y5YB 4KY1L 3FT2A 4M1DH 3ALWA 5MENA 4OI8A 3DYPA 1QSEE 4OKVB 1RHHA 3Q5OA 4OLEA 1HH6B 3U46A 1UQSB 3UYOD 2E5EA 2O26U 2XWTA 3W2DL 3AS0A 1K6QL 2R2CA 4P4RB 3LKNA 1V7ML 3HNVH 4JN2B 4NC2B 4L8SB 3F7QA 4P0DA 3QEQA 2UWEA 4OAWA 1JHLL 3BPLB 5CCKL 2PYEA 2ITDB 3B8SA 5KSBB 3CH8A 2P24A 1IZJA 4WUUB 3LPWA 4ONOA 2V7HB 1EVUA 1XR9B 2IADB 1BQSA 2JIXB 2X4PB 4JFEB 4WNQA 5EZLA 4G8IB 1PX4A 4R26L 1FNLA 3L3DB 2Y06L 1JRHH 4GAJL 3T2PA 4FQCH 1N3NB 4G6ML 3DXAE 3QPXH 4PRDA 2X4NA 3HI5L 5CEXA 1WEJL 3O6KH 3QNYA 2N7BA 3QFDA 4QRQB 4HKZB 4TULL 4Y16A 1J0JA 1A6WL 4E0RB 1KJVA 2F5AH 2X1OA 1MRCH 5KS9B 1JFQH 3F58H 5F1NA 4MB3A 4XTRD 2NLJA 1QKZH 5A3ID 2HT4C 1LO3L 2VSDA 4L3EB 5DD6B 1P53A 1RJLB 3P9LA 1DBMH 1CBVH 4X0KB 1PEZA 3RWIA 4LAQL 4X7EC 4DW2H 3NN8A 4QTIL 4L8CB 4PJGF 3OG4B 5MEOB 1KEML 1CR9L 1DQDH 4DZBB 1A9BA 1UKQA 3RP1A 3EFFA 1EV2E 4LLQB 1SM3L 2HVJB 2OR8A 1JTOA 2P24B 5DC4B 3FZUD 2X05A 2YBRA 4HS3B 2P5WA 4PJXF 4HPYL 5JW5A 6FABH 3WO4B 5GS2H 1HHKB 4RFNB 4AEHH 3K4AA 4F2MA 3WDHA 1H8OA 3S35H 2JB6B 5I1IL 3RBGA 1HILA 4M6OH 3S3JA 3TBWB 3RA7L 2HTLD 3V4PL 4UILL 1HN1A 4GG8A 3VXUA 1YMMB 4LPXA 4LL9A 2DL9A 1PLGL 4FFYL 4FABH 3O4LB 4R6UA 3RDTC 5DQ9B 4Y16B 2NY7H 4OCLC 3FKUS 3WYRA 2AV7B 1U8MA 4L8BA 5E00A 4IJ3C 2C26A 5CLTA 1EFQA 2Y5TA 2QR0A 3PXJA 1ZGLA 4J23A 1J12A 1U42A 2FJFA 1YC7A 2HFGL 3FO2B 4NQVA 2XPGA 2NZ9D 3D3VD 2AEPL 2R1WA 3INUH 4YE4H 1OPGH 1NC2D 2V2XA 1FFOB 4YDVB 5I1JL 1FFPA 4AG4H 2P7TA 1QFPA 4G8EB 5LCVL 4DZBA 1QYGH 1VCAA 5HYIA 4C59B 1QBBA 4Z0BL 1KG0A 3W11D 4N0RA 3GSUA 1BX2B 2APVA 1PG7W 1UWGH 1P4LA 1FL5B 1ETZA 1F6AA 5F44A 4DTGH 3OKDB 1JGUL 2DLGA 2OL3H 5I1DA 3GB7A 4BSVA 4JPIA 5TE7L 3UYRL 15C8H 2A9ML 4HXBL 3QBTB 4ODWA 3RPIB 4DGVH 4WU5A 1UH4A 2APBA 4NQCE 1QACA 3AUVA 3ISWA 2CLZA 3TO4B 4C58B 2XA8H 2AKRA 4TVPH 3IDGA 4XGZA 1CXKA 4WI4A 5C6TL 2XYCA 5DEFA 2BNQD 4PP2A 3ROOA 1A7QH 2B2XL 4ZYKB 1MAKA 1BIIA 1AXSA 2DTMH 4KHXH 5DD6A 1KIRB 1VFMA 3ZE0F 1EAJA 1LEGB 1MCOH 5LBSH 1ZGLB 5FK9A 2HG5A 4L4JA 5I9QC 2PW2B 2L4OA 2X1QA 4IOFC 5FKPB 4V2CB 5BRZD 3OKEA 2XPGB 4C54A 1KT2B 4U1KA 2R2EA 5F7WC 4PRHD 3MCKA 2PXYA 1AI1H 2Z8VC 3B9KB 3IDYC 1N26A 2R0ZH 3O45B 4G7YH 5FGRA 3WIIH 3KLSA 2AJXH 1VGKB 5K9KA 4PRHA 1KLUB 4FFWD 2VC2H 4W4OA 3ZT7A 3LKPB 4JDZA 5SWQB 2E7LA 2VZ1A 1EJOH 2L0DA 1H3TA 4MD4B 3SDXF 5DUML 4NOFA 5DTFB 4JKPL 1CS6A 3GSXA 3SQBA 1BF8A 1YECH 3LQMA 4GSDH 4JM2B 4Z76B 1VPOL 2CSPA 3TJEL 3T0DA 3MREB 3AROA 4X7TB 1OWRM 5F7EL 2H3NB 1CFBA 1N6VA 3ILQD 5MERB 4E42B 4XPFL 2NTFB 3MJ8A 1BAFL 3ECBB 4HFUL 4XAWL 5IHBA 3MFFB 3M8OH 2VDKL 3B9AA 3VFPB 3WE6B 2XTJE 1E6OL 2AQ1A 4MZ3A 3EDEA 5D2NA 2VL5B 4UUJB 2IG2H 4IBLT 4MNHA 1EXUA 4ZFOL 2JJWA 2IAMA 4LLDB 3R1GL 3ULVL 1MCKA 1F00I 4RX4A 1CXHA 4RMWA 5JIIA 3B9KC 3IDYB 3DMMD 4U0QB 2EDRA 3BKCL 3MJ6A 1WBYA 2JE8A 4AZ8A 1IEAA 3CPLA 4MA8H 5I1GL 4JRYD 5FGBA 4DGYL 3OKLB 1FVEB 4ETQB 4L4TD 3OAYH 1EJ6A 3EDKA 5I1DB 3ULUF 1WZLA 4M7ZC 4ENED 5HBBA 3PWUA 3KS0J 3MNWA 2F5BL 2J8UB 3K4DA 3L3OA 3DHJA 2NY4B 4PYGA 4TUJA 3G5YB 1J0ZA 3REWA 3QQ9D 4Z78B 3ULUL 5JORB 3G08A 5D7LA 1HI6B 4FQCL 4E5XA 1MWAB 1R6VA 1NBQA 3ARFB 2C7UA 5E9DE 4OSUH 3RHWK 4JE4B 2BOBA 5FHAL 4KU1A 4N68A 5FOJA 2OMNA 1A6ZA 1JPFA 4UV7L 5IVXF 3O8XA 2DQEH 5I1CH 5HGBA 1K3ZA 2HMID 1ORQA 3KXFB 5I1AB 1XF3A 3EYOB 2V9TA 5FO7A 4Q7DA 1DE4B 1TZIA 3UJJH 4G6FD 4BSWB 2YPLB 3UEZA 4X9BA 3HAEB 3LDBC 3D69B 4PY8J 1GHFH 4H1LB 3GNML 4OD1H 5HI4C 2Q76B 4BH8A 1KJMB 4I18A 2DQCH 5EUOA 4PJ5D 3OAYK 1LO2L 2GSGA 3DRQB 3T2NH 1IJ9A 4OCSL 1RVFL 4NNPL 4NZTH 1NEZB 1Q9OA 1OAZH 4PS4L 2PYFB 3KVQA 1BZ7A 5DHXB 1NCDH 5TDNA 2AQ3A 5F6IB 1NAMA 1WWCA 5I17B 4N0FA 2E7LC 2XKUA 4ZFOA 5BVJA 4KRPC 1EXUB 3QULA 5EU6B 3I3BA 5L6YH 4HQQL 1T4KB 3R8QA 3QDGE 1I7RB 2NY7L 4HS8H 1NC4A 1YEFL 5ACZB 5FKAA 3ARYA 2A6KA 4WTZG 1S9VA 3QA3B 1OLZA 4FFVC 4ZODA 3U0WL 1QSFD 2R8SL 2D7MA 3L5HA 5DMGD 1KCSH 3MBED 3A67L 2DM2A 5I71C 4NRYB 2F54E 4MYWB 3FQNB 2PO6C 2BNQE 1V5JA 4GRWE 1MHHB 4L8SA 2UZIL 4MNQB 5I8KH 2HT3D 3NA4A 1I7TA 3SGKC 1EIBA 4OZHB 1KBGL 5D5MF 1F8TL 2YEZA 3O3BB 1IGYB 1Z0NA 4WW1A 3ZTJH 4WUUA 4BUGA 4PRHE 5EZIL 3NZHL 4L3CA 3O11B 4LCCA 1NEZA 2J6EH 2RQ8A 3ARPA 3JV5A 3F12B 3O6LL 4WI2A 2O5YL 2PYFA 4NM8H 4ZTOL 1DBJH 4CVWA 5TJWK 4BQCA 5C0JA 2VDLL 2PO6A 2FZ3A 3WFZA 5CEXB 3KYOA 3O9WD 3JV0A 4GMSH 4APQA 4M03A 1GYAA 5EN2B 5EOQH 1RJYB 4QHMA 1PG7X 5D2LA 4I5BB 4HUVA 1VFUA 2P8PA 2XNAB 4U6VH 2CLVA 3PWPA 3RL1B 1MFDL 5SWSE 1D9KA 1FSKC 2PR4H 4JG0H 2WBWB 5D7IE 2I07A 1NMBL 1T21A 2EDXA 4ONGL 4OCYH 5GGVL 1WICA 4P2QB 3ARRA 1U3HD 1E28A 1I9EA 2EH7L 2FEEI 2GYSA 2J5LB 4NQEE 4L29B 1I8IB 4MXVE 4ZAKC 1I9JH 4CMMA 1BM3L 3ARDA 5EU6D 3OKNA 4LF3B 5C92A 5KBNC 3ARTA 3F7VB 4DN4H 4KVCL 1GCFA 3S4SB 1I7UA 4Y4KC 4ONHB 4OGYH 4DN3L 2YD4A 4YDIH 1FLTX 1NGQH 2VZOA 5KVDH 1GC1L 1VGEL 4HGWB 3SPVB 4OGAC 1XGYH 4R3SB 4GFTB 5CP3H 1A7RL 1DUYB 1FO0L 1BFOB 4FXLA 1WQVT 4ZOEA 4S2SB 3L5WA 4IRZL 4NN5C 5T1KB 1P84K 4F33B 4HIEA 3VI4F 4QYOA 35C8L 4ZFGL 4JY4A 5FUOL 4V2BA 3OXRA 5E9DA 2YN5A 2YK1H 3LD8B 5HDQH 1ZMYA 2XFXA 2R1WB 2ID5A 1PSKL 5AYUL 1HZHL 1T6WA 3BO8B 5D7KE 5A16B 3UCRA 4LPTA 4PBWD 2DI7A 5CFHA 1JN6B 3BUYA 4XPBL 5HHQB 5HYJD 3TIDB 4WEBL 3ZDYE 3NIDE 4K3JH 3MNVA 2P46B 3P4OB 1NGYA 5B39A 4M1GL 5C07A 2EC9T 4MQ7A 4DJMA 3CFEB 4TPRL 4ZOBA 2BSRA 2VE6A 1N4XL 5I76A 1KIPA 4KI1A 5C09D 3D25A 4OCRH 5CSBA 1TTFA 1KB9K 4LCWE 4JG1H 5IF0B 1QRKA 2AJ3A 5E8DL 1QP1A 5LG1A 4MQSB 4ZS7H 4W70A 4FQJH 2HJLA 3T3PE 4RMRA 3U7WH 1U8LB 2YOCA 3KYAA 4NGHL 5CZXC 1T5XB 3LS4H 5E8OA 3RWJA 4O51A 4OZFB 4NO0D 4UV7H 1LEKB 1F4HA 3DYMA 4P9HH 3ALXA 3OKEB 4PR5B 2VNCA 3DUSA 4OF6A 2CQVA 2GW5A 1SBSL 5IB5A 1OOAA 4NC1C 3WHXB 3U4BL 4NKOA 1KN4L 5AZEL 4KKAD 3V5DA 1DBKH 3U0PA 5CBEA 5EFIA 5J11C 1A7NL 4MJ4A 5HHMD 4FP8L 3QNXA 4PP1D 4WW2C 1IC1A 4DGIH 4XT1C 1OAUH 4JO3H 3I6KA 4AENA 2FYYA 4JFDD 1WV7T 5ALBH 5K59E 1ED3A 3K1DA 2FIKA 1DQJB 3LEXB 4LBEB 2RCSH 5C08B 4U1MB 3NN8B 4NZTL 5CBAB 3GSNH 4LRIA 3MX0A 4M7JH 4KKAC 1RAMA 3D25B 4WUUE 4XP1L 1UH2A 1NCDL 5J57B 3KNBA 3LMJH 4Z7UE 1YNTA 4IDJH 2APXA 1UCTA 1CD0A 3ARFC 2QLVB 2J5LC 3QUYD 3T0EA 1CGYA 3GMRA 4LEOB 2AEQL 1IC4H 2MNUA 3VFGH 4QRPE 5IROC 1AD0A 3MRIA 4BUHA 4NUJB 4EXPX 4FMFA 1F3RB 1H3PL 1BGXH 1A64A 3D6GA 2Q6WA 3CU1A 2FH8A 2OTWA 1KV3A 5L7XH 2NY2B 1GGYA 1L0XA 3IETA 1OPGL 3GGWB 2UZIH 2X4OB 5I8KL 3UTSA 3BUTA 2BVUA 4O5LH 4YHOH 4RWYL 2XT1B 3ZE2F 1Z5LB 1ZLUK 4RDQF 3BISA 3V4UL 3DV6B 4P2QE 2CJUH 5HI5D 5AZ2H 4LSVH 3UTTB 4FG6D 5FM5O 3KPOB 1FZMA 2V2XB 1MLBA 4UV4L 2IH1B 1PD6A 4RAHA 4Y4FA 2WM0A 4PJFA 5EPMA 2UWEF 4GKNA 4TRPH 4K3EL 1U8JB 4IRSB 5EOQL 3MXWH 5C0EA 3EZ8A 1OGAA 4OZ4B 2DBLL 2R56H 1Y6NR 3FO1B 5HHOD 4B50A 5GISL 5HVHC 3LZFL 3N9GH 1RUPL 2FR4A 3GBMH 4U6VL 4NKOB 1UJTA 1AHWB 4OGAD 4RSVA 4HWBH 3CFDA 5BQ7A 1MCOL 4R4BA 1RJCA 3VD3A 4OF8A 1NMBH 3DX6A 4D8PA 4O9HL 5T33L 1WIUA 1P9MA 2IANE 1G9ML 4JANA 1F2XK 4JQVC 1YPZE 4CN4A 3ZKMC 4JFFE 4QT5B 3TVMA 2LU7A 1CF8L 4QY8B 1T1YB 5HPOA 3L5IA 1TETL 4LQ1A 5IV2B 3ZKMD 4TSBL 2R39A 3QHFL 1QG3A 3MYJB 2GY7B 3B3IA 1G6RH 3PP4L 4DN4L 1ADQA 1XAUA 4WENB 3ARBB 1RSFA 3MRJB 4X6EB 4POZD 5D7SL 4PRHB 1KN2L 5DZLA 4PB0L 4GXVL 4Z18A 4MA7L 4WGVB 5F7EH 5C0DB 3THMH 1RU9H 4XBEL 1LDPL 1H5BC 2B0SL 2Q3AA 4RAVA 4MJ2A 4JN1L 5BV7L 3WSQH 1WFNA 4PYHA 4HFUH 4LCWA 2O61B 4JFZL 2O93L 1S9XB 4JB9L 4R0LC 2GFBB 2R29H 4HBCL 1QHPA 5FO8A 3CDFA 3HC0A 4U1GC 4HXAL 3WKNA 1UCBL 4U6YA 2X10A 3BI9X 4X7DC 2OZ4A 5FUCC 3VD4A 1J0YA 1PSKH 4JKKA 1TCRB 3NZ8B 3ZKXC 2HA1A 1SY6H 1X5JA 4O2FA 3C5JA 1V3LA 4LLYA 3X3GL 9CGTA 3CVHA 4K7PH 3QB7C 4RBPH 5EBLB 4NRXA 3HTLX 2GK0B 2BMKA 1I3RA 4IRSD 4MA8L 2XFXB 2HT3C 4J3XA 2Z31C 4XNQA 2I5YH 4ODTL 5F88B 3T8XA 3KJ6L 1FGNL 3C09C 2DQUH 5C0CA 1W2KT 4Y1AA 1E4XH 3O2VH 3HPLA 5CEZL 2DYPA 2VLME 1LNUB 1V3MA 5D2LB 2XRAH 5B38B 1UM5H 4JRXE 4X4ME 2FGZA 5IFAL 3PWJA 5E8NB 4UINH 2IF7A 1D9KB 2GJZA 4XPGL 1XGRB 3RUGF 2P5ED 3S5LG 4YR6A 3VFOB 2XIDA 3O4LA 4YDKH 2VR9A 2VDPL 3HPJA 3QEQE 1QPPA 2IMNA 3MR9B 4F9PC 4S1SH 4XZUA 4KJQD 1TCRA 3NZ8A 3BVNA 1YYMH 5EUOF 1WZMA 1I9RH 3B2VL 2NY1C 4LKCB 3VD7A 3SE3A 3O8XB 1WCBA 1K4DA 4Y5XB 4H1LH 3AM8A 3NH7H 2GK0A 2J4WH 2DJSA 3DLQR 3PNWB 4Y4HC 4ZO7A 1FPTH 5ITFB 4EI6B 1EAPB 1N59B 2VH5H 1S7VB 1IBGH 5EBMB 2BHZA 4JFXA 3GRWH 4JPKL 4F7TB 2Q8BL 3O6ML 1XCQA 4P46C 4FNLH 4JY5H 3BP4B 3K1KC 4QXWA 4RX4D 4Y8DC 3C8KB 4JQVA 2W65B 4OZIB 3B5TA 3ARQA 4YQXL 1ONQA 3U30C 5EZJB 3DSNA 2Q7NA 4PRPE 5JOFA 1B0GB 1Q8MA 4WU5B 5TGBA 5IB2A 5TDNB 1BEYL 2ZUTA 2GTZB 4PJIE 2A2QT 5E4EC 4XGZB 1OGAE 2LVCA 4MS8D 3KR3H 1JE6A 2X4RA 4R7NA 1LD9A 1N6UA 2YD7A 4HWBA 1H3PH 1QHOA 2BSED 1K4CA 1KCSL 1N8ZA 1GH7A 1WSST 4L5FL 4O4YH 4CADB 4ORGA 3IXAB 1OD7A 4JGUA 4BK5A 4DVBB 3TO2B 1OCWL 3TH2T 4C4KO 1D3CA 3RWHA 4EBQH 1JTTA 2EEBA 1ZT7B 1F8TH 2YRZA 5AZ2L 4YXLL 4M7LL 4XCNA 3KYNB 4M43H 4X6BA 3V8CA 2RIKA 2F19L 4H26A 5DLMH 5FV2A 3UTOA 1CXIA 5DR5L 4BELD 4MCYA 4OJFL 5D8JL 5ADPH 5J1AB 2E7BA 3GSOA 2BERA 2J8UE 3L3GB 4K3HA 4S10A 3O8XD 2BSSA 3FT2B 3QAZB 3V6FA 3MA7A 1Q1JL 2OSLB 2W1NA 3V6BR 4HC1A 1RK1B 4YUEL 1XGTA 1YNKH 3MRKB 4Q6IB 1ZHKB 4Y4KA 3HE7D 1T5WB 4WY7H 3ZSTA 3QFJD 1YN7A 4HWBL 5DJ2A 5KSAD 2HTKD 4Y4KD 1VERA 1BECA 1F3JA 4GAYB 2P8MA 4KKLC 2C1OB 2RAMA 2BC4B 4PGDA 3I6KB 4AENB 1AHWA 3RU8L 1WITA 1JBJA 3ET9F 4LVNB 3LN5A 2C3XA 4U6XB 4KK6D 3HRZB 4KDVA 2DQJL 1RQ5A 5JPNB 3PP4H 1II4E 1T22B 1P7KA 4ETQA 4PJEB 1YNTB 4ZQKA 5HHXL 1A1OB 3OKOB 2GJ6A 1Z2KA 1K6QH 4WW2A 2J2ZA 4QLRA 4RGNC 2EC9U 1T04A 1GC1H 1VGEH 2WUBH 3HZYA 4P57A 4AT6A 4M8QA 3KLAA 5H35A 5GGRA 2B0SH 3REWB 5C1MB 4JN1H 1P7QB 5DK0A 2BFVH 4S1DC 4Z7VA 1R5VA 2WBKA 3C60B 3FONA 1AGDA 3LSOB 4OFDA 2A38A 5HYJB 2R29L 1UB5B 1CDGA 1FZKB 5I8EB 3D3VA 2ZJSH 4Y1AD 1E0OB 1U8IB 2CIKA 1W72H 2ZG3A 2I27N 3UTZB 1L9MA 2UV3A 4QRTB 3L3KB 5DS8A 1GSMA 3WUWB 4QYOB 4XCEB 5DRXA 2O5ZL 3SGKA 3EYUL 4NJ9H 1QSED 4G9DB 1P1ZB 1G7LA 3SJVD 2B4CC 1G6RB 4APQD 5FA3B 1EEZB 5C9JA 3MLUH 4X8XA 2UZXB 5KJRH 3SJVA 4LHQB 3WMSA 5HD8D 3H3PH 2D31B 1E27B 1I8LC 3O9WA 2OP4H 1NMAL 3QEGH 2I5YL 4JY6A 4XC1L 5E8PA 1D7FA 4WUKL 5EH1A 3UTSD 2EDTA 3HE7B 4QXUL 3QFJB 2DWDB 1AXIB 4QTIH 4GKNB 1NLDL 1WC7B 3V6FB 4IRSC 3RL2B 3RDTD 1U3HA 1AJ7H 4WV1B 4YHNA 3G04A 4ZSOA 5C0BE 2HTLC 4M5YH 1ZLSL 6FABL 3CFDB 1R3LB 3FB8A 4WFHE 1IAKA 4XPGH 2EH8H 3QULB 1T7VA 5EU6A 2WQRA 4CVZA 5CWSA 2EIZB 4OZIF 2N56A 5BJTA 2AJUL 1SVCP 1IFHH 1H3UA 5F89A 3FQXB 4PLJD 1NCTA 4KTEL 4KXZI 2P5EA 1MIMH 3QUZB 3PGFL 3U0TA 3O6KL 2BHUA 2D7QA 4RMVA 3KLHC 5AZEH 4X99A 1SBBA 4RFOL 3UTPD 4GRLC 4KAQH 4Y89A 4I18C 2VR5A 5SX5H 2DB8A 3F6LA 4O51B 4YR6B 1P4BL 2IH3A 2HP4A 4FP8H 2GITB 4LP5A 4EIGB 3HNTH 5I1AA 2ENYA 4P9ML 4MCZB 1NBYB 3LS5L 4Q9CA 1T1XB 1TIUA 1QKZL 3M17A 1RUQL 4FQQA 4HJ0D 5CHNB 3DXAD 4PJAA 3UO1H 4KTYA 1MCEA 5J11B 3M1BA 1UXWB 4PJEF 5IVOA 5KSBE 4QXTA 4D94A 1XGUA 4UU9A 5DFTA 1QYGL 5E6IB 3GO1L 2YD3A 1NLBH 5JXAH 4GRMA 3TBVA 4APQB 3QEQB 3VFNA 3DJ9A 3FB6A 4AEHL 4IHOB 4CVZB 2VAAB 1IC4L 4XNZB 2V2WB 3T08A 4JCLA 5J06A 3R0MA 4ZTPL 5AWNH 4Z7UB 5I71B 1W0WB 2QTEA 4MDIB 4U31A 3SEPA 5DD1L 4P5TD 5FGBC 2Q87A 3JWDL 4EVNA 5IFJB 1NANH 2HFTA 2NY0C 4P5TA 3MMEB 2F58L 3ZYOA 3BZFB 3NIGF 1CK0L 3IDIB 4WHYG 5C0IB 3ULVE 3MLYL 4R97C 2VIRB 1OTTD 2Q20A 1AP2B 5EU5A 2VERN 3HG1B 1T3FA 4LCCC 3VRJA 4RNRB 2IAMC 3QDMB 5I1JH 3DARA 3QDGA 1J8HB 1TQBB 2OCFD 3I02A 4PREB 4AG4L 2FJHA 3T65B 3BX7C 1I7UB 5HI5C 5DJYA 1GGIL 1CE1L 3P0VL 1EJOL 1U36A 3UX9B 3HAEH 4QGTA 4IOSD 1JMZA 4TRPL 2BVPB 1JV5A 3EOTH 2A6IA 2BNQA 4GSDL 1FYTA 2RFXB 1NDGB 2ATPB 1MREH 3W9EA 1VADB 5T5NG 3LZFH 4NKDB 3IAPA 3ILQC 1JP5A 3TCXA 5CMAB 2CXGA 2HVJA 3RVUC 3VXOB 4HMDA 5EPMB 5JR1H 4R2GC 4XPFH 2X89A 2RGSA 3DXAB 12E8H 3MJ7B 3SDYL 2LAAA 5GGSA 4EI5D 3P30H 4X7FC 1UEYA 1N64L 4WO4A 2YUXA 4LIQH 5HHOB 3O4LD 1W8NA 5DHYA 3U48A 4XRCB 5C0IA 4LVOC 4MXQC 4YBHA 1INQA 4GRWF 1YUHA 3DRTB 1HI6A 4F3FB 1TETH 2HLFC 3ULVH 1NAMH 4F9PA 3TNMA 2W0PA 2D9QB 3V6OC 2NR6D 3DI2B 4HUWB 3HMXL 3I02B 3I84A 2AJXL 3TZVD 3BSZH 2DJUA 3T65A 4K8RH 1YJDH 4ZFZB 1SJEB 3RAJL 3LPGA 3ZL4H 1M05A 4DGYH 5EIVA 2A6DA 5IESH 4M4PA 3DTXB 3QZWG 1B0GA 1S9YA 1KTDB 2W91A 2P8LA 1ZA3B 1UG9A 5TDOA 1XF4B 3BHBB 4XNYH 2GI7A 3X3FL 4XI5C 2XZAL 2IFFH 2ZCKH 5J0BA 4PGEB 5ABDE 3DUUA 4NRZB 2CKBL 2V17H 1P7QA 3SDDB 3T0XA 1KOAA 1WGOA 4XWGL 3BP5A 4XNUL 4EOWH 5EORH 3SOBH 3BN9C 4JPIB 1XF3B 2EIEA 3X12B 4P5MA 2VABA 1W0VB 4LK4A 4Z9KB 1EZVX 5LVEA 5C0NC 1A6PA 5F9AC 3MV7A 5IVXA 1QSEA 4LGRB 5DRNA 1HCFX 1A22B 2NZ9C 2V5YA 4Y4FD 4NYLA 3GKWL 5IJVB 4PTUB 1QNZL 2X44D 1CFQA 2IBZX 4F57L 2BRRH 3K8KA 1JHKL 3AU1A 3BFOA 4HC1L 5T1MB 1U58B 4HZLB 4ONFL 4YXHL 3STBA 2HFFB 1FNEA 3LV3A 5CEZH 3N1PC 5LGKA 3OAZK 3RUGA 3VXRB 4ELMA 1ZA3A 3MLTB 4NWUL 4LSSH 3ZKSD 3BH8A 3FQNA 4P2CG 1MI5E 1T5WA 4UT6L 2DN7A 1AY1L 2MOVA 4Q9BA 5L2KB 1KENL 5GPRA 1T1WB 5ANME 5CGTA 3RIFK 4F7PA 4N8PA 5IKCB 4XCYA 2ICWB 5DEGA 1YMHA 1UB6A 4KGLA 4M6MH 3DPBA 3IS0X 4LSDA 1M1SA 1GOFA 1JPST 3TBTA 3TVMC 1M71A 2YWZA 2PCPA 5CWSB 2VXUL 4KZDH 5CGYC 2W60B 2Z8RA 4ZXBD 3P9MA 4IMKA 4DVRH 5FOBB 2B39A 4MD0B 3V52H 4OF0A 1DCLA 4A6YB 2IPKA 1IBGL 1C12A 5T5FH 2EDEA 1UZ6F 3MCKB 1HHGB 3FFCA 2ZUWA 4JJ5A 4WJ5A 3L9RA 1Q9LA 3JWNC 5JO5A 1S9WB 1MRDL 3DX8B 5FYJD 1R3HA 2EZ0D 3KJ4C 3FN9A 2RJMA 4JRYB 3MRNB 3KYKL 1R5VB 3C60A 3GSQA 2X4QB 2BY0A 4NNPH 5F7MC 3WD5L 3W9DB 3NZHH 5DRZB 3LKRA 1U3HC 2D7PA 2E8YA 3DVGA 5DVNA 4IRSA 4AH2A 3DWTA 3WFDL 4QTHB 1BEYH 3U2SA 1YY9C 3AY4C 4HHAA 2NX5E 4KDWA 4K3DL 5JXED 1T80A 3FQRA 1YEJL 3DV4A 3CLEH 4YHKH 3ZYZA 1CGXA 2R69L 1D5MA 1MWAA 2KQMA 3PIQB 4M62L 4M7ZB 3CUPB 3OKMA 3FFDA 4Z7UA 3SDAA 1S3KL 2DWEA 3QAZC 3GBNL 3VJ6A 1JYXA 3A67H 1I8IA 4S11A 1U2CA 1DUYA 5TH2A 4ONGH 1R3KB 4YXLH 1EHLH 5H2BB 4NP4H 1F58L 1QFUL 4NO5B 4AEEA 1Q38A 5JOPE 4M3JA 2EH7H 4YGAB 4WO4D 4TVPD 3HI6L 1CE1H 4MB5A 5I8OH 4XVJL 2HJFA 3D39E 4PJ5B 1DN2A 1FN4B 4PJ8A 1B6DA 4LLMB 2PYEB 4Y2DA 2K9UA 1C7SA 4WTWA 1AGEA 1YNKL 4NPYB 1S7SB 1KEGH 1NGZA 1NJ9A 2A9NH 2BVQA 4PJAF 4FFVD 3D39B 5CP7A 5BRZA 4ODBD 2M8XA 5C3TA 4L4TE 3E6HA 1PEWA 1IAOB 4E5XB 2RFXA 3W9EB 1GGUA 4MVBC 5ACMA 32C2A 2EXYD 1O7VA 1NBYA 3QNYB 3RU8H 4U6HB 1I3UA 3OMZA 3HUJF 5DF0A 1IM9D 3DX7A 3TBYA 3DX6B 3VU2A 1S9KC 1LHZA 5B21A 5IBUB 4NQED 5A2KH 3ZDZF 5DMIH 5C0FB 3BD5A 1LEIB 1A3LL 1RZGB 3QG6B 4OFYA 3VDBA 5ESAB 4PJ7E 1YYLH 3VGDA 4P59L 5DHYB 3PDGA 4PJCF 3P73B 1ZLVK 4G42A 5GSVA 3HN3A 3VWJA 5CD3A 4ZMAT 4O02L 2GQHA 2DOCA 3GMPA 4GXUM 4Y2OA 3EO9L 2FD6L 3QQ4B 4KZEH 1FBIL 1W0YT 2IANA 1A1OA 2G60L 1W8OA 4ZQKB 3ZO0A 2DKUA 3AGVA 2OX5A 2ZOKA 4HUXA 5D1ZD 3KPMB 1WAAA 4BA8A 5EUKA 3RWJB 2OJZL 3JV4A 2G5RA 4KWUA 3QDME 5DK0B 2XACC 1R3IL 5EA0H 3BDYL 4U1MA 5HSFA 3OHXB 4AL8H 1E4XI 4CAGA 5E8EB 3QXDA 4OF7A 2VUYA 3EYUH 3LRSA 3GSVB 1KSRA 3UTZA 3VFMB 43CAA 2HLAB 3W39B 1U8QB 2XY2A 3K2UH 5A43C 1Q9KA 3MLXH 3WFEH 4XPBH 5FYLD 1X5YA 4XC1H 4ENEC 4WUKH 1A4KB 1G6RA 1TZGL 4LPVA 4PJ5A 5EU3A 3QCUH 2GSIA 2NY5C 4TNVK 3SJVB 5BXFB 3CXDL 1TJHL 1ROWA 3QQ4A 4XHJD 3NCYP 3KLDA 3L95A 4MAUH 3ZHDA 3QUZD 4LLUA 1MY7A 1N2RB 3O3EB 1J87A 3PUCA 1N4XH 1S7SA 4J3VA 3GSNL 2XICA 1CDHA 1WC7A 2FHBA 1W72A 4BZ1H 1G7IA 4JEGB 5FYJE 4XP1H 1LNUA 4LQFL 4L8DA 4OM0L 5DK2A 5DFWH 1Z5LA 1HH6A 4I2XA 3U46B 1XF5B 3HE6C 3ZTJG 1J0IA 1RJYA 4QHMB 5JIKA 3RHWF 5J7CC 2EXYC 2OTWB 1RUMH 3VW3L 2X7LA 2YPVH 3IGAA 4OIBA 3MRPB 5F7DB 4QKXB 1JZ7A 2VXUH 1PZUB 3QIBD 3GUTA 5F89B 2XI9A 3MRMA 3IRZA 1RHHB 4PGBB 3PABB 3T2QA 4MA3B 2YD8A 1EUUA 3MRCA 2D7TL 3O2WH 1BWMA 3OBAA 3MXVL 4DGIL 1CICB 3BEWB 3MRQA 3NCMA 1HYSC 4YDLC 4HS6B 3EYFB 4N5ED 3QUYA 3T0ED 2WMPA 1T2XA 1A6TA 1AO7E 1ZGLP 2FLRT 1BQHA 4OD2B 2AK1L 1DVFD 1OTSC 3VFSB 3PL6C 3WIFB 3BQUD 4TTDC 3WFDH 3Q5TA 5E95B 1CG9A 3QEQD 4HW6A 4KK9C 3K7UA 1WISA 3BQUA 3I75B 3FQUA 4YJZL 1RFDL 3MBEA 4M5ZH 3GBLA 2R0LL 1CD1B 3B5GA 3FQWA 1LK3L 3FTGA 4R7DA 2CR6A 5GISH 1ZLUH 1NAKL 2X2YA 1IZKA 1K9TA 1ZWIA 1SEQH 4M62H 5JIHA 1LD9B 3MRMB 4Z5RB 4L3EA 2AI0H 3QIUC 1RY7B 2MMXA 4NQTA 3FRPG 1CCZA 1GAFH 3GMQB 4OZFA 5FM4A 1YY8B 1UENA 2HKFH 1D5MB 2W0KA 5BXFA 3HG1D 4L8CA 2FX9H 3ARBA 3C6LB 5SWZD 3VE0B 1CF8H 5I1LB 3HC0B 3W11C 4NCDA 2IMMA 1EVTC 3HI6H 2AXFB 1KXQE 1ACYL 1LE9A 1BP3B 4XVJH 3SDXA 4R0LA 1ZVSB 1CYGA 5IMMB 5L8KB 5FM8A 2R0KH 5D7KD 3C87A 1F4WH 4RDQG 5LGJB 2FL5B 2GKIA 4L4VB 4F80A 3ARXA 3S34L 4YIQA 1CXFA 3MV9B 3MNWB 2DMKA 5DJYB 1WZ1L 4EUPA 4JVPA 1ZT1B 3EBAA 2VDNH 2ICEB 3MXWL 3DGCR 5JHLH 3T0WA 4MJIA 3VXNA 5ILTL 4JFEE 3CVIL 5D6DA 12E8L 3MZGB 3NCCB 5DJCA 2ATPA 5CMAA 5EWIL 4DOHB 2C7UB 3TVMD 2Y5EA 1J1OH 1J8HE 5I17A 1VESA 4JFOB 1NGZB 4LIQL 4JFFD 4C56B 4HZAA 2NW3B 2GUOB 1LK2A 1A9EB 3O41B 3PQYD 2A0LC 5IIEA 5IJKC 3BEWA 3MRQB 2ED9A 3D5OF 4PJGA 4PJBF 5E2JA 1X5ZA 1YZZA 3B43A 4NQEA 4X6DE 4P59H 3WJLC 5JHDD 3CDYA 1SYSB 2E27H 3HMXH 4PV9A 4TUKL 4ZXBA 4YXKL 4F3FA 4K9EL 1T03H 4HJGB 3GSQB 3QCVH 4BH8B 4N0YL 4O02H 4U1SB 1HDMA 1YNLH 3MCG1 5IESL 1AXSB 5JZ7D 1JHLH 2V9QA 5KAQG 4LVHB 1A7PL 3PDOB 3CFIC 3QEUA 1I8KB 2KQNA 1HOCB 1HQRA 1G7QB 3OJ2C 4XNYL 5CJ8A 5IOPA 4JZNA 4Y4FC 4MA7H 4PJDF 3RPIA 3GMPB 2IFFL 4XTRC 2P8LB 1NUFA 3KNBB 2IH1A 4HUUA 1JUFB 3I2CL 4JO1L 1SMAA 1N59A 3WLBB 4JO2H 4EOWL 3HI5H 1WEJH 4OLVH 4HCRA 2DLIA 5IFAH 2NY5H 2NTSP 4UINL 4HK0A 3BP6B 1NUNB 3OKKA 3UTTE 3CDGB 2GUOA 5ESVB 3QRGH 1A7OH 3BP5B 1A1MA 4HUVB 1EEYA 1TVBA 1PX3A 3JSSA 3QA3A 2CLVB 5B3NA 3FHAA 4M48H 5D71H 1OGTB 4UOW1 4YZFE 5IM7A 1S7VA 4IM8A 5D7JD 3FHQA 5D2NC 3QDAA 1UKSA 4UNUA 2K3TA 3R8BB 4C56E 1FV1B 5C2BH 4MNQA 3NCEB 3JZ7A 1Z3GL 4YFLF 1IQWL 1CFSA 1KJ3L 4MNQD 4PJ9D 3K8MA 5HJ3A 3V6OA 3N06B 4LSPH 2XN9E 4UU9B 4CJ1A 2DQUL 4X7TA 2DQGL 2GEEA 2D0HA 5IQ7H 3O6MH 2Q8BH 1KF9B 1FO0B 1XIWC 1WZKA 4LQFH 1IAIH 4F7CB 3HCVB 3DETC 4Q2ZB 1R5WA 4P3DA 5L2KD 3FCTA 1KC5L 1UM5L 2CIIB 5JIPA 2ZSWA 4NFBA 5GS1A 3IS1X 3O3DA 4S1QH 3H7BA 3NAAH 5T3XL 4RGMB 3CNKA 4X5WA 4Z0XB 2JJUA 4Y5VC 4WWKC 4F7PB 3EYVA 1PLGH 2LE9A 1JRHI 2Y4SA 4JO4L 1OF2B 5F7LB 3ARVA 3TBSB 3QRFM 3RWFA 3GJFB 1D6VL 2CDEA 3TZVA 3KR3L 4PJGB 4S1SL 5AAMA 4G6FB 4DVRL 3W0WB 1B0RA 3NGBC 2HVKB 4Y88A 1NANI 5A2FA 5KN5A 3MLWH 4XC3H 4M6AA 3O2DA 3INUL 4YE4L 3GUTB 3G9VA 3X17A 3WIHL 1UXSA 3ARED 3L3IB 3IVKA 2ORBL 5DA0B 2E7CA 2P5EE 1VA9A 5CJQH 3KPRB 5EBWB 4M7LH 2VDQL 3GRWA 1DQTA 3CX5J 4JPKH 3NCJH 1BQUA 2DQHL 3V6ZA 3NFNB 5DLML 1PY9A 1BLNB 4LDLB 4P2RD 4U3CA 3QUMH 4JRYA 5KG9A 4YC2C 2MQ0A 1FHGA 2P5WE 3JWDC 5EU4B 4F9LA 3S36X 1OGAD 4H1LA 4GRMB 1RUKL 3BIBX 2BNUA 3JUYA 4UIMB 4KQ4L 4J4PA 4RGOH 5DJ6A 3ZKND 3GSWA 4LCWB 2O61A 3QNZB 5D1ZA 3D0VA 3SO5A 1HYRC 4XBPB 1SEQL 4MJIE 3BKMH 5DVMA 3CCHB 3MBEB 3WO3B 3K80A 1ES0B 4LHJB 4POYA 3RX5A 5ICYB 4MSWB 4JFPB 4NQDA 3GSNB 4L3ED 2HKFL 3E8UH 5E99H 1OB1B 1MVFA 3IF1A 2GT9B 3BH9B 1IKFH 4NHCL 3RDTA 5CD5C 2Z91A 3K2MC 3I50H 5C6WH 3LRGA 3VXUB 5MEOA 5LAXA 4GG6B 4W6WB 4EBQL 5IBUG 4RBPK 3CH1B 3WXVL 3P4OA 5B39B 1T2JA 4G9FA 4AT6B 5I1EL 1UM6H 2XZZA 1MJJA 4QWWD 2FDBP 3QQ3A 4G9FD 2GCYA 2X6MA 5HXMA 3FB5B 3FT4A 3Q6FA 1CGWA 2K7QA 4OQTA 1KEGL 2C1PB 5J13C 4Y2DB 3FAWA 4GG8B 2VMFA 2ADFH 2DIAA 3D0VB 1NCUA 1U8NB 2VDKH 4L8BB 4Z7QE 2YC1B 4IIQA 4XNXL 5T5NF 4GRLD 5CLWA 1G7JA 5E5RB 3KS0H 2DWDA 3KLHD 3E3QC 2P44B 3ULVD 3KPPB 2V5RA 3B9DA 1ZANH 5CP7B 2NYYD 4KUCF 5JA8B 4RMQA 3FFCD 1L6ZA 4MLIA 3PE9A 2XXCB 4I3GA 5DMIL 2PO6B 4NKIH 4W81A 2YUWA 3MRIB 4OBSA 2AXHA 2O5ZH 3NIFE 3QIBA 5IBTL 5SX5K 2EO1A 1U95B 4IRJA 1LK2B 1NGPH 1YDPB 3FN0L 3MCLH 4YHIB 4MJ5B 3O11A 1FQ9C 5I1HL 3VH8B 2QQNL 2RR3A 2H2SC 4P48A 5CAYB 1FBIH 3C9NB 4BFIB 3HB3D 4YHNB 3GJFH 1JGEB 3UZQA 3ULUD 3GHEL 1T20A 3KPQA 2P49B 2ITDA 4O58L 1D5IH 2UWEB 1ZHNA 2N1KA 4AJ0A 2BFVL 2C9AA 1PYWA 4L1DA 5EA0L 2AEWA 3D2UA 1MAMH 5IT2L 1QUNA 4Z5RA 4MAYD 4AMKH 1U6AH 4HG4J 2FHFA 5L2KE 4Z76A 5DWUH 1S7TA 3WS6C 1OT2A 2BZDA 3QDGD 3RIFF 1I8MB 5GRJH 5HHPA 5IQ9A 4R4NC 4DCQB 3OG6B 3KJ4B 2X42A 5C0CD 2AAVA 4S1DD 4MD0A 5TF1L 3B2UC 4L29A 2H26B 3T04D 1P4BH 1IL1A 4NN7B 5MI0B 3GNMH 1FZOA 3SO3B 3O0RH 2EICA 4AEIL 1F45A 2EDKA 2FRGP 5T1KA 2EYTB 5MHSD 1WT5C 4NZJA 4UNTA 1NMAH 1P4IL 4U3XA 2PXYD 3MOBH 4JCMA 3LQAC 1GL4B 2DQGH 4M02A 4QXUH 4Z6AT 3BWAB 3TBVB 1DLFL 2C3HA 3DROA 1OAZL 1FSKB 2EDBA 3UMTA 5IVXE 1T22A 3BWUC 4PJXE 5T1DH 3GIZH 1NH6A 3X11A 5HI3D 4KK6C 3C2AH 2I9TB 3QJHB 2OR7A 1TITA 5E6IC 1JF1A 5CP3A 1QOKA 4P2RE 1ZS8B 4PJBE 3H9SE 3KLAB 1R3JB 2EH8L 5IHUL 4HQQH 4KKCD 3RQ3A 2YPVL 2OTPA 1HHKA 3WDJA 3ABZA 2ICWA 5DEGB 2HTKC 1A3QA 4ZTPH 4ZUWB 2HT2D 5A16A 3PGFH 3OKMB 2CLRA 1FZKA 3H9ZA 1DBBL 3JWDH 4N8VA 4OLWL 3IDNB 1T1ZA 5ID1A 1JNNL 2W60A 3S3PA 1F13A 2ITCB 3O8XC 2PN5A 1X5FA 1YN6B 3N1MC 1RUQH 5I16A 2HVKA 1XF2B 3MUGB 2OYPA 4BFEA 4N90D 5CSZA 4KKNA 4LLYB 2VDRH 3MOQA 5B4MD 3OJDA 3S98A 2KZWA 3NCJL 3UO1L 1ZVHA 1ZHBB 1EMTH 5JW3L 3O6LH 4Z78A 5AG8A 2RHEA 5C07D 3WLWC 2YEZB 1DQLL 3T8XB 3WN5B 4Y16D 2COQA 3BT2H 4CW1B 5IMKB 4RGOL 1KCLA 1C5CH 3N0PB 3RWGA 5ICZB 3BJLA 1ZT4A 3PGDA 1XGQB 5C08A 1FFNA 2VLLB 5HHOA 5GHWL 1EGJA 2YD5A 1M05B 4C83B 5JR1L 3VFTA 3NGBB 5DJ6B 1VB9A 1JMXA 3FMGL 3G6DH 1GAFL 4P46B 1MHEB 4OZFG 1S7XB 3P30L 4K2UH 4ZS6D 1WFTA 1RULH 3FFDB 1UWXK 3C5ZC 4ODSH 2O5XL 3FN3A 2DKMA 5HVFB 5FK9B 3DVNA 3UJTL 1OM3H 1KIRA 4MXWL 1K85A 1I7RA 3IJHB 5EBLA 5FF6B 4FRWA 1RJZA 3H7LA 3HZVB 1I3GH 2C3VB 3QH3B 2Y7QB 1UM6L 3VE0A 4U1GB 4NNXB 2WINA 1ZSDA 5F1IA 3PWLB 3ES6A 1PVHA 4FFZH 1EGJL 5FGSA 4ZUVB 1VGKA 2OTUA 1K5NB 3BXNB 3HRPA 4JFFB 4C56D 4X9HA 4PJ9A 1WZ1H 1QSZA 1BFVH 3MRDA 4XMLH 5KZCD 3EOTL 1MJJB 2ADFL 5ILTH 5KVEH 4XCFH 2KL6A 1SEBA 1CFQB 2YWYA 1IAII 1L4IA 5B3JE 1J1OL 5FYJU 2CLRB 5EBGA 5D2LE 3T4AA 4KJQC 4EUPB 1QBAA 3ECBA 1K8IB 3N50A 4NRYA 4XWGH 2AXJA 3MR9A 4MQTB 1E6JL 4ALAH 2VL5A 1HZHH 4GG6F 3TFKC 1WWBX 1KIQA 1WUNT 4X6CA 1Z9OA 4N0UE 2DLHA 2MCPH 1DVFA 4G6AD 4KJPC 3GMMA 3O3BA 1MCHA 5HDBE 1OP5H 3RZCD 4WEBH 2LVEA 4K3JL 3QCVL 5DHVB 5BMFL 1T1XA 3O6FA 4M1GH 1AE6L 1NFDB 4FQ1H 4QRRB 3MMEA 4KY1H 4KRNA 1ZXQA 3S96B 2ED7A 4LOUD 4UTAH 4K7PX 2LTQC 2MHAB 3ZKXB 3EZJB 2LU4A 4K8RL 2UUDK 3MACH 3NTCL 1QEWB 4CVXB 1ZKAA 4J12A 4QF1A 1YJDL 3RIAF 1HDMB 1UXWA 3GHEH 3ZL4L 3QG7H 5DFVC 2V5SA 1TJGL 4HC1H 4GLRH 1E4KA 5D1QA 5E8DH 4W6XB 5GJTH 4QT5A 3IFPA 3QIWA 5LQBH 4QOKD 2EXWD 2WWKO 5BZDB 5F97E 1NGXA 3U7WL 5DGRA 5DJZB 2QEJA 1T20B 3P77B 4R4BB 4AMKL 5IHLB 4IMLA 1QBML 1FFPB 2Y06H 2YPKA 5C0BB 1D6EA 4RQQA 5F96L 3G08B 3V0WL 4V1DB 3IF1B 2P43B 3BPOC 3MRNA 1Y0LA 4NKDA 5GRJL 5ISZA 3Q6GH 5D9SA 2QBWA 2OL3B 4BKLB 2ARJA 1E28B 3L5XH 4YK4B 3F8UB 3GSVA 4PV8A 3TPUB 1NCCL 5HYFA 4PUBL 1IEBB 1T1YA 4PRBB 1S7TB 4MA1B 4AH2B 5FYJH 4PJ7F 4PR5A 4HHAB 4JHWH 1HXMA 3OGCA 4CU8A 2FSEA 3SE9L 2SEBA 2WINB 4HWEL 4DAGL 3QUMA 1IQWH 1KUMA 3MUJA 1QNZH 4LGPB 4OCXH 3GI9L 1INQB 4LSPL 2X4QA 3V95A 5E4EB 1TZHB 4KK5C 4KI5E 1HCVA 4HIIA 4WWID 3HZMB 5E5MB 2ZOLA 4JZJA 3ARGA 3ZTNH 3BP7B 3LMJL 3U2SB 4LLUB 1KPRB 2FECI 3U30B 4LLWB 2CGRL 4NWUH 2PW1A 1FO0A 2IALB 1PG7L 3JTSB 4DZ8B 3QHZH 2W0LA 1C5BL 1XF5A 2J88L 4NCC1 3VFGL 5C2UB 5IHZB 5EC1A 1KXTB 4N8CL 1MSPA 2ZSWB 4KMTL 4KH2A 4LNVA 2AJ3B 3V4PH 4L9LA 3CDCA 3KPRD 4LEOA 4HKJA 1MQKH 4FABL 2B5IB 2OMBA 5JW4Q 5I73C 4JAMB 1JNNH 2X4TB 3BEVA 1FCCA 1UZ8A 4M9PA 4O5LL 3LKSB 3U9PL 1MHPH 3QT2A 1X44A 2VLRB 2FB4L 1P1ZA 3VI3F 2W9DH 2D7NA 5IVXB 3G5ZB 1OHQA 3W0WD 4NP4L 1Q72H 5D5ME 4XXDB 1UT9A 1AIFA 3F7YB 5INDA 3ZZ1A 4DKDC 4UV4H 4FQIL 3V5KA 1UWEH 2X9YA 4PJEA 1E27A 1QA9A 2Y6SD 4E41B 2NXYC 3MOAL 1M7DA 4NPYA 1PYWB 4Z0BH 1YJDC 2NX5D 1FYTD 4KPHL 4X83A 3S36L 1A6AB 1BIHA 1QLRA 4UT7H 4F15C 5L2JB 3TV3L 3VXRD 4QRUA 2CRMA 3WIFA 3GB7B 4OCNC 2EIBA 3ELAT 3VXRA 3WUZA 5K9QG 1B4JL 1H3GA 2NY6B 3VXQB 3BAEL 1AO7A 5TDPB 1TQBC 1RIVH 1BBJB 1WCBB 5T33H 5T3ZL 3QNZA 2R69H 2X5PA 4J1UB 5JNYB 5IIEB 1RULL 4P2OB 4NO0A 3QXAB 3QUZA 3U0TB 3IDXH 4G9DA 1DDHA 2G75A 3ARFD 1PJ9A 3NOIA 2NXYD 4IS6A 1TVHB 3BWAA 4TSBH 2GT9A 2DIJA 4RZCB 2XA3A 4Z7WE 2YD9A 2JELH 2OJEB 3MLVL 2AW2A 3FO0L 4P2QA 3O9WB 3UAJC 4OF5A 2R0ZL 4G7YL 5I2IA 4G7VH 1AXTL 4J2XA 1QO3B 4YGVB 4FQQB 3FJTA 1C12B 4X6FA 4HPOH 4JKPH 3THML 2VXTL 4DZ8A 1GPOL 1PKQB 3DX8A 5JA9A 5KVEL 3HZKB 3D1MC 4X6EA 1XGUB 1I1RA 2XZQH 3LVEA 4YHLL 1IVLA 1O0VA 5E70A 1QLEL 4NC1E 1OSZA 1N7ML 3HLAA 2BY2A 3TA3B 4MJIB 4HXAH 4BQ8A 5TDPA 3LHPH 2HLAA 3W39A 4CADA 5D70L 5I19L 4OZHE 5IVNA 3NCYS 3RNKB 3ZKQD 3FT3A 4UQ2B 5JLZB 2PETA 2YBRB 2AJVH 4HS3A 2VLRA 3UJJL 2BSSB 3P0YH 2BY3A 4NZUH 4WV1C 4J4PD 4EQ3A 3KG5A 3F5WA 4OM1H 3P3YA 4FQ1L 3TBWA 3MV8D 4KK5D 5B8CB 1EHAA 1I1FB 3BKJH 2AABH 3DNKA 4AEFA 2QHLA 1BBDH 3DI3B 1YDPA 5FUZH 1NGYB 4X5LA 4BZ2H 3MNVB 1QLRB 2AJZB 2VYRE 2BNRD 1P7QD 5J6GB 1S9VB 2AGJH 1HSAA 1MELA 1XR8B 3MA7B 2B7DT 1F11A 4NQSA 1X5KA 4ZUSB 4KHTL 1FC1A 5JTWA 1KJ2A 1ZV5A 1REIA 4ZPTB 3BYYA 4DKFH 1BZ9B 4QF1B 4PRIB 5IT2H 1WFOA 1VDGA 5DJ2B 1RI8A 3UPAA 1QBMH 2BVPA 4LLMA 4JVWA 4LVEA 1HNGA 1MHEA 1RD6A 4NKMB 2FNBA 4YDKL 5E2VL 1MLCB 3RWFB 2HN7B 4OSUL 1MQ8A 5FHAH 3VFRA 2ADJA 3P77A 4K23L 3OKKB 2I60H 2XXMB 5I1CL 2D3VA 4PJDB 2ZUXA 1P2CA 5GS2D 2FZ3B 2J4WL 3K2UL 1JFQL 4R8WH 5D7LE 5DFVD 2OQJB 1FPTL 2OL3A 4K94L 4X80H 3QR2A 5TQ2H 1ZSDB 1LO3H 5F1IB 5B8CC 2Y25A 2HRLA 4YH6A 5F70A 3X14A 5CEZE 3MOBL 3MRFB 3Q1SH 3KPRA 3ARDC 4FQHA 4LAQH 4MQXC 3QCUL 4KJWC 2DQCL 3RUGE 3RL1A 3D87B 4ELME 5FB8A 3O81A 5JDJA 4YDLB 3SCMC 2MTPA 5CILH 3TEUA 1DQDL 1CICC 3O6FC 4I1NB 2X1PA 3RZCC 3FB7A 3WIHA 4OCSH 2FJGA 1YA5A 2OBGA 1A6UL 3PWVA 1BZ9A 2FHCA 1ACZA 3G6AB 4HIIB 4YDJA 1MCDA 2IPUK 5ANMB 1A14L 1D9KC 1YEIL 3V5HA 5D1ZB 3X11B 3S35L 4PGCB 5I1IH 3D9AL 3RVVD 1L7TL 3VXRE 1IT9H 4ESKA 5C0AD 1CFNA 3TJHD 4PGEA 1GVIA 1YEHH 1OP5K 1DBBH 1X7QB 2F54D 5EO1A 4N8VG 4H8WL 5DHVA 1T7WA 4WI6A 4LRNL 3KDMA 1WCQA 5AYQA 3U83A 5E7FA 2F54A 1HINL 1N0LA 4I3SL 2R8SH 3MRLA 2VQ1B 5ENWB 3QIUB 2VABB 2FB4H 3QXDB 1GZPB 3RTQC 3U1SL 2DQTL 5E56A 1A2YB 5DO2D 1ND0A 1AO7D 1AGFB 4YPGA 3ZE1F 3BIAX 4HK3J 3B5HA 2X4TA 4U33A 2V5MA 4ZD3L 2ENSA 1UZ8B 3CZFB 3ZE0E 5F71A 1XF2A 4X99B 4JQXC 3TN0A 5F9WB 2M2DA 4OJFH 5L8JB 1K4DB 4U1NA 4P5KA 2AK1H 1UZ6E 2JJSC 5TFSL 1Z9SA 4DKAA 3VXNB 4RQQB 2A6JB 4MCYB 5J1AA 1U8PA 4JFXB 4YHYC 3OAUL 5LWYL 5DMGC 4AYFA 4PG9B 2IQAB 4X98A 2R0LH 3VWKC 4QCIB 4A6YH 1TPXC 3CVIH 5DXWA 3SQOL 1YPZB 2Q7YB 3C5ZB 1A4JB 2X4NB 4U4BA 1ODAA 2CXKA 4EXKA 1RZIA 3PWNB 4GKZA 4KI5F 1MCWM 4ODSL 4UOW0 2O5XH 2EE6A 3IDXL 4EI5A 3QUMB 3I6GA 2DLTA 3UJTH 3SE4C 2Z0BA 1S7XA 3JWOC 2H45A 3BKYL 1PBYA 1A2YA 1EERB 3QDMD 1MHCA 3MJGX 1HQ4B 5I75B 4M6NL 1RV6X 2DQJH 2X4RB 2E9WA 2Z91B 3FO0H 1HKFA 3DIFB 3G5XA 4FQ2H 4P4KA 4XVUD 5KVFH 5M95B 5FECA 3WHE1 4GQPH 1OTUD 5DUBB 3LH2H 2QSCL 2ILLA 3KYMB 1YNLL 1VACB 5F9OL 1YECL 5GQBA 1P6FA 3ES6B 1CT8B 2AQ2A 2HH0H 3TJEH 4LMQI 1A21A 4HGKC 1N7MH 4MDIA 3T1WA 4PG9A 4X98B 3JVGC 3CU7A 3FO9A 4PY7A 4M8QB 5H35B 2HMIC 4I2XB 2NY4C 1BFOA 5CKAA 3M45A 3CSGA 1T89A 1JPTH 4ZAKB 2DM3A 2YXMA 4IRZH 1IQDA 4UB0H 3VXSE 4B53A 4HLJA 4MX7B 3UJIL 1P69B 4P4KC 3QCTH 3MRGB 5JW4R 5F7NC 3G5VB 3TNNB 5JW4N 3FQWB 3HNSL 4J6RL 1BD2E 4LCYB 4R7DB 3QRGL 4WEMB 3MRKA 3JV6B 1IGIL 1KFAH 3N1GC 3RFZC 2ICWJ 3SE4A 3SY0B 4S1RL 1GC1C 4NO2A 2BSTB 5D71L 1NDMB 3QEGL 2AABL 3FO2A 1DVFB 2HG5B 3HKFA 1F02I 3L3GA 4YAQB 4UI2A 5DUBA 4WEUD 5TH2B 5D7LD 3DX9B 4EDXB 3TH3T 1TJGH 2WIMA 2F9BT 1JI2A 1QSFE 1Z3GH 3BPLC 2D31A 2NY2D 4TUOB 3B9KA 3STZA 1RK1A 5J3HD 5F88A 4CN1A 2ZUYA 3DMMC 4AIXA 4GQ9H 3LKRB 4Z0XA 1YEEL 2DLFH 4PLOB 2AK4B 1FNFA 1LP9A 3L3IA 3MV9D 3BZEB 1X4ZA 1QSVA 1A4JA 1J1XL 2NY3C 1IFHL 1KPVB 3UTTD 4ZUSA 3WJJA 2EKSA 5MEQA 5IWLA 2GTWB 2R15A 4X9GA 3NAAL 4PRIA 1XMWA 5E8OB 1R3LA 3FB8B 4KAQL 5CCKH 3WDIA 3E6FB 5DJXA 4WFFE 4H8WC 2QADB 1D6VH 3PJSA 1ORSB 3MODL 1IC5L 4PV8B 4V1DD 2B20A 1Z9LA 1AD9B 3QPXL 2H2SD 2J1KA 1VSCA 2H32A 3WFBH 4Z7OE 2ATKB 1OAUL 5EU7C 3L3HB 1RZGA 3QG6A 1P5UA 3C6LA 1TPXB 1J86A 4TULH 1MUJA 4X5XB 3IFOA 1EEZA 2X70B 4L1HA 5K9OA 1X3DA 3AXLB 5F1SA 6CGTA 3MRFA 2VDQH 5IQ7L 4R96A 3DROB 4LLVA 3S6CA 4UDTA 1VFAB 2Z31B 4PS4H 1PG7H 2QHRH 1UKTA 5ICZA 3SGJC 4PJHB 3QI9C 4G5ZH 3C8KA 2FJGB 1BVKB 3RZCA 4PFEA 1IT9L 3E3QE 1MVUB 3TYFA 3JTSA 5L6YL 2AEIT 3QUKA 1U3HB 5D7LB 2JCCA 1M4KA 1QSEB 1YEFH 1UH3A 3BKML 1QFHA 3FT4B 3Q6FB 1M6OA 1EO8L 2WZPD 5JDSB 5T3XE 3OHXA 4EQ2A 3VXPA 1MHPL 5HGHA 2BXZA 3U1SH 3OX8B 4R3SA 1MF2H 3MLWL 3G6JB 2OXHA 4JFED 4ODXB 1I7ZA 2VLRD 1IM9B 2BVTA 3AU1B 1H15A 1U8QA 4XCYB 1Q72L 5B38G 3LKSA 4NQEB 1IKFL 1INEH 5DRWA 1J5OL 3BD4A 4RWYH 4W68A 4FQIH 4QRPA 5C6PB 3KPPA 2H2PD 5D7IF 1WBYB 4EN3B 4BSWA 3NMEA 1GGIH 3LQAH 1NFIB 3MV8A 4FXKA 1O5DT 3TN0D 4LSVL 3OKYA 1U2HA 4DKEL 1AIFB 3F7YA 4UT7L 3G6JF 5IMLB 3BGAA 4TNWK 5BJTB 5HYJE 1DQQA 4PRNA 4PPTA 4LEXL 4WGWB 2X4SB 1J11A 4FXGA 4NHUA 1FAIH 3LDBB 1KCKA 1IRAY 1CLZL 2X4PA 5EZLB 4TOYH 2NXYB 2FO1A 2XWBB 2ADJB 1F90L 4KQ4H 1K8IA 3CFEA 5LCVH 2EYSA 5F9DC 5E6YA 1RUPH 1ZHKA 3B9VA 4XNXH 5GZNC 3BRGC 1Q9WB 5AAWA 5D7JB 3W9DA 3QUXB 3VFNB 4RA0C 1KIQB 1Q0YL 4EIZC 1ZA6A 3RWCB 3BKYH 4CMHC 1L0YA 2X7LB 1FNGA 5JHDA 4F9LC 4BSVB 1IM9A 4OCYL 3UYRH 3SKOA 3VH8A 1S78C 25C8L 2Z4QB 3K8LA 3MBXH 2AP2A 2VN4A 3EJYC 4XWOC 4CMHB 4FQ2L 3OB0K 1B0RB 5IBTH 3S96A 3RKDD 4XP5L 1D5ZA 1A4KA 1IGMH 3ESUF 1CE6A 3SE8H 2QSTA 1FV1A 3WXVH 1JGDA 1NFIA 4FXKB 3GM0A 1JL8A 4WU7B 4NQCA 2QQNH 5I2IB 2XTJC 3QJFB 4G6JL 5KAQF 5HY9A 3I3DA 4YFLI 2XKNA 3D2UB 4JFFA 4N9OB 2YXFA 5DJZA 3RGVC 1PKQA 1WIPA 1CIDA 1C16B 1D5IL 2V17L 1G1YA 4XP4H 4LCIL 3WNPA 5I19H 5F9JB 1LP9E 5EORL 2VB5A 4F7MA 1MAML 2Z35A 1T83A 4Z7NF 1OSZB 2D03L 4W6YB 3UPRB 3TF7C 5FUOH 3TA3A 3FO9B 4J6RH 4PY7B 1OWWA 5I8EA 5EU5B 4GW4B 4JM2A 1F97A 1U8IA 2CIKB 4K8RC 4J3TA 1AR1D 4PJGE 2CK0H 3LOWA 1WWWX 2GIYA 4X6DA 7FABL 4OZIA 1AGEB 3QPQD 1C5DA 2FCBA 1J18A 4JKLA 5E2UH 4MNGB 1MAJA 3X3GH 1IAOA 2WBJC 5DD5L 5MI0C 1JNHA 1CDUA 4ZNCD 5I1HH 1MPAL 4LVOB 3S97C 5BW7C 2BNQB 5CEYB 1NDMA 5EZOL 2LU3A 2VR4A 5KSAA 4YAQA 4WI9A 2A83B 3U4EA 5ID1B 3V6ZB 5HHMB 4FQXA 1CGVA 4G9FB 4E41E 4OCRL 3LEYH 2X4OA 3NABH 5CGMA 4X4MA 2MWCA 4KUZL 2Y07L 2XRAL 4FQXD 4LNRA 1RUAH 3P73A 3LAFA 3LKNB 2FX7H 5DHVH 3PWNA 4GKZB 4ZUWA 4Y2DD 1MWAL 4RRPG 5I1GH 4M6ML 1AH1A 5EN2A 3I85A 2KH2B 3UTTA 3P9WB 5L88L 3SBWC 5D93B 1RZFH 1AQDB 4NN5B 4GG6E 5L8LB 2Q1EA 3CXHK 3QWRD 4NBXB 4BM7A 4R8WL 1CFTA 1KYOJ 4K94H 3DSFL 3CFKA 2R1XA 2C4XA 2VTFA 4C56A 2OSLA 4OLWH 2XTJD 5EG6C 3KPNB 1CGTA 1AGBA 2IPTL 4JFQA 4N0CC 1GZQA 3RDTB 3RPKA 1IMHC 3DTXA 1F3DJ 4CNIA 2DQIL 4WHYH 3T3MF 5GXBB 1A6ZB 1JPFB 2NY6C 3BOVA 3C6LD 5SWZB 5MEND 2VISB 4OQTL 5GS0L 4I77L 1S78D 4FNLL 4JY5L 4EDWL 5KS9A 1KCRL 1QBLL 3WJLA 3VWJD 5LGJA 4GBXD 5C0RL 1J0KA 3GIZL 3SDDA 4X5XA 3LN4A 5CJXC 2K1MA 3HC4H 1NBZB 2PW1B 1ONQB 3VD5A 1I1AC 3IFNL 2VOTA 5CINL 3RVWC 4J3WA 5E2WH 5ANMA 1L7TH 2C3VA 4RWHA 3PV6B 4OT1H 4UQ3B 5E1AA 3NACL 5IHUH 4I9WE 4YHKL 4KTDH 1TVDA 5F3BA 4PGCA 4LRNH 3VRIA 3CX2A 1A9EA 2DTSA 1Q94B 4L5FH 4O4YL 4FA8A 5DK2B 3ULVF 4K7PY 1EDQA 1IAIM 3WNMA 4ZD3H 2YA2A 4ZFOB 3OR6A 4LGSB 4PJIB 3KPLB 3HG1A 1IAMA 1N2RA 3O3EA 4KRLB 3U7YL 3CMOH 4MJ5A 4XCNB 1QFWL 1AGCA 4M43L 4HLZH 5KSUB 4GAGH 4JRYE 4MQ7B 1D5BA 1T0MB 2R4SL 2YN3A 4XAKE 4ODVL 3OJVC 4FS0A 1I8KA 3PP3H 1PZ5A 1DQLH 1K3IA 2A1WH 4OLYL 2GHWB 4MAYB 3V0VA 4G8GB 5GGRY 3L9RB 3L6FB 5FAAA 1C5CL 3EKCA 4FTVD 2NNAB 3CK0H 1WBXA 3N9GL 4Q9QH 4OLUL 3WNLA 5C0CB 2CDFA 2VDMH 4G80A 4N5UA 3VRIB 1R5IB 1YQVL