4AENB

Hla-dr1 with covalently linked clip106-120 in reversed orientation
Total Genus 43
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
43
sequence length
188
structure length
181
Chain Sequence
TRPRFLWQLKFECHFFNGTERVRLLERCIYNQEESVRFDSDVGEYRAVTELGRPDAEYWNSQKDLLEQRRAAVDTYCRHNYGVGESFTVQRRVEPKVTVYPSKNLLVCSVSGFYPGSIEVRWFRNGQEEKAGVVSTGLIQNGDWTFQTLVMLETVPRSGEVYTCQVEHPSVTSPLTVEWRA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Immune system
molecule keywords HLA CLASS II HISTOCOMPATIBILITY ANTIGEN, DR ALPHA CHAIN
publication title Peptide Linkage to the Alpha-Subunit of Mhcii Creates a Stably Inverted Antigen Presentation Complex.
pubmed doi rcsb
source organism Homo sapiens
total genus 43
structure length 181
sequence length 188
ec nomenclature
pdb deposition date 2012-01-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00969 MHC_II_beta Class II histocompatibility antigen, beta domain
B PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4aenB02
3.10.320.10 Alpha Beta Roll Class II Histocompatibility Antigen, M Beta Chain; Chain B, domain 1 Class II Histocompatibility Antigen, M Beta Chain; Chain B, domain 1 4aenB01
1J86A 2E6JA 2VDNH 5FHAH 3J7HA 1S7TA 3LY6A 5FYLE 3SKNA 1AQKL 2PO6C 2XZQL 3PWPD 4K7PX 4R96B 2Z93B 1JWMA 4DQOL 2ADIB 4GMTH 1J8HB 3G08B 3L3DB 4JRYD 4OCRH 2OQJB 4U2YA 2JJVA 1FSKB 1JHLH 2ESVE 2BXZA 5C07A 2DJ4A 1ACZA 4K2UL 1HK6A 1WZMA 4MDIB 2VOTA 1IKNC 5HYSG 2XQYG 1UYWL 4YHKL 4HK3N 4OM0L 1FL6A 2FGWL 4HLZG 3P9MA 2SEBB 3BUTA 3CZJA 4FABH 1VGKA 5FYKH 1P7QA 3OXRB 1CLCA 1P7KB 4JCLA 1MHPL 5ESQB 3T0DA 3I75A 5FDYA 3NN8B 4HQQH 3L6FA 3EOBA 3PGCA 2R2BA 4K23L 1Q9KA 4B7IA 5EPMA 4O4YH 2C3HA 3QEQB 4PJFE 5J3HD 1UXSB 4ONGL 4PS4L 3PDOA 3IDMB 1Z5LB 1A3LL 3MBXH 3GJEA 1H0DA 7FABH 3VD4A 4JO1H 1UACL 3U0WL 3RBSA 2HWZH 1DLHA 3VXTA 4LP5A 4IS6B 4LCWD 4XPHH 3ILQC 5DK0A 1AQDB 1VACB 4UT6L 3PP4H 1WFUA 2X89D 3SCMB 5KSBB 3HRPA 1BVZA 5IROC 4GXUM 3AMLA 5EZIH 3CFBB 3EJZD 1S9XB 5L8KB 5E9DB 2FWOB 2VUYA 4XCCL 1BWWA 1S7UA 1I3RB 5TQ2L 1OB1B 1VGEH 4POYA 1MY5A 4IIQB 5SWZA 4WI3A 2Y23A 1WWAX 2WIIB 1FBIL 1T1WA 2EDQA 1FPTH 1MIML 2Y07L 1KTDA 3HHRB 1K4DB 1G9MC 5AAWA 1RV6X 5C0AE 2GJ6D 1E4JA 1NAKH 4M48H 1CICC 2E9JA 4L1HA 3O3AB 3WO4B 2CR3A 4JGMA 1KYOK 2HVJA 4ZAKD 3L5HA 4U1LA 3U4EB 4JFFD 1P6AB 4NZUH 4U2ZA 3B6SA 3RGHA 4U0QB 1H3PL 2BC4B 3IFOB 4X9IA 2DQHL 4HXBH 2EO9A 2OR9L 5IEHB 4B5EA 3O3UN 1ULVA 5IR1A 1MWAA 3CZFA 3MV9E 5HHVL 5K9OA 3GMQB 4WJ5A 1NMAL 1WT5C 4E0RA 3LH2H 4LCIL 5B38B 1IL1B 5IBUB 4M4RA 3TEUA 3KPNA 4LVOC 1QLFB 3MGOA 1EO7A 4JFQA 4N0FA 1NCDL 2NY4D 1IM9D 1U8LB 3MV8B 4YHOH 1I85A 4FTVD 3TVMB 1E6OH 1WEJH 2OBGA 3LKPA 3RY6C 4M03A 3DYOA 2MCPH 3AB0B 3G6DH 4P57B 2IPKB 2IG2L 1PKQB 4YHML 5KS9F 1ED3B 3WIIH 3NA4A 4DGIL 4XC1L 4DK6A 1U3HC 3EDKA 4P2OD 4HUXB 3UDWA 4FFWD 4Q7DA 1T89A 3V5HA 1A47A 1UM5H 2XN9A 1A7NH 3H0TA 3VCLB 4LVEA 4U1SA 3VGGA 3T8XB 1GCFA 4DVBB 4N0RA 5I1AB 1G0YR 2Q8AL 4WI9A 3QWOA 4Y5XB 1MSPA 1UCBH 2ZOKB 4M7LH 4NQVB 4JHAL 4P4RB 1OL0A 1IKFL 2F8XC 3DX6A 2D31A 3JV4B 3QUMA 1CVSC 3ZKXC 4U6YB 1EK3A 2F9BT 5AWNL 3D85A 2ADGA 1A6TA 2EXWC 5GS1A 1VKXA 1U2HA 1P9MA 4DGVH 3NGBC 5BV7B 1U3YA 4JY4B 3TNNB 5LQBH 4UB0L 3HI1A 5FV1L 5C0DA 3W9EA 4AL8H 4YXHH 3LRSA 3MLSL 1QPPA 4X98B 1X5KA 3V6ZB 4BH7A 2YWZA 4P5KA 3ZYIA 3ZT7A 1NANH 1UEMA 2NTFB 5MHSE 4G9FE 3CLEL 5IB5B 2APWA 4PGEB 2IEPA 1GRWA 3EZJB 5D6CB 3SDYH 3UTTA 2VDKH 2JKXA 3VGDA 4BA8A 4ZXBD 1FFNA 2CLVB 3V52H 3FL7A 1HHJA 3PHOA 3UEZA 4ODWB 1QFUH 4KMQA 1RZ7L 2D0FA 4H0HB 3VFVB 1MCSA 1JN6B 3MMEA 1C5CL 3SDXB 2YBRA 3IFLL 5HBBA 4P23D 1F8TL 2OYPA 4PBVC 3MODH 3MA9H 5F7FA 1JPTL 3FCTB 4D8PA 3ZKQD 4EI6A 5MEND 2F54B 1OGTA 2HN7A 1G9ML 2HJFA 2QJDA 1FFOB 4G6JL 3TYFB 5B21A 4GG8A 3DMMA 5L7XL 3DSFH 4Z76B 3U6RA 1L7IH 5DK2A 4G8IA 4D3CH 4UNUA 3QEHB 3CXDL 1PYWA 4LOUD 1HSBB 5JZ7C 3QO0B 3N1MC 4PJ7F 2NW3A 1WCBA 2C26A 1VFMA 4HIJA 4AG4L 3INUL 2CKBH 1EJOL 4EI5D 4XNQB 1QBBA 4Y5VB 4CVWA 1S7WA 1B6DA 4Y4FC 4NJAL 2EZ0C 4YQXH 3DRTA 4KKLD 5I1KH 5E0QA 3AAZB 2I27N 3VXRE 5CD3A 2ATPB 3MBED 4K9EC 1DVFB 1EUTA 3H9HB 4H1LA 3PWJB 4QXUH 4ENEC 4IRJA 1CQKA 4IRSA 4EXKA 3RZCC 3FOLA 1GXEA 5TGBA 3KPLB 5DJXA 1A6WL 2CDFA 4DTGL 4OUUB 4X7EC 5J9PA 2AQ1A 3GO1L 1GYAA 2HVKA 1AD9B 5L6YL 4ALAL 4PJAA 3UJJL 4L8DB 3MLXL 4NPYB 5D1QA 1FG2B 1GGBL 3I6KB 2IPUK 3IDYC 4NHUB 4XP9L 1JMXA 2EIZA 5TDNB 4X6CE 3P40A 1KTLA 3AUVA 4R0LC 3FO1A 4R2GB 1BJ8A 4JZOB 4Y4HA 1TJGL 3WFHB 3BN9C 1VCAA 1ACYL 1AE6H 4N0UA 4RWYH 4EQ2A 2NY2C 1MCHA 4YHIA 1Y18A 3BP7B 4PJCA 4WI7A 2R2EA 1A1OA 4WNQA 3RQ3A 3NZHL 1MQ8A 1J10A 2IGFL 5DD0L 1CD8A 5C6WH 4GXVH 3L3KB 1RIVH 3ALPA 1KGCE 4QNPE 4GBXB 4GKOA 3P11H 2VR4A 4JRWA 4OCLC 4GAGL 1IQWH 2QQNH 1PBYA 3HE7C 4JHZA 2BVYA 3CDYA 3GK8L 4WO4A 4TUOB 1BJMA 5CFHA 2E27L 3HUJF 1U91A 1RZGB 2UUDH 3PWUA 3UAJC 1MI5B 1QO3A 2BVUA 4MWFA 3PV7A 3RNQA 5E6ZA 1M05B 3MNZB 5HYSB 3QIUC 3NFSH 2YRPA 1V7ML 3U0PB 4YHPB 4Z7VF 1LO2H 4PJDE 3VFRB 4M5ZH 5IT2H 3D3VB 3DJ9A 7CGTA 4K8RD 1JZ3A 3RTQD 3WL9B 3LKQB 1ZA3B 1QFHA 1AFVL 1RJCA 5EZOL 2VDRL 4L4TB 3HMWL 5IIEA 4MNGA 12E8L 3TIDA 4XTRC 5HVHB 3AFLA 5A43C 5A2IH 4LNVA 5CIPA 4YDIH 4PY7B 4UIKL 5EOCH 1RIHL 1WWBX 1E4KC 4R7NB 1HH6B 4OTXL 3M07A 5T1MB 5DRWB 2EE6A 4Q2ZB 2V5TA 1VFAA 3VXPB 3HS0B 3F62A 4PJAE 4YDJA 5HGBB 2A6JB 4F37K 4IRJD 4Z7WE 3SGDI 1NCWL 1NMBH 1BIIA 2XKSA 4J4PD 1A7OH 2QR0A 1CLZH 2FL5A 3G6AA 5DJCB 3VFWA 4OV5B 5F6IB 4XMLH 4CW1B 5CZVL 4N0UE 4PRHD 1TCMA 1YNKH 2FYYA 1B2WH 2WV3A 3GMLA 4MJ5B 3DO7B 5IFAH 1NLDL 1KIPB 1QBLL 1NCAH 2DQEH 4QT5A 4N5ED 4TSAH 5E99H 4A6YA 4W4OA 1QG3A 2ZSVA 3QUXC 1FRGH 2GTZA 1LP9E 3BP5A 5DZLA 1AKJA 1ORSB 3T2NH 2BSTB 4ZS7H 1CFVH 2E9IA 3LEVL 3SBWC 4A2MA 2C7UB 3FMGH 2VWEC 3T65B 2PTTA 4JM2F 1NBYA 3BH9A 3B43A 3LPGA 3BKCL 3VFUB 2Q87A 4UDTB 3IXAB 3I6LD 3O2WL 4MD4B 4PP2A 2ZUXA 3Q3GA 2I60H 3S98A 5CWSB 4JFPA 3ARZA 1CDJA 1EJ6A 1QSEE 3P9LA 1NFDB 4JPVL 4W4NA 1GOFA 4IOSD 3PDDA 1S7RA 4P46B 4XH2A 3RVXD 3LAFA 4KJQD 1QSFD 3DHJA 4XCEB 3TPKA 4PJ5D 5FCUL 4F58H 4FQQA 3SDCB 1GZPA 3MREA 1M7IA 3S36H 1KXTB 4ZUWA 2H26A 1HYSD 3Q1SH 2V7NA 5DC0A 1UH2A 1W72H 3U0TB 5KSAB 2IMMA 1ZOXA 4P48A 5K9KA 1YPZE 5E00A 5I1HH 2WMPA 5EZJA 4DZBA 1MF2H 2FHCA 4XPAH 5GGRY 5DQDL 3KDMA 3BMVA 1J5OL 3NOIA 4F8QA 4WW1B 4FS0A 3QZWG 4P59H 4CKVX 1D5MB 4O02H 3RPKA 3IAQA 4JPIA 3HG1A 3GGWB 4OCYL 1KB5L 3BIKB 1I3VA 2MWCA 1IAMA 3IDUA 2FH8A 1LHZA 2LU3A 5KOVC 3OBAA 1RK1A 3QXAB 5EORH 1MFBL 3UTSA 3FFCD 1OSZB 2E7CA 3N9GH 3RL2B 1R3IH 2IH3B 2W9DL 4I0PA 3P30H 1YN7B 4KU1A 1C08B 2CO6B 4LLQA 4U6XB 1OGAE 5FB8B 4LCCA 3FRPG 1CFQA 3CU7A 1IEBA 1ITBB 4K3EH 5DEGB 5D7LE 4GW4A 4AIZB 5F9OL 3P77A 1U8NB 1WGOA 5I9QB 2EH8L 3LPFA 1JTOA 3PWLA 5HXMA 3ULUC 4LU5H 2VDOL 1F58L 4Y1AB 1BLNB 1PW3A 1GSMA 2UWEB 4YDVA 1ZHNB 1WBZB 4UT7L 1O0VA 1XIWA 2HJKA 3QUZB 4XCNA 5ISZA 5J1AA 2YXMA 3QNZA 3L3GA 5CILL 1LVEA 2YC1B 3LIZH 1CFTA 3JTSA 4OCNC 5IF0B 4GRLA 4NO2B 2W65A 4QTHB 1TZHB 3D1MC 3EGSB 4NGHH 3RL1A 4DZ8A 4L8CA 3D0VA 4NQCD 3I6GB 2WW8A 1E28B 2AVGA 1FZMA 1F13A 5GGTL 2M26A 3QDME 3EYUH 2PTVA 2DQTL 4MAYD 1KB9K 1R3JB 5DJ8B 3V6OE 3BD5A 4JANA 3RIFF 2VE6B 1CFNA 3HZYB 4ZO8A 4KKCC 5E2TH 3UPRA 2EYTB 1JGDB 1HILB 3PL6C 4W81A 3QNYB 3QXTA 3MYJB 5LAXA 3VXQA 1KEGH 2X4OB 1QVOA 3O6FD 5C6PB 2Y7QA 1CXKA 2UYLA 1F11B 3CC5B 1K5NB 2EDNA 2LU4A 3V4PH 3V5DA 3SN6N 5EO9A 3S4SG 3MPCA 1PEWA 4X99A 1A14H 3F8UB 1YMHA 3DIFA 5CMAB 2A83B 3CFJB 1A3RL 3NMEA 4MQXC 3SJVE 5DD6B 5CZXD 5CBEA 3EO0B 5I18L 4HUWB 3VFGL 1ZGLP 3S6CA 2BSRA 1ZWIA 4JQVC 5GGQH 1Q9LB 3RA7L 4Z77B 4QYOB 4OQ1A 3RWEA 5L8JB 2FBJL 5TE7L 1TJIL 3ARGA 2VDQH 2P24B 4K3DL 1CL7L 4EEEA 5I1JH 1UWXK 1QFWL 3QHZH 1D6EA 1V3KA 1F02I 2F15A 4N5UA 3SQOH 5A1AA 5BZDA 2XA3A 2B7DT 3L3IA 3S3JA 4NQTA 4HC1H 1Q72H 3HNTH 4M7ZB 1XCTA 5F93C 5GGRA 4OZFH 3GSRA 5HHMB 1SJHA 4EDWL 2PXYB 5C09B 5JIPA 1LEIA 2XY1A 3P3YA 1T80A 2NY6C 2VLJE 4FNLL 3HZVB 4X8JB 3N85L 1BGXL 4NHCL 2V5SA 5FV2A 1XCQB 3HLAB 2F5AH 1G1CA 5ERWB 3NA9H 1YEFH 1TJHL 4U0RC 1U8QB 1YJDH 3HNVL 1FIGH 2GSIA 4WFFE 2J7LA 3MRJB 4R97C 3IDNB 2VZSA 3K4AA 3QBTB 1OLZA 3JV6A 1A4KB 5IB3A 3JUYA 5D7JC 1KUMA 3D87B 4RGMC 1HXYB 3LQAL 4LGPB 4EXPX 3IVKB 1JYXA 3VG0L 4GRLD 2CPCA 3OJMB 3ULSA 3MACL 5A16A 4LF3B 1GZQA 4UQ3B 4G7YL 1KNOB 4L4VD 5D7IE 5DJAA 4PJEE 4NCC1 2YEZA 4OQTL 4KY1H 1QFOA 4ORZC 1WSST 5LWYL 3O0RH 1FIEA 4NCDA 2VLRD 5FHBL 2ZPKH 4LPYA 3I3DA 1XF4A 5HI5C 2F74A 1IM3A 4ZD3H 1S7SB 4FMKA 3ULUL 4PREB 1EO8L 4LHQB 5GZOC 3AM8C 3WD5H 4PRAA 4JJ5A 1K4CA 2Q1EA 4U1KB 5K9QI 4GMTL 3S96A 4DK3A 4BUHA 3FB7A 4OCRL 3SGJC 1KSRA 1QBMH 2A73B 1KIQA 3MYZA 2GY5A 1KJMA 2RCSL 3CSYB 2HRPL 3HAEH 5CEYA 5J1TC 1QR1A 2VR9A 3QPQC 5ICYB 1QLRB 2W59A 4HS3B 1FVCA 2C1PA 4S10A 2OTWA 2XFXB 4OCMC 1CGVA 4OD2B 2XIDA 3MV7B 3ARDA 4OFYA 3NACL 4HJ0D 4RAVA 4OAWB 1T0NB 2EXYC 3X12A 4P5TD 4X9HA 1S7QA 4OLXL 5FXCH 1XH3A 1MVUA 4O4YL 3MRLA 5DUBB 3ZTJH 1HNFA 2IBZY 1A2YB 4WW2A 4LSVH 3S9DB 2B4CH 5ILTH 3BISA 3PABA 3UJTH 1BM3L 1OM3L 4Y4KD 3BDBA 3SKOB 1GC1L 3UTQB 4QOKE 5JQHC 3C60D 3E6HB 1IQDA 3J8F7 2F53A 4KDTA 3RKPA 2Z9TA 3QEQD 5SX4H 1EAPA 5EU5A 2NPLX 5EC2B 1XF5A 4MZ3A 4QXTA 3V0WL 3ZKNC 5IFHH 3H7BB 2AJSH 2Q6WB 5F9DC 4Z0XA 2CKNA 4NN5C 1UZ8A 3LN5B 1FV1A 5EOTB 3VRLF 1M1SA 1CF8L 5H94B 2JIXB 2NY3C 2IPUG 3PV6A 5E8DH 2R69H 4CJ0A 5FECA 4O2EA 4X0KA 4WCYL 1F6AB 4LRNH 3T0ED 2DBLL 1Z2KA 4UAOC 4X9FA 1LD9A 1IC7H 4ZSOB 3WEXB 2CJUH 3HZMA 2BHUA 5CSZA 4I0KA 1LK2B 1EDQA 2BVEA 1BBDL 2BNRD 2FEEI 2O5ZL 3AREB 4J3VA 2GTWB 4WWKB 2X41A 4FQXB 2VQ1B 4X6DF 4KROC 5F70A 2NNAB 4HXBL 4N1CA 3PNWB 1NGWB 2HH0H 5E08H 1FH5H 2BNQB 4JO3H 4K7PY 4N8VG 3QZWB 3P73B 3FQNA 4OZIE 2FB4H 5D2NB 1QQDA 5ESVB 1YQVH 2QBWA 1IRAY 3SGEH 2YPLE 3FQXA 3S34L 5IMOB 2IPTH 3DARA 3QDJB 4CADB 4JY6B 2MHAB 2X1OA 3B9AA 3QUYB 5C1MB 4NQEE 3I85A 1L7TL 2JJSA 5BS0E 5IP4A 3IF1A 3W0WE 4N90E 3CX5K 5GS2D 4R4BA 4QRSA 5CGYC 1HXMB 1MRCL 5GGSB 5D71H 5JW4Q 1VADB 1INDL 1RY7B 4ZFZB 4K3JH 2JLLA 1RJZA 2N56A 4WI2A 3WIIL 4MXVE 1TNMA 2IAMA 2Q3ZA 1ZLWH 1ZGLA 1BZ9A 5I71B 1A7NL 2F53D 3RJQB 5HYJB 3BH8A 2J12B 4RAUB 4WEUD 1UKSA 4KXZI 3DXAA 5KJRH 3SE4C 2VITB 1CS6A 3Q0HA 4NP4L 5IB2B 2IFGA 2R0LH 5T3ZL 1RU9H 4HPOL 2P5ED 2QADD 1YEDB 4C55A 3LN4B 4FQJH 4M43H 4MNQD 4NRZB 5DMKA 4HJJL 1YEGL 4M7KL 1FFPA 4O2CA 1WWWX 4O2FA 2DM3A 4GRMA 4P49A 4OJFH 3UX9B 4TVPE 5B8CC 3QI9B 2ITDB 5DA0B 1M4KA 5LQBL 5ACMA 2VAAB 1WBXB 4NOFA 1GGUA 3PWNA 1NAMH 4TTDC 1LK3H 2L7JA 4XP5H 4OLVL 3W81A 1IC1A 3K8LA 1R3LB 1DR9A 2XQBL 1U8PB 4CN1A 3BPLB 4U1IB 1T0MB 3NIGF 3V4UH 3TWCL 3ZKMC 2I9LB 1UKTA 5FM5O 2J2ZA 3UTZA 2EICA 5J13C 3EOYG 4FFYL 4O5LL 4NYLB 3EZ8A 2P4AB 5FOBA 1ONQA 1VESA 4JQXA 3ROOA 2YKLH 3N1QC 4PJ8C 2I9TB 1NC2D 3ARFC 1UM6H 2PO6A 2A6KB 3TN0D 4PD4J 4HHAA 3KYMA 5L2KD 4NWTL 5KN5B 2H45A 3N1FC 2BSSB 5GRVL 3C6LA 4OCXH 2X9XA 2R9HC 3MA9L 2Q86B 1N3NB 5C0GA 4AMKL 3L3HA 5CJQH 3S4SB 3KPSE 2DQIH 1LE5A 3TBWA 3GBNL 3QWRA 5BZWB 5EB9A 4MD5A 3PJSA 1NKOA 5EFIA 5C08E 1JJUA 4JM2C 3VFSA 3RAJH 3U9UA 1R24B 1HHKA 3VW3L 3EAKA 3UXFA 5I1CL 1RVFH 1M71B 4YC2B 1PEZA 1RD6A 3RDTC 1TZGH 4KTDL 4KWUA 4U7MA 4D3CL 3QPXH 4G3YH 3U2SA 1OP9A 3BXNB 4GAFB 3PWPE 3S36X 4JFOB 1BX2B 3QUKB 1OP3K 5MI0B 4OGZA 4U0RB 3CSBA 5T3XH 5FK9B 1CXEA 4PJIA 1EHXA 5I2IB 4RQQA 4POZD 3T04D 1VFOA 4P4KA 5L9DH 2BY2A 2A74A 5BO1H 1FCCA 2NW2B 1KCUL 4ZPVB 1FGNL 3QXDB 3KS0J 1ETZB 4YQXL 4ISVA 2D9CA 1DSFL 1PY9A 2Z4QB 3RRQA 4JDZA 1A6PA 4H26B 4H5SA 1G1YA 5IM7A 5DVNA 1KPRA 4I5BA 4NQDB 1F45A 2BNUB 5LG1A 4HH8A 1JE6A 1NFIB 1XGUB 4ZUUB 4J7RA 3LEYH 1MIEL 4NBXB 2HFTA 1S9VB 4OGXH 4KHXL 3O8XC 4Z7QE 2QSCH 1K3IA 5I1GL 5BV7L 4BQCA 1QRNA 4XMPH 1BREA 3QG6A 3BI9X 3KHQA 1G7JA 3PHQB 5C0ND 3BRDA 3ILPA 3MROB 1CDIA 3PQYA 4FXLA 3FTGA 2V9RA 3HI5L 3RIAF 1G9NH 4WU5A 4M1DH 4AQ1B 1C1EH 5CZKA 3FN9A 3ARYA 1NUFA 4LCWE 4RWYL 2E7LC 4EOWH 4G6KH 5F7EL 1SY6L 3G5VA 3IXTB 1XGYH 2NZIA 5HYQA 2CH8A 3ZSSA 2PO6D 4R2GD 1CQYA 2EDWA 2H32A 4F7TA 4MVBC 3RIAK 2VDPH 4EDXB 4HFWB 1KLFA 3PGFH 3ZL4L 4FZEH 2ICWI 1RUPH 2YS4A 5JHDE 2BFVL 3DNKA 2YZ8A 1Q38A 3VWKC 2GJ6E 5E1AA 1J18A 4K3GA 1WT5A 5DVLA 3L7EB 1EO5A 4Y7MA 4KRPC 4LLWB 3OHXA 2AJ3A 4GBXD 2CK2A 3TBSB 3DPBA 3ZE1F 3MNWA 2GAZA 3GMRB 5FUZH 1TQBC 4RMWA 4Y5YB 5FF6A 2VB5A 1VEMA 3O2DA 3O4LB 2P44B 3K4DA 2MKWA 1SEBA 5LXGL 3WN5B 2NY7H 3H42L 4IBLT 4TUJA 1FZKA 5KVEH 3UO1H 3NPZB 1JHTB 1OQXA 2AXJA 1MJUL 4QHNA 4UV7H 4XRCB 3Q5YA 3U46B 5KG9A 1AP2B 5A2FA 2W0FA 4EBQH 2HT3C 2FH6A 4D9LH 2R1WB 2X4UA 1U3HA 3F7QA 4Y0GA 3VXRB 3DUHA 4ELMA 4S1SH 2XKUA 2PNDA 1ZVSA 4Z7NE 1BOYA 1MH5B 4PJ7B 1MCJA 5JTWA 3W11C 4WUKL 5EOCL 3VWJC 4QWWD 3MRRA 5IESH 3ILQD 2RFXA 3EO9H 2NYYD 3EFFB 5TE6H 4MB3A 4F7EA 5DRXA 4FTVE 3B2UC 1QRNE 3WJLC 4LKXA 1YDPA 3QCVH 3VGAB 3CK0L 1EEQA 4APQB 3TLRA 2VXQH 4JO4H 4HUVB 2AJYL 2B0SL 2PYFA 35C8L 2EH7H 5I19H 1A7OL 1KFAH 4M93B 1CI5A 3QG7H 2IBGA 2J8HA 4Y16B 4UUJB 3BD3A 4LBEB 3VXOB 1KULA 4HEPG 5IFAL 1MWAH 3OKOA 5E99L 2FX7L 1DE4A 4ZUTA 5DK3A 1CICD 1IGTA 3BP6B 4DN3H 3H9SB 4KHTH 4U6VH 4BZ2H 2BRRH 1S8DB 1HNGA 4NUJA 2J5LC 3LKRB 3LD8C 2BXYA 3HC4H 5E8EB 4PGBA 3IJYB 1CXFA 4NUGL 5EIVA 2HJLA 4PLOB 2NX5B 2R4SH 2FD6H 4S2SA 1BQHA 1BOGA 1CL7I 4ZFOB 4F9PC 1Z9LA 4GKZA 1QFWI 5CHNA 2E5EA 1LE9B 3NAAH 3ARTA 4NRXB 5GS0C 2X1QA 5CEZD 1B0RA 4OGAC 1NBVH 4OI7A 2AEIT 4FQ2L 4N8VB 1YMMA 4LSQH 4XNMB 1T6VN 5JW4M 1H3VA 2AEQL 4FQPA 4PJDB 3HC0A 3P0VH 3A6CH 1N4XH 3HPLB 3A6OA 1NBZA 1XF2A 4UINH 3MOBL 3HUJB 3Q1SL 3G5XB 5HDLA 1RK0A 4FZ8H 3HR5B 4NSKB 2CDGB 1IAIL 4Z78A 4CBPA 3C08H 2IAND 1YEIL 3VXUD 4X6BA 3K0WA 1JGEB 1L6ZA 3QUMH 4X4XB 4XPAL 3WSQL 3QIBA 4HKJA 2B8OT 4Z7VB 3EHBC 4KDVA 4MLIA 2Z92B 4FXGB 2LVEA 3U1SL 3FOMA 2OJEA 3O6LH 1JWUB 3ESVF 2A9ML 5IOPB 4LLMB 1CIUA 3MV01 4F7PB 1SMAA 4L5FH 4GAJH 1B0WA 5ITBL 1WBYA 2QSQA 4ZUVA 1UQSA 2DIAA 4ZOCA 1YJDC 5IQ9B 5MENE 5DLMH 4AEIH 1EGJL 5T1LB 1MREL 2EYRB 3ULVH 1MLBB 2VISB 3RWFB 3TYGH 1TFHA 1OAZH 3HTLX 5IG7A 1G7LA 5MEQB 3MO1A 5DDHB 1DTUA 4GT7A 3IU3B 5D5ME 3CDGA 1T1ZB 4NBZB 2EXWD 5EORL 5GJSH 3LSOB 1RZIB 3IDJB 1DBJH 1J05A 1FE8H 2YA2A 1LP9B 3RZCA 2BERA 5IV2B 2J6EL 5ENWB 2H6PB 1XGRA 5FO7A 3ZZ1A 5FKPA 2R15A 2Q76B 1I4FA 2OI9C 4K3EL 2Q7YA 1G84A 4PB0L 3B83A 1A9BB 5DUPH 3TIEA 5I75C 3ULVF 4GG6E 1QSEB 1JBJA 3BZFA 3D0LB 5FUOH 1TVHA 4X7CC 4CVXA 4H0IA 5F7LB 4GKNA 5CS7A 4KUZL 5IVXA 4RA0C 1T1YA 3KLDA 4WY7L 1ZGLM 5F7DB 4XAWL 4OM1L 3V5KB 4MSWB 3DURA 4ZNCD 4ODHL 5DMIL 1YEJH 3KPRD 4Y1AD 1KB5A 1C16B 4L9LC 1DFBH 2HFGL 3BZDA 5H37G 5L2JA 1QA9A 1H15B 1FLTX 1YPZB 5DO2C 4XCYA 3VXSA 2C4XA 3F7RA 5JPMB 1NH6A 3TF7C 1IBGL 4J3OC 1EHLH 5IW1A 1EEZA 3WHE0 4RNRA 4TQEH 3QIUA 1N6QH 2DQUH 3VMNA 2Q7NA 5D93C 2VRAA 1DLFH 4OZGA 1P1ZB 2A9NL 1IC5H 3SO3C 4NZRH 5JZ7D 4AK1A 4OZ4A 2X4RA 2B4CC 2ICWA 4H1LH 2W91A 3T3MF 4QRTA 4OF7A 4XZUB 4YXKL 1MCOL 3MRPB 1FNGB 1YNTA 4RFEB 4YWGH 1TZIB 2RAMA 1UJ3C 5IFJB 5I30L 2JELL 2Q8BH 2D0HA 4Y4FD 1NBQA 4Q6YA 1YN6A 1WZLA 2NY5L 5JOPD 4AJ0A 2EZ0D 4NM8L 4YBHA 2LTQB 1R5IB 1W0VB 1RZKH 4J3WA 1ZK9A 3O8XB 5GGQL 3RX7A 2IFFL 3O2VL 4LHUG 3D6GA 1OGAB 1I1AC 1FVEB 4RISH 4ZNEE 1INQB 1VFUA 1ZT7A 3MTRA 4P3DA 3DHMA 4V1DA 4RGNB 4ZMAT 5F9AC 3X14B 3QDHA 1WTLA 2CSPA 3EDJA 4MJID 4UU9A 5D1XA 3EYFB 4NQXA 5GISL 1SBBA 4ZTPH 4BZ1L 3MRGB 1Q72L 5HPOA 5BVPH 1LEKA 3KYOB 3KWWB 4PGCA 5H8DA 3X13A 4DUVA 1MJ8L 5IJVB 3L1OL 4QRRB 4HBCH 1OWWA 1EMTH 1F6FB 5E6IC 4NO3A 5GGTA 2FLBT 3CFDA 3QUXA 1MNUH 1A5FL 4IOIB 3ISWA 1U6AH 2B2XL 3BN9D 1LO0L 4LCYB 1AY1L 1I7ZA 3SBWA 3C6SA 1I1YA 4JFEA 1YJDL 5HHMD 4BFGA 1FIGL 1QP1A 2EKSA 4KQ3L 4D0CB 4PJCF 4QRQB 1CT8A 1BP3B 3VXSE 4PJBA 5IMMA 3ZTNL 5BW7A 2R8SH 4P9HL 3R06B 5H35B 4U49A 3MZGB 3HE7D 1NCUA 1R3KB 3WNNA 3QDMB 1V7NH 1G7QB 3C2AH 4X7SH 3CXHJ 3IU4H 3PP3K 3TA3A 3UAJD 1QEWA 1WVZA 3MOAL 3SEPA 5I17B 2H9GB 3SPVA 3EFDH 4KI5C 4E41D 3JVGC 5IW6B 2H1PH 2AJUH 3RVVC 2N7AA 3GJFA 3OR6B 2Y1VA 4LSUH 1LO3H 5C3TA 2DICA 4IDJH 3F58H 2DYPA 1DUYA 2XPGB 1ORQA 4HV8B 1D5ZB 1S7XB 3I6LE 4YLQT 3HMXA 4WV1B 4Q9CA 4UTBH 4NO0B 1J1PH 1OARH 2QQKH 3WD5L 1NSNL 1Z3GH 5TDOB 1X5LA 4JFHD 4JZNB 3B3IA 4XTRD 1I1CA 2ATKA 2DQDL 3QCTH 4LVHC 4Y19A 5ICXA 3ARBB 4U1HA 4I77L 3T3PF 2R0ZL 5F7HA 4L3EA 5F9WB 5E8NA 5C0BA 1CDUA 4I18C 2YPVH 4R3SB 1HN1A 4HIIA 4HZLA 3OX8A 1A7RH 3MUHL 4Z5RB 5EUOA 4LPCA 5DT1H 1AGCA 1HQ4B 2FJHA 5LGKA 4ODVL 3MRNB 4QRUA 2Y36L 1PLGH 4NRYB 2VLJB 5IB4B 3QWQB 1KLGA 1R5VA 2OTUB 4Y8DC 1HSAB 5DFVC 4G8FA 2B1AH 15C8L 3H8NA 9CGTA 5D70L 2BVOA 2NXZC 2NY1C 2DLHA 2V2WA 4QF1B 1YEKL 5JPNA 5ILTL 4OQTA 3UJTL 1KJ2H 1JP5A 3WUZA 4HH9B 3RWHB 3CDFA 2PYEE 4RAHA 2FEDC 2FJGA 4N9GB 3RHWK 1MJ7L 1DBMH 5FGCE 4HLJA 3W9DA 5C0EB 3B9KB 1FQ9C 4MCZA 4G8GA 1A6UH 3LQMA 1JZ2A 3E2HB 4QHUA 5BOZG 2AKRB 3JBG7 1WK0A 4LLDA 1R3HB 3R1GH 4D0BA 5HYFA 3FFCE 3QQ3A 1JMZA 5C0JB 3GB7B 4U1JA 2F5BL 1LNUA 5KSVB 1QSVA 3KXFB 1IGJA 3GNML 4D2NA 4H8WL 2MQCA 4Z7UE 2HYMA 4TPRH 4E9LA 5I1EL 2DQCL 3HE6B 3R8BB 2X44D 4MJ6A 5T1DH 2V5RA 1NDMB 5E2WL 1ZANL 3TGXA 3RY4A 3BGFB 3NFPA 1RI8A 4OLZH 2FO4A 1U8OA 2JIXD 4WDIA 1E27A 5D1ZB 3L5XH 2QEJA 4U7SA 1ITCA 5BOPA 4ACPA 4HJGA 2ZOLA 2WUCH 1WAAA 2E9BA 1ZHLB 3TO4B 4HEME 1KACB 3GIVB 3O6KH 4M1CD 1T03L 3AS1A 4KTEH 4Q9BA 1DBBL 4XBEL 3GKZA 1J1OL 1RQ5A 4HIXH 1HCFX 3MJ8B 4W6WB 1RAMA 1FN4A 2BRQA 1T4KA 1H3TA 1SBSL 1N2RA 5E08L 2OTPA 1U8HA 3IFPA 3CMOH 1VEPA 1BVLB 2VN4A 1HDMB 4QRPD 3BZ4B 3SE3C 4ETQB 3D5OF 4KGJA 2BVPB 1KEMH 2FSEA 4RMSA 4UDUA 3IDGA 4NQCE 5IVNA 4GUPB 4TULH 1R5WA 4P2RB 1JGLL 1X5AA 4L29B 1JGVH 3BGMA 1ZA6B 4LEXH 1IAKB 2B1HL 3C5JA 2HKHH 3BPOC 2OXHA 4XXDB 4HWZA 4PRNA 3GUTA 4X80L 3QDAA 1D9KC 2G9HA 2W0LA 5I8CB 2OMNA 1OPGH 4QOKB 3QDJD 2QQLL 5EU4A 4WTWA 4K3JL 3QUYD 4YDLC 5J6GA 3KPMB 3GSNH 4OFPA 3VGFA 1ZLUH 2X1PA 4NT6B 1CGWA 5E2VL 4FFVC 1G9NC 4L8BA 2AQ2A 2ZG1A 2YUVA 2JCCE 2HG5B 4LSSH 1EV2E 4W70A 4G8GD 2A77L 5JHLH 4YNYA 1KCSH 3NPSB 3GMPB 1P2CB 1MQKL 4YPJA 3CXHK 5GGVL 2D03L 5GIRA 3MFFB 1SYSB 2CXKA 2FECL 2XXCB 1G6VK 1G7PB 4FQJL 3GBMH 4M43L 4RGOH 3K1KC 43C9B 5D7JA 2Z31B 2KH2B 5D2LA 4R96A 1CFSA 4WGWB 1J8HA 3IDIA 1BAFL 3L3DA 3OG4B 1G7HB 4CMHC 2OQJA 5MERB 3DUSB 1GHFH 4LSRL 3G5YA 1RUMH 2JB6B 1AJ7L 4MDIA 4I8DA 4IOFC 1PQZB 4PRIB 1CGUA 4H0GA 4HIEB 4JHBA 4N68A 2Y5TA 4MAUL 5FYKD 1D5XA 4HMDA 5E70A 2P5WA 5DD5L 1TETL 5FYLL 1EX0A 1NCNA 4H25B 4KKCD 5F3HB 5DEFB 4OZIB 1EHNA 3OXRA 1P7KA 3CVIH 4KVCH 1SVZA 3PL6D 2DTML 5ESQA 3U4BH 1BECA 3MGTB 4OLYH 1YY9C 2YPLB 3MCLH 3THMH 1FC2D 1UXSA 2Q3AA 5DWUL 4NQEB 5KW9L 1Z5LA 3BIAX 4X6DB 3SGJA 2HLFC 4XPFL 4Z7OF 5BS0B 3O3BB 1N64L 5MEOB 4QCIB 3W0WB 5CJ5A 3VXMB 1JGUH 2AK4A 3PGDA 1PAMA 3MJ7A 5TFSL 1XGPA 2R0WH 5JOFB 1EERB 4N0CD 4IS6A 1GPOL 4WUUB 2O5YL 4YJZL 3RY5A 1VACA 4JAMB 1NUNB 2VLRE 4Y2DC 1RZJL 4HKXB 3SCMA 3MLWL 4F57L 3AS0A 4LHUB 5KSBA 2X4TB 1ND0B 1D7FA 4G3YL 3CLFH 3FQUB 5J06A 3CFBA 1ZKAA 4ELKB 5E9DA 1T2QH 2FWOA 4YO0B 5HGAA 5C0CD 2J8UF 2I5YH 1OB1A 3JWNC 2ICES 3K4ZA 3QXVA 5DD1L 1CK0H 5IB1B 1K4DA 4S11A 4Z0BH 5CCKH 1FO0B 1KT2B 4KTYA 2NXYB 2VZOA 3ARQA 4HCRL 4PY8I 3NABH 4KQ4H 2H2PC 1WITA 1JF1B 3TP4A 5CBAB 4G6FD 1C5BH 5DMYA 3RGVB 4QO1A 2PKDA 5C6TL 1AHWB 1PGRB 5TF1H 3NIDE 2ILLA 1TENA 5I74C 3IFOA 1M7XA 3U83A 4YFLI 5HI3C 1CG9B 2KDGA 3ZE0F 2X4NB 5IEHA 3L3JA 3DVNA 4F15C 4S1RH 5F96H 5F8QC 4J3XA 3EBAA 2CMRH 5I6XC 1D6VH 4LLYA 3GMQA 1YYML 3ARWA 2ARJB 1N5YL 4OD1H 3VXNA 4F9LA 4NQDD 3GHEH 2AGJL 2FGZA 3WS3A 4ZYKB 4ZS6D 2HA1A 1QLFA 1U8MB 3QEQE 4JZJC 1QYGH 5IHUL 1AIFA 3BE1H 2NY0C 3MV8A 4PJHA 2MOVA 2YHGA 5AZEL 5B22A 4D94A 3TVMA 2YMXL 4QHKI 3BKJH 3T2QA 5HI5D 4EIGB 5D9SB 3ZLQC 4WHYG 4B50A 2IPKA 5C70A 1JHKL 3KPSB 5T3ZE 5GS1C 4LVNB 4XMKL 5BJTA 5SWSA 2CKBA 4GAYA 4H88L 1ED3A 3N50A 3QRFM 4PP1C 4R4FH 3PGFL 4FZEL 1RUPL 4Q9RH 5JW4R 3ZDYE 5KSBE 1ZTXL 2R23B 3QPQD 4DVBA 3ULVC 5I1AA 1LQSR 1GAFL 3P0YL 1K9TA 3PWPB 3KR3L 3UC0L 2ZOKA 5AD0B 1A02N 3ROLA 2C3VB 4P4RA 2NY1B 4E5XB 3JV4A 4JRYB 3OL2A 3P4LA 3Q6GL 5JW3H 2F19L 1DN0B 2J88L 5FKAB 2EXYD 5JIHA 2ADJA 4X7TB 1GVIA 3LRGA 4PG9A 3UO1L 5KVEL 5DS8B 1AQKH 2XZQH 3BP4A 3NZ8B 4DQOH 4JY4A 2VMFA 5JXAL 4TUKL 5DQ9B 5EO1B 4X98A 2GCYB 3MUZ1 1OLLA 2D7PA 1OQOA 4KMLB 4R7DB 4WW2F 4ZDHB 2ENSA 4GW5B 2UV3A 1ZLVK 2NTFA 4K2UH 3CCHB 4XNZC 1DL7L 1OHQA 4PG2C 1TVBB 1NEZA 1KTKE 2DL2A 1UYWH 4PLJD 2FDBP 5IB5A 4YHKH 5DC4B 4OM0H 2FGWH 5J11C 4RBPH 1AR1C 1P6FA 3DMMC 3ZKND 5LVEA 3HCVB 1TCRB 5T33L 3QCVL 1RHHB 4XP4L 4ONFH 3DX9B 4Q9QL 4OCWH 1JNHB 1MHPH 4MQTB 4ODWA 2EH7L 1P5VA 4X7FC 4U33A 2NY3D 3BZEB 4KK8C 4K23H 3VFVA 1JUFB 5DGRA 5B8CA 1JN6A 1G9EA 4NO5B 4ONGH 2RIKA 3EYQC 4OLEA 4WWID 2LABA 2Z8SA 3RWJB 4WI4A 1U93A 5T1KA 4XVUC 3D69B 3U9PL 3OAUL 1UACH 2ITCB 4GQPH 2F54A 4C58B 1PKQE 4DN3L 1MRDH 2DWEB 3WHXA 5IBTH 3VMPA 1FFOA 3OGOE 1RUQL 5F8RC 2OSLA 1SJEB 2P5EE 4UT6H 3RWGB 3IS1X 1Q94A 3FT2B 1V3JA 4MNQE 4PJGA 5HHXL 5CJXA 1I9JL 3DSNA 2XY2A 3MUGB 4KROD 1HSBA 1C8PA 3QDGD 5I1LA 5SWSD 2VLKD 3H9SD 4PJ8A 4XCCH 4JDVB 5IHLB 5BMFL 3NAAL 4RDQG 3E6FB 3GMMB 5TQ2H 3HZKB 3OKEB 4YXLL 3QFJD 1WIUA 1P4IL 4ZAKB 1FBIH 2OL3H 3VI4F 1PKOA 1MIMH 2Y07H 4JFDB 4JFFB 1U36A 5D1QC 2NX5D 4Y5VA 3V2AR 4AEHH 5I15H 3P0GB 3SKNB 1VSCA 1W0YT 2EYSA 2EC9U 1DQMH 5ALBL 2GFBB 3TO2A 2AJXL 4TNWF 1DVFA 2CRYA 3HPJB 4ZQKA 3BKML 3B4NA 2YRLA 3PWJA 5CGYD 5D72H 3LB6C 3O9WA 1MCWW 4JPKH 1H3PH 3TJEL 2DQHH 2QHRH 2VXVL 3QO1B 1NC4A 1AXSB 1JF6A 4L3CB 1FL6B 3S5LA 4OUUA 4UBDD 5L2KE 1LO4L 1AD9A 5HHVH 3O6LL 3OWEA 1CE1L 4L8DA 4WO4C 1P7QB 4FTVB 1NMAH 3M1BB 4L5FL 1NCCL 2B5IC 1FG2A 2G5RA 3GI9L 1JZ7A 1A0QL 4NHUA 4X9BA 3I75B 1X7QB 3L6FB 4LCIH 3EO1B 2R2BB 3RPIA 2HMID 4IJ3C 4KK5C 5DLML 4AEIL 1LDPL 3I50L 3OR7B 4JZOA 4OV6F 3OAYH 3PDOB 3SDXE 3BP7A 1CXHA 4XVJL 4YK4B 3MRKB 5F89B 3R0NA 4PYGA 1U0QA 1MAML 3F5WB 3QAZB 5GGUA 4DW2L 1BBJA 1DLHB 3L3KA 2IG2H 2J3SA 4IHOA 4YHMH 5JMRA 4M3KB 4DGIH 4XC1H 3MA7B 2X4QB 4TUOA 4HS6A 4C83A 3UJIL 5D6DC 3KAAA 1MI5A 4AEEA 2Q8AH 3ZKMD 4PRBB 1M05A 5HYSA 1XR8B 2VL5B 1S7UB 5FM8A 3BQUA 5SWZB 4YHPA 1IKFH 3KJ6L 1KN4L 1OAUL 4PB9H 3D3VA 4WI8A 3WL9A 4KKNA 3LKQA 4LHJB 4RA3A 5AWNH 5M95B 4EIZC 3ARFD 4L4TA 2ZCKL 3GSQB 2XTLA 3DOSA 1EFXA 3ZHDA 5CLWA 4ZFOL 2HVJB 1X5FA 3K8MA 3BRGC 3MLSH 2IC2A 1BD2D 3B6SB 5CINL 4BH8A 1EGJA 4W4OC 4PY7A 2R4RL 5I16B 1NGXB 3X11A 3V8CA 3C8DA 4DEPB 1JPGB 1JPFB 3V79C 1F4XL 5FA4A 1ZV5A 4UIMA 3JTTA 3CLEH 4NM4L 1HH6A 3SDDC 1J0HA 4DN4L 5DRWA 4JM2D 1OWRM 1AGEB 3OKMB 4TQEL 3VXPA 3CZFB 3HS0A 3WDJA 4XHQA 5HGBA 5K9OB 2A6JA 3O3EB 3FHAA 4EUPG 2D9QB 3C09C 3RDTD 4WJ5B 5BRZA 4P23B 4FQHB 4NN6B 4E0RB 4MLSA 2YUWA 2J6EA 2AERT 4NZRL 2YA1A 5DJCA 3KPNB 4MA8H 1RZ7H 3MGOB 4CW1A 4TOYH 3KHOA 4M6ML 3C5ZC 3QT2A 1J12A 1C5CH 3IFLH 4RMUA 3DO7A 1F8TH 1KIPA 4NN7B 3L5JA 4PJIF 3MX0A 1CE6A 3Q48A 1JPTH 1UGNA 1ORSA 2BSTA 3DETC 1AC0A 1HHGB 3VWJA 2KKQA 1RZKL 1MAJA 2C7UA 4G6JH 5AG8A 3UPAA 4J23A 3BUYA 5L7XH 4MXQC 4PJ9C 2XWTB 3WJLA 5C9JA 3VFUA 4UDTA 3H0TB 5F1NA 1IGFL 1IT9H 1MI5E 3HB3C 5JIKA 4P3CL 2Z0BA 2YD3A 1N59A 3O8XD 3REWB 2Z8WC 5L88L 4AG4H 1NFDA 3V6OC 4GG6B 1AH1A 3INUH 3SGKA 4ZTPL 1JVKA 1EJOH 1EFQA 2A1WL 2H32H 4P46A 4CUCA 4AY0A 3ME0A 2ED9A 1RURL 4XCEA 3ECBB 4NJAH 3NCMA 3SDCA 3MXVL 3SGEI 1A6VL 2X5PA 4Z6AT 3QISA 1JV5A 5C0DB 5KVDH 5E5MB 1MHEA 5KSAA 4GRWH 5EIIA 2RBLA 4TYUA 3R8QA 2JJTC 5TPWH 1S9KC 1EFXD 4D0DB 1T3FA 4I0PC 1N0LA 1FAKT 1A6WH 5FYJD 2G5BA 4MVBD 3IFNL 4DTGH 5HYEA 3X3FH 1DUZA 1I8MA 5L6YH 4LCCC 4ALAH 3UJJH 2CUMA 4WVRA 3VWKD 3BPNC 3C2AL 1PZ5A 3AROA 3GGWA 3BIKA 5E8OB 3PHOB 4XP9H 4GMSL 4KRPD 4M9OA 4JN2A 3EFDL 3GM8A 4MX7B 3F7YA 1TJGH 1ACYH 2LAAA 3W5MA 4LSUL 3KS0H 4QGTA 3NZHH 3IJHB 4CRPA 5DD0H 1WTGT 5FUCC 2AABH 3DX8A 5DFTA 3D39D 4EI6B 1XIWC 2IQ9L 3TCLA 3RL2A 5J7CC 1J1PL 1OGTB 2HN7B 2HT3D 1YN7A 2IALA 2ZJSL 1Z3GL 4YBQC 5CEZE 4GAGH 5CKGA 5FB8A 2BVTA 4PLKD 2K1MA 3GK8H 3U6RB 5DK2B 4G8IB 5DEGA 4O51B 3ZDZF 4RIRB 4AIZA 2E27H 4ELMF 5F1KC 3VWJD 1J9CT 2DJUA 3MXWL 5EN2A 2BDNL 2NW3B 1WCBB 4JHWL 3TZVC 4HIJB 4PRPD 1CDGA 1UZ6E 1V7MH 2GUOA 1YECL 4OSUL 3B2UD 5DT1L 3ZDXF 2K3TA 1BLNA 5HHNB 4RFNC 4NC0B 3ARBD 2IANE 4NBYB 3UYRH 2KQMA 1S7WB 1ZHNA 1WBZA 4U1MA 4YX2L 3FQWB 3QUZA 4F8TA 1I75A 1AFVH 5EZOH 1Z9MA 2VDRH 1ZE3C 2YC1A 4UOW1 1FYTD 2FO1A 12E8H 4DUXA 1RMFL 5EO0A 1SMOA 2DF3A 3T08A 2LU7A 1CLOL 3O45A 5TQ0H 4G6AC 4IRJB 4UNTA 4IRSB 3I6GA 3SY0A 1RIHH 5ACLA 2DOCA 2F8VA 1W8OA 1WC7B 5J9PB 4OTXH 1WJ3A 1R3JA 4FMFA 4PRHB 4EJ1C 1J0YA 3O4OC 2VE6A 5KZCD 3ARGC 4Q74A 3U30C 4X6EA 1JGDA 3QNYA 2EIZB 3WV0A 3MYJA 2OK0L 1YC7A 4F3FB 2XTJC 5EU7E 1XR9B 3FO1B 5GSVA 1F3RB 3DVGB 4Y4HB 5GS0D 1AO7D 5FO9B 5CZVH 1KCRL 1S78C 1W8NA 3HAEA 1A1OB 4WNQB 3TPUB 1K5NA 5D4QA 1NLDH 1QBLH 2AI0L 4L9LA 3MLPA 2A83A 5DD6A 2KUTA 3JV0A 3EO0A 3KXFD 2X70B 4HUWA 3KJ4C 5FM5M 5EULV 1Q9LA 4AT6A 5ETUB 1RZFL 4QYOA 2B20A 5CJOL 3SDAC 4U1GC 1F90L 2WUCL 2Z8RA 2EE9A 4AH2B 3O2WH 4FHBD 5E5RB 4OKVB 1QSFB 2VL4A 1QO3B 4MJ2A 4MWFB 3EHBD 1KPVB 2ZWLT 4PJ5B 2Y9RT 5I8OL 1UB5B 1FNSL 4UQ2B 1FLRL 4NNYA 3EOTL 3KPRE 4Y1AE 2VSDA 2PXYA 4PIRF 1N8ZB 4JPVH 4ODSL 1UWEL 2UWEE 4X8JA 5C7XL 4GFTB 1NQBA 1FORL 1EUUA 5FCUH 3VH8G 3HLAA 1L0QA 1UVQB 1U8QA 4MNGB 3ZT5A 4LEXL 1U8KB 3MRJA 2DLGA 3ZYJA 1Y6MR 5CIPB 2R1YA 4M8QA 1IFHL 1A4KA 4LSPL 3OXSB 4F2MB 3FO9B 1TQCC 4RRPG 3JZ7A 3RUGA 4XB8A 4P2RD 1Q9OA 5DQDH 1HXYA 3MRFB 1J5OH 2CLRA 5FGCB 3IVKA 1VFAB 5K9JL 5JORB 3IDXL 3STLB 5LGJA 3WYRA 4LF3A 4EKXA 2GYSA 1KNOA 25C8H 1PJ9A 2QR0B 4OCYH 1KB5H 2FL5B 5DQJB 2VJXA 5JOPE 1FNEB 5JHLL 4X4YA 3QB7C 2BOBB 5T5NG 3KNBA 3V9FA 2FYYB 1YEEL 2EDHA 1DJSA 2AW2A 2ZCHL 1T7ZA 4OBRA 4A6YB 3ARDC 2DLTA 3GBML 1MFBH 3H2WA 2GTZB 5SWQA 1AKJB 5H2BA 3OSKA 3E8UL 5IVXF 1J7VR 1JWSB 1PZUB 2Z8VC 3BEVA 2W9DH 4U1KA 4I3SL 5SX5H 4OLUL 2W9LA 2PTTB 4WW2C 2A73A 3OKNB 1Q0XH 3FONA 3PP3H 3BH9B 1N26A 1JNNL 5DO2D 1RUML 2FX9L 3W39B 1L4IA 3Q3GB 5F9OH 4JFPB 2Z31D 4KDTC 5L0QB 5AEAA 1KJ3L 1A6AA 5HHME 4BM7A 2VDOH 1F58H 4LASL 5C09E 1S7RB 1GOHA 3MV7A 4XH2B 5INDB 3PE9A 3VFNA 4EUPB 1ZXQA 1I7UA 1I7TB 4PTTB 4OZGF 4JKPL 4JFYB 4KVCL 5ANME 4UT7H 4FQQB 1P4LB 4NQCB 1GZPB 1M7IB 1X5XA 5CILH 5DUBA 3MCLL 3QHFH 2H26B 5EU6A 1A2YA 1KCLA 3FB8B 3G5ZB 4KV5E 4OF0A 5DVKA 5K9KB 2RJMA 1IAIM 3ORJA 5D8JL 3UTQA 2CGRL 3E6HA 2ZNWA 4F7MB 3MV11 4E41E 4I18A 3JSSA 5HHOD 1ADQL 4HWBL 5EC2A 5GGTH 1FDLH 4JLRA 2DQTH 3O6FB 4Y89A 1XGQA 2AAVA 5DFWH 2OZ4L 1I1AD 4Z95L 3LN5A 5EOTA 4P2QA 4OGYH 1I7RA 4RMTA 3VXMD 2P8LB 1H9VA 2E7MA 5H94A 3CLFL 1DDHB 3QIWC 1RHFA 4JFHE 1NAMA 4X4MA 3JXAA 4WUUD 1F6AA 3D2UD 2E9WA 1H5BB 5E6ID 1RK1B 4JRXA 1KYOJ 3UTSB 1A3RH 3WEXA 2KZWA 3VFGH 3FFDB 1G7MA 5DA4A 2FR4A 2JJSC 4KVNL 3RA7H 1K8IB 1CFQB 2FBJH 5TE7H 1TJIH 4ODUA 3KPPA 4RX4A 3BPNB 1D3CA 3AREA 4C56D 2GTWA 3GJFH 4D9QD 5AAMA 4GW4B 5HHQA 4FQXA 2QHLA 2VQ1A 4K3DH 2MTPA 2NXYD 4KJWC 4NQUA 3PNWA 5FDWA 2WBJC 5FA3A 3AS3A 1NGWA 4PJBF 3KLAA 5F96L 3WFDL 2BNQA 2LFGA 4C59B 1CVRA 3P73A 3RGVD 1H8SA 1FNAA 4X4ZA 1D6VL 2IAMC 4JG0L 1F3JB 4EDWH 4OZHF 4LGSB 1OD7A 3LDBC 5ESVA 5A40E 4FNLH 2CR6A 3N85H 1BGXH 4NHCH 1XIWB 2HJKB 4KI5D 1PX3A 4K71C 3OKKA 5IMOA 3LCYA 4CADA 3QNZB 3L3GB 2DMBA 4JY6A 2MHAA 3RVVD 3BYTA 4X5WB 4PJFA 4BSJA 1TJHH 3JTSB 4YBLB 3HNVH 4CL7A 2I07B 4GRLB 4XVTL 2W65B 1X5IA 5E4EB 4NKOB 3BKJL 1HXMA 4Q6IB 5GGSA 4DZ8B 5HGDB 4L4VB 3X3GL 4WEMB 4MMXC 4ZFZA 1S3KL 3S37L 5BXFA 1FZMB 3LQAH 4KPHL 4HX1A 3VG0H 3MACH 1CFNB 4HCRA 3FRPA 3UPRB 3QJHA 2VLRB 4KKAC 2WANA 5HYJA 3GKWL 5LAXB 3RWDA 5GSRA 4JEGB 1SQ2N 4X4ME 2XZAL 1X5ZA 2Y7QB 2K7QA 5LWYH 4NRZA 4UTAL 1INEL 5EO9B 5FHBH 2EIEA 4ZSOE 3TT1H 3DIFB 5C0AA 4NIKB 1EO8H 3NTCH 3MRBB 5DFVD 1MCEA 3QI9A 2ITDA 3PUCA 2MSPA 1ZWIB 1X6NA 2VAAA 2NXZD 1WBXA 2NY1D 3RWEB 4NNPH 2ICEB 4QRPE 3C6LC 3NIFE 5K9QG 3ARGB 3QQ4B 5E7BA 2RCSH 4HWUA 2HRPH 1R3LA 2J8UB 3H7LA 1MCLA 1D6EB 3EJZC 3GM0A 3GDBA 1T0MA 1CGYA 4P5TB 2YPKB 2I9LA 1FO0L 3L3IB 5C86A 5KVMC 2BNQE 2DAVA 1XCTB 2ESVD 3GSRB 1SJHB 3MV9A 4TVPL 4NYLA 1S9YB 5D2NE 1IE5A 1F2QA 2QKIA 3CH1B 5ESAB 4U3CA 3NACH 3ULUF 4ONFL 2G2RA 4Y4KB 4MGXA 4OCWL 2I9TA 3WBDA 3C60B 4LKCB 3QDJE 2C3GA 4M6NH 2A6KA 4OLXH 3UP1A 4GJTB 3CFKB 5KN5A 2GSIB 2BSSA 2EDJA 2GW5A 2XOTA 3IJSA 1BM3H 1OM3H 4P4KC 4M3JA 1U92B 2Q86A 1N3NA 1ZHBB 3S4SA 5IB3B 1GC1H 1TPXC 1UCTA 3ALXA 4UNVA 1FCGA 5F7KC 1MRDL 1A7QL 2AK1L 3GHBL 3C87A 5IBTL 1R24A 3ARUA 3IGAB 3V0WH 1M71A 5E94B 2ERJC 1AGFA 3WUWG 3FAWA 4HAFA 3FO0L 1RUKL 1V3LA 3T0EB 2C3XA 1WAAF 5HYJE 3RFZC 5T3XD 1VFBB 5DJ2B 1CF8H 4JG1L 4DWHA 4JFOA 1BX2A 3QUKA 3KVQA 4HKBA 4N8CL 5I1IL 3QQ9D 5FK9A 5E2UL 5I2IA 4WCYH 4WU7B 4YIQB 2JF1A 2DJSA 2OL3L 2DBLH 5DJYB 3RBGA 2BNRB 2NW2A 4AEHL 4QHMB 5I15L 4KMTL 2XYCA 3LEXA 2VXSL 5FYKE 3QXDA 1OD9A 5JXEA 3VH8B 1DQML 3FB7B 2Z4QA 1FFQA 3VG9B 1KIQB 2D7MA 4MB4A 4P2OC 4JN1L 3VRJB 4MQSB 1BBDH 2A2QT 4JFDD 3M45A 4XPBL 4Y2DA 1D9KD 2O5ZH 5D72L 1QR1B 4MA1B 4KJPC 1FZOA 2XV6B 4YHNB 4JPKL 1XGUA 4ZUUA 4JRXE 4IMLB 4KZEL 2QHRL 4G9FA 2AXFB 3FQRB 3EDEA 1S9VA 1PY4A 2OTWB 2VZVA 3FRUA 4LRIA 5C07D 4LARL 4FFVD 4YHYB 3MROA 1S7QB 3S34H 1M7DA 1HINL 2FIKA 2MCG1 4WW2B 1L7TH 5DHYB 1JRHH 3WNMA 3PABB 5FO8B 3VFOA 3EYSL 1P7QD 3V7AE 3BSZL 1DQJB 1EZVX 1MRCH 2YN5A 5DD3L 2F53B 2XWJA 1INDH 4NKQB 5C0CE 3A0OA 3DUUB 2EE3A 1X3DA 5EU5B 1B4JL 5D2LF 5EBMA 4EDXA 4HFWA 4YZFF 1WIOA 3MNVA 3CSGA 3U7YL 1JYVA 3L9RB 2P5EB 2QADB 4G8EA 4Z0XB 3BPCB 2BJML 4MNQB 1M6OB 4ZXBC 2O61B 4IOFD 2IH1A 4DAGL 4PLNC 2L0DA 1WWCA 4JCMA 5EH1A 4LLWA 5C0IB 3VA2C 3TBSA 5J8OA 2VQTA 4JZJA 4O2EB 4NP4H 4UT9L 4KI1A 5T3ZH 4HPOH 3IB4A 4P3WA 3O4LA 3TM6A 1TMCB 4HJJH 1LD9B 3WN5A 3ALWA 1YEGH 4PB9L 2A6IA 4M7KH 5KS9E 3U46A 1YY9D 4X6FA 4D9RE 4XWOC 4GKSA 2ZG2A 3OB0H 3E1F1 5SWZD 2R1WA 4DKEH 2HLFD 3VXRA 3ZYOA 3I2CL 4OLVH 5I1DA 5HGHB 3JWDL 4NQDE 2KBGA 2YUXA 1NMCC 2XQBH 5DR5L 1L9NA 1Q9WA 3TWCH 1NC2B 3BO8B 3EFFA 5IHBA 3TN0B 2HT4D 5L2KB 3FQNB 4UILH 3G9VA 4FFYH 2FZ3A 5B3NA 1HQRA 4APQA 4O5LH 2H8PA 2KZ1B 1QQDB 5MHSD 5KVGL 5J12B 4TRPL 4PR5B 3WJJA 4X6CA 1NGZA 3FN0L 3O6ML 1I1FB 4MA8L 2EDXA 1B4RA 1A7BA 4WGVB 4TOYL 1N7ML 4NWTH 1HWHB 5IKCB 4Y16A 1CGSL 4BZYA 1RUAL 3IF1B 3MRQB 3MBEC 4LBEA 4GXUN 2OCFD 3VXOA 5J0BA 3M8OL 2D3VA 4R4BB 3OKLB 1JCKA 1MRFH 3LV3B 4AMKH 3T77A 5B4MC 1Y6KR 3GBNH 5IMKB 5GS2H 2CLZA 3GSXA 4PG2A 2H2PD 4Q0XL 3K7UA 3VJ6A 2V9TA 3LKRA 5T5FL 2NTSP 2C3WA 5KAQF 3VW3H 3F12A 5I1CH 4LCUA 4NKIL 5ALCL 4KTDH 4HK0A 5HI3D 2WWMC 3BH8B 3E3QE 4ZFOA 5F3BB 3QIBC 3SOBL 1IT9L 3OF6A 4LLUB 4U6HA 5JMOC 1EEYB 2DD8H 4WFHD 1J87A 2X4PB 4NRXA 2DDQL 5DSCA 5ID0B 4N8VA 3IT8D 1HE7A 1XGTA 3O4LE 2XN9D 3R0MA 1J8KA 4PJDA 4O2FB 1JNLH 2GSGB 4FQIL 5EU3A 3DV6B 4YGVB 1KCUH 3HPLA 3QXWA 1FGNH 2VH5L 3S88L 3KLHC 5E95B 2NY0D 3HC3H 2EC9T 1F4YH 1DSFH 4FP8L 1BZQK 1HKLL 3HUJA 3PWNB 3G5XA 5KVDL 3T1FB 4F7CB 1BJ1J 3N1PC 1VPOL 1WFOA 1R6VA 2CDGA 1NDGA 4PJHF 4BKLA 4PJ7E 3D85D 4HSQA 3V95A 3VD3A 5TPWL 1A22B 4Z7VA 1MIEH 2Z92A 4FXGA 4Y8AA 4PP1D 3X3FL 4KHXH 1AI1L 5IOPA 1KIUA 3SE9L 5I1GH 5BV7H 4F7PA 1EHAA 3N0PB 5FOBB 3IRZA 4Z7WA 3ULVD 5BVJB 5IQ9A 5IHZB 4RMQA 2YRZA 1T5WB 2D4FA 4DUWA 5T1LA 2PO6B 3HI5H 2EYRA 3KYMB 3MUJA 4MJ4A 1MLBA 3RWFA 5F7EH 3NBNA 1MCRA 3UTTD 1SY6H 2ED8A 5MEQA 2BCKB 1F00I 4XVSL 2AABL 1T1ZA 3QDGE 3LSOA 1RZIA 2VLKE 3V0VB 4L1DA 4LAQH 1LP9A 3H9SE 3PJSB 4I0CC 4K7FA 5EFIB 5IV2A 2H6PA 5K59F 3U9UB 5J89A 5CAYB 4XBGB 3QFJE 3ZL4H 3LKOA 2Q76A 3WO3B 4TVSa 4PUBH 2BFVH 2DM2A 2NX5E 1TTGA 2ZUQC 4AENA 4K94L 2HP4A 1A9BA 1MFCL 4ZG1A 3QJFB 3MRDA 4EVNA 1QSEA 1AR1D 3D0LA 3DMMD 1HHIB 4LGRB 4PJIB 2BMKB 4JDTH 4HDIA 4RQQB 3TV3L 2WWKO 4EN3C 1YA5A 1WV7T 2A74B 3VGHA 1J0ZA 4NZDA 5LXGH 3H42H 1CD1B 3UYRL 4P2YA 4N9OB 5DJ0A 5F7DA 1MJUH 3V5KA 1BFOB 5F71A 4ISVB 3D18A 3EYQD 4HFUL 4JDZB 3QFDB 4B7LA 1EXUB 3HUJE 3QEUB 3MUY1 1C16A 4H5SB 4XVUD 5IM7B 4F33A 4I5BB 1OP5H 2XKNA 3NCYP 1YPZA 5TQ0L 4J3SA 1CBVH 5D6DA 3QSKB 5JPMA 1KB9J 4IRZL 4WUKH 4Z7VE 1I9RL 3BW9A 2IMNA 4RSVA 5DRNB 4G9DA 1UC6A 1CYGA 3CK0H 3OJDB 1NL0L 1G7JB 2AJYH 2B0SH 4IRSD 1OTTC 3WUWB 35C8H 4PJGF 1MFAL 4CGTA 3ILPB 3PQYB 1Z0NA 3FTGB 1DBKL 1CICB 1X5GA 2UUDK 5D1XC 4XZUA 2Y72A 3AY4C 1A3QA 1QSZA 1TZIA 2QQQA 5LCVL 1MJJB 5IFJA 5D1QD 1I8LA 4Q58C 5MEPB 5HYQB 2FX7H 5DI8B 2V2XB 1W0VA 2HT2C 4Y4HD 4F7TB 2W9EL 3SDDA 2XA8L 4GS7C 4LDLB 1OGAA 2AXHA 4LSTH 3FB6A 3BWAB 3LB6D 4GLRH 4NUGH 4OIIL 1KOAA 5E1AB 5D7LA 4L8SC 1ZAGA 1Y0LB 4NJ9L 4AIOA 3X14A 5BW7C 2FJFA 1LILA 5FGBA 2BK8A 3OHXB 2AJ3B 3EYFA 1BQLL 4LVOB 3MLTB 3MNWB 4OB5L 3HRZB 1G0XA 2GAZB 3MRGA 1KJ2A 3C5ZA 4FQ2H 5FF6B 4WO4D 3KYOA 5TDPB 1BD2E 4QRRA 4ZTOL 2CUIA 4LFHD 1AGBA 2VZ3A 2IANB 2AEQH 3TA3C 1A1NA 2X2YA 1KELL 3VXUB 3QEGL 3RVWC 2YSSB 5KG9B 4KK5D 4IOIA 3MOQA 2W0FB 1J0IA 3OPZL 3KYNA 4LCYA 5DYOB 1S9WA 4K8RL 3TJHC 3TH3T 4YE4L 1U3HB 5GS3A 3MOBH 4ELMB 4D0CA 2P1YA 4PJ9A 1IAIH 3WFCL 4QRQA 4ZFFB 1YEIH 4HLZH 1B9ZA 4XPGL 3X17A 4ZOBA 3KYKH 3WSQH 3R06A 1JFQH 5F7UA 4FG6C 4LSDA 5FIEA 2AP2A 1HHHB 4HF5H 3U1SH 5DRXB 3QDMA 2A9MH 1YDPB 3V6OA 1G7QA 3BFOA 4JREC 1KLUA 3ZKXB 5ITBH 1MHCB 2PYFB 2N7BA 5DGQA 2FHBA 1BEYL 25C8L 1SYVA 5I17A 2H9GA 3WIHL 1EGJH 5IW6A 5J57B 1MREH 3NGBB 3OR6A 4I1NB 3WLBA 2WQRA 1MCFA 1VHPA 2IQAA 3D25B 4QTIL 5F44A 3S8WA 5J1SC 2XPGA 3GEWB 4HV8A 1D5ZA 4YFLF 4PV8B 1S7XA 3OKOB 4ZUTB 2YK1L 4WV1A 4MQ7B 3LQAC 4PPTA 1IGTB 4NO0A 3SJVA 4U3XA 2JJTA 4HT1L 4Q97A 3EOAA 3WKNA 2J6EH 1QBAA 1UXWA 3BESR 5AUMB 1Q0XL 1G6RB 2HJLB 3GSWB 2AJZB 4RGNE 4PB0H 1AKJD 1G0DA 2C4FU 4GKZB 1DANU 5HDBF 5HGGS 3KYAA 2WLYA 3MRHB 4Z5RA 1B0RB 4R6UA 1HQ4A 1PG7X 3MRNA 8FABA 2MJWA 4WHTB 2BY3A 3KPRB 3MJGX 4NRYA 4QRRE 3MLRL 4R8WH 1GGYA 4KUZH 2VLJA 1IAOA 2MFNA 3HC0B 5IB4A 5JDSA 2OTUA 5EZLB 3A67L 4MCYB 4WY7H 1HSAA 1YY8B 2GT9A 5F88A 3VI3F 3GSNA 3OQ3B 4XAWH 4OM1H 5FYJE 1LMKA 4LPWA 5I73C 3QHFL 1E6JL 4ODHH 2DI8A 4BQ6A 1JZ4A 4LQFL 2C1OB 4TNVF 4QF1A 5DMIH 4NNXB 3EJYC 1DBAH 4Z78B 2HFGH 4MA3B 4HH9A 1RJYA 4X6BB 3RWHA 4JFXA 4N9GA 3UBXG 1P84J 1KCKA 3DETD 4HKJB 4CMMB 3B9KA 2OS7A 1IBGH 1XF1A 4BQBA 2DKSA 1NGQL 1FGVL 5I0ZA 2OJEB 3TZVA 3BDYL 4S0TD 3ARSA 1FDLL 1PVHA 5F6HI 2GI7A 4TNVK 1R3HA 3B9EA 2GK0A 2A9NH 2E7HA 4OGYL 1UQSB 3D39E 5D7IA 4ZUVB 5IVZA 5C0JA 2JB5L 4PJEA 4Y4FB 2X9YA 3S35X 4XP1L 4YXKH 1MCOH 1D5IL 3ZYZA 1GC1C 3HE6A 5IG7B 4CDGC 3HG1D 3UTPD 3V7AG 1SEQL 3O81A 1NDMA 1NFDF 2R1XB 3N1GC 3VE0B 2VIRB 2J4WL 5I30H 2ZUSA 2JELH 3RIFK 4HUMB 5CGTA 2NY5H 3RZCB 4NM8H 4ZO7A 5LGHL 1OCWH 3BT2H 5FCSH 4MJIB 4GOSA 1MELA 4PRPE 2ZUYA 1YYLH 3EW3B 1NGPL 1ZHLA 1JIBA 2IFFH 1I4FB 3CPLB 3O2VH 3TO4A 3GMOB 3GIVA 5IJKA 3MLZL 3PIQB 3UTSD 3IDYB 2FX8H 4A6YL 4R9HA 4I0PD 4R0LB 5EBGA 3B8SA 4UI2A 1OAQL 1FYTE 1U3ZA 5GISH 2NY2B 4BZ1H 1HDMA 5CP3A 3BZ4A 1AGDA 4GKNB 3W2DL 3EIFA 1MJ8H 3L1OH 3WNKA 5IVXB 3M17B 1JPSL 1ADQA 4HWBA 1R0AL 1NGYA 1MEXL 1CFBA 2QTEA 3BAEL 4J1UA 4QEGA 5ANMB 4XC3L 1A5FH 3CX5J 2OZ4A 1ZA6A 2B2XH 1LO0H 2JE8A 3BD4A 1AY1H 3BKYL 1IAKA 3UZQA 1NEUA 4QY8A 4XXDA 3HE7B 2HFFB 5DJZB 3HA0A 1T1XA 3SDAA 1C5DB 4KQ3H 4YGAB 5L2JB 1QA9B 4HWEL 2N4IA 1XIWD 3JWOL 5ISZD 3ZTNH 3LKSB 4QOKA 3U36B 2HTKC 1MAKA 4LMQE 5IW1B 4P9HH 2AV7B 1AO7E 4E41B 3KPMA 3QIUB 2O5XL 2V5MA 5DJDB 3WCYA 2DQJL 1FSKC 4OZGB 1MVFA 4NC2B 2IJ0C 2E6PA 4HJ0C 3V4VL 3WLWC 2EDLA 2ICWB 3MOAH 3KXFE 4HGKC 5E03A 3L95B 1BFSA 3GMPA 2DQFB 2VZTA 1NCBL 5I66B 3MFFA 4P2CG 2G60L 3T0VA 2WWKT 4NDMB 1G7PA 2Y4SA 5F7NC 3TT1L 3K74B 1S5HB 1K8DB 3NTCL 4KFZC 3NCYS 1NSNH 1G7HA 2VKXA 1UH4A 4NNPL 3OGCA 5DRZB 2DQDH 4G6AD 4I77H 4XB7A 2R0ZH 1PQZA 4PRIA 5TH2A 1QNZL 4UU9B 1IARB 2ID5A 4PJXF 5F6HJ 3WNOA 1CR9L 3ZMRA 3ESUF 4ODVH 4J3TA 4PGCB 4H25A 4HKZB 3ARGD 3X13B 5A3IC 4XAKD 5F3HA 5DEFA 2Y36H 3SCMC 2PW2B 1A21A 4OZIA 1PSKL 4M7JL 3MGTA 2XTJD 3QUXB 1HI6B 4P2RE 1ZS8B 2M8XA 2YPLA 4M6NL 3DYMA 15C8H 1F42A 3C6SB 3TFKD 1I1YB 4IIQC 5D70H 4NQEA 3RX8A 4GS7B 5IMLA 5BS0A 3O3BA 1IEHA 1YEKH 4R4NC 5MEOA 1PG7L 4M61A 3D9AL 3W0WA 1KN2L 2AQ3A 4PJBB 5IMMB 1JZ5A 2GITB 1HOCB 2DQGH 3ABZA 1MJ7H 5JOFA 3KPOA 2PW1B 5DHVB 3WO4C 4OZHB 2YD5A 1N5AB 4FQCL 2ORBH 3EDDA 4M62L 1J1XL 1P84K 3SKJL 3WXVL 1T7VA 4LHUA 3CD4A 2X4TA 1ND0A 4E42A 1QEWB 3FQUA 3RU8L 2UZXB 3SPVB 2VN7A 2VKWA 2F5BH 1P7HL 4NKDA 5ABDE 1GJIA 3GNMH 4H8WH 1AR2A 4RCAA 3CVHB 1RZ8A 3K80A 2E3VA 1J0JA 3ZE2F 5I1EH 2DQCH 1DUYB 3WE6A 5IB1A 2APTA 2WINA 1CDCA 2KQNA 4F9LC 1KT2A 5E2WH 1ZANH 2YWYA 1U9KA 2CRZA 4G6ML 1IC4L 3DO3A 5CBAA 4ODXB 3S35L 3B3IB 3CU1A 4MNHB 3VRLE 3WXWL 1AHWA 3TVMC 3CFEB 2KL6A 4Y19B 3FO2B 1NJ9B 1IILE 3SE8H 3KPTA 4QRPB 2R2HB 4QXWA 3AB0C 1T03H 2DIJA 4PRIE 1DBBH 4XBEH 3ZE2E 1J1OH 2X4NA 4HIIB 3A6BL 4EQ3A 2ED7A 3QIWA 3CDCA 3RUGF 4JGJA 1SBSH 5HPMA 3FHQA 4LPVA 3U7WL 3U4AA 4LK4A 1KLGB 1R5VB 4ZYKA 4XI5C 1QPXA 1U8MA 5TE4L 4X5XA 4Y5XC 3F7PC 1JGLH 1QUNA 2I25N 5HHOE 2BVOB 4RZCA 2B1HH 3G6JF 4X6DE 3DI3B 3LS5L 1JRHL 4P5MB 32C2B 4CN4A 5HJ3B 3ARDD 4OFYD 3TESA 4X80H 5D9SA 1NEZG 1CDHA 4YAQA 3VXME 1JPST 4BYHA 3K2UL 3KPSA 4XHJD 5AYUL 1B0GB 4MCZB 2WBJA 2QQLH 4G8GB 4KK9C 5BV7C 3VFMB 2P8MA 2OL3A 4YUEL 2HLAA 4WUUE 5C08A 4QHUB 4JY5L 1KIRA 1KBGL 2GJJA 3UPCA 5E2VH 1XEDA 1QR4A 4NFCA 3QQ3B 43CAB 4U1JB 4YHLL 4LNRB 2A77H 3PWPA 2OP4H 5I73B 2IWGA 1DEEA 4BK4A 1MQKH 2C3VA 3NCEB 1T20B 2AXGB 5GGVH 4E5XA 2D03H 4JRYA 5DHVH 4KI5F 1W0WB 5AZ2H 4MJ6B 4D9QE 3VFPA 4C56E 1CU4L 5DC9B 5AYQA 5FKAA 1T04A 4X7TA 4I2XE 2FO4B 1U8OB 2UVEA 1WQVT 1IGIL 1Z9SA 3QULB 3Q6FB 3D48R 1BAFH 1IGYA 4MHHI 1ZSDB 5EO1A 4HJGB 5DQ9A 4X5LA 5EA0L 3FT3B 4DKEL 4BJLA 4LSRH 4ODBD 4ZDHA 3BHBA 1AJ7H 1WLHA 3CCHA 2WLZA 3PL6B 1OT1A 4MAUH 3UBXB 4U1NB 1T4KB 2NMSA 2ARJQ 1N2RB 4OKDA 5DD5H 1UA6L 1TETH 4NZTH 5FYLH 3HCVA 3FAXA 4UILL 4POZC 5CJXC 5JW5A 1RHHA 3F7VB 3DX9A 3IDGB 1ZLWK 3T0BA 2DTMH 3DROA 1OTUC 1R5WB 1ZT1B 3SO5A 1UJTA 4CDHA 4QKXB 2XI9A 2W60B 3L7FB 3C5JB 5DWUH 3ZKSD 4LCWA 4NC1C 1BMGA 4PRNB 5KW9H 3MSPA 4XPFH 1N64H 1JYWA 5E6YA 2X89A 3DYPA 3NIGE 2XNAA 4Y5VC 1MRFL 2ITCA 1CDYA 3KLSA 3S5LG 4U3HA 5TFSH 3K46A 3WIFA 2BY1A 1S5IL 4A2LA 4G80A 5J6GB 5C0CB 3MR9B 2LQRA 1KG0A 4BK5A 1GPOH 4MS8D 2O5YH 3RWGA 1DVFC 1RZJH 3MLWH 4F57H 2NY6B 2X7LB 5JHDA 3O9WC 3MUGA 1FNHA 5C0NC 1T83A 2GJ6A 1QD0A 1XF3A 1EEUA 4JDVA 1EZVY 1KJVA 3HI6L 1T5XA 2DD8L 4M9PA 3GMMA 3GRWL 3HZKA 3OKEA 3RNKA 4JRYE 2IAMD 4G6FB 4M6AA 5JLZA 4JM4L 4JFFA 5DD1H 3I9GL 2DRUA 1OAXL 4R97B 4BFIB 1DQQA 4M6OL 5HI4D 4M5YL 5F1IB 1ZEAL 5D7JB 1JNLL 2WP3O 5D2LB 4HCRH 4PTUB 3DXAD 5KS9B 4I9WD 1CFSB 3IDIB 4R2GC 5D7KD 2GK2A 4RGMB 2YXFA 2GFBA 3HC3L 3OTTA 4I48A 1F4YL 5MP6L 5C6TH 3HPJA 1QFPA 4PJFF 3G5YB 4ONOA 3T4AB 4ODTL 3QO1A 2Y5TB 1AXSA 1NPUA 4L3CA 1T2JA 4GBXC 1D5XB 1O7SA 4AM0A 1OF2B 4R90L 4C57C 2P5WB 1AXTH 1IM9A 1YYMH 4FTVA 2P8PB 4HIHB 4KKAD 3M1BA 5ADOL 1N5YH 2AGJH 3MRCB 5EC1B 1X7QA 1LEGA 3EO1A 3OR7A 2P7TA 5KTEH 2QV2A 3BQUC 5IHUH 1SM3H 5ICZA 3MRKA 5F89A 5AZEH 5FYKU 4JVWA 4P2OA 2YMXH 1FYHB 1I3GL 1ZLSL 3F5WA 1OAKL 5T3XE 2AK4B 3PGDB 2UZIL 1BFVL 3TCXA 3MJ7B 1XGPB 1JHKH 4QWWC 4LAQL 4XMKH 5M7QA 4H88H 2Q20A 2NYYC 3GSVA 3K2MC 5HVHC 3C6LD 3MA7A 2X4QA 3STZA 4G42B 5CUSL 1P4BL 4AYFA 2WUBL 4PUBL 4XGZB 1ZTXH 1NUDA 1UFUA 3QWRD 4PRBA 1GAFH 5HGAB 1XR8A 3DRQA 4XPTL 2VL5A 2PETA 3P0YH 3KR3H 3UC0H 1QRKA 1HH9B 1T66C 3G04A 3LKNA 5SV3A 4JDTL 5JHDD 3LZFL 4JFDE 4JFFE 5I8EA 3Q6GH 1XZ0A 4GSDL 4HUNB 2F19H 2YN3A 5CLTA 1NLBL 2J88H 1V5JA 4CVZB 4WTZG 3GSQA 5EOQH 3IETB 5F6IC 2Z35A 1AD0A 2DMKA 1T22B 1H3XA 2FNBA 4I3RL 5JXAH 4TUKH 5C07E 3AU1A 4P4KD 1E4XL 4NN5B 5I16A 2CIIA 1NGXA 3DX7B 4ZXBA 3S3PA 1DL7H 1JPGA 1JPFA 2EE2A 3ZE1E 1CBVL 3RWIB 3L3JB 3DVNB 4DGYL 4JB9L 2NY3B 4OT1L 5I76B 1AGEA 3OKMA 3NCJH 2R2CA 4LLYB 4GH7B 3O3EA 4P23A 4FQHA 5T33H 3VXNB 1EA9C 4XP4H 4UAOB 1CLYL 1A6ZA 1T7WA 3WS3B 4Q9QH 2GJZA 4Z8FH 4MXWL 3VMOA 1I8IA 5MENA 5KSUB 1AIFB 2EDFA 4PJHB 4DCQB 1QRND 3SGKC 4P46C 4OF5A 1MUJA 5ITFA 3U9PH 3OAUH 1CWVA 3O11B 3HNSH 5F1SA 2LVCA 5D5MA 3PQYD 3QH3A 4KROB 4JKMA 1HHGA 5BJTB 1FL3A 3QDGB 3SDCC 3EYVB 5SWSB 2VLKB 2CKBB 3FQTA 3NFNB 4GAYB 1RUQH 1YUHA 1WFTA 2ICCA 5KSAC 2CDEB 5HY9B 2XWTA 3QFJB 5HHXH 1FG9C 4LSTL 1I9JH 3DBXB 1MY7A 1DQLL 4KJPD 4EI5A 5EWIL 5IEKB 4FQ1L 2X1XR 1U3JA 2R0KL 4CVUA 3CUPA 2JK5B 5HDQH 5BMFH 5EG6C 3ROLB 3REWA 3SKMB 5SWZE 4GG6A 1ODAA 2VABB 4YXLH 1P4IH 3OZ9L 1T21B 3MBEA 2NY5C 5DXWA 4LAJH 4TSCL 5C0FB 4YHZL 2ADJB 3TT3H 4J6RL 4PG9B 2M1KA 1U95A 1KPUA 2A6DB 3ECBA 4JFZL 1ZT4B 3BP4B 4OZFG 5EU7C 5IVOA 1D5BB 4PGDB 3MRMB 5ALBH 5E5MA 2AJXH 1MHHB 5GRJL 1W2KT 3BKMH 5E8PB 5DJ6B 1MCQA 1FJ1A 1FP5A 4NWUL 3TJEH 1G7IB 1NEZB 1TTFA 5IBLC 2XRAH 2VXVH 4D0DA 3KYKL 4K7PL 1JFQL 4MD0B 1LO4H 1U3HD 4HF5L 4HMCA 1CE1H 3MLUH 1NCCH 3GI9H 5E8OA 1A0QH 4X9GA 4TSBL 5I9QC 4MX7A 1LDPH 3I50H 3QCUL 3FJTA 5B8CB 4XVJH 3PHSA 1U93B 3IJHA 5T1KB 2AEWA 4P9HC 3B5HA 1CTNA 5HVGB 1MAMH 5FAAA 2APBA 1I1RA 1F3DJ 4JPWH 1JK8B 3QUZC 2V7HA 4DW2H 2Y06H 4XWOD 3PWVB 3WHXB 4WFHE 2EDRA 3K3QA 4ORGB 1REIA 2OSLB 5J13B 1Q94B 1CGTA 4PJGB 1JYNA 2AJVL 3GMNB 2XN9E 4O51A 1RFDL 4RIRA 1S7VB 1H3UA 5DMJB 3UJIH 4ZNEA 4PRDB 5I1LB 3MJ9L 3RTQA 2X4SB 3FB5B 3UZVB 3WDIA 3JV5A 4PJ8B 1HZHH 3ARFB 3HAEG 4GW1B 5K33A 4G7VL 3EYOA 5HHNA 3T4YB 3KJ6H 4RFOL 1KN4H 1OAUH 1BD2B 4R8WL 5CEZL 4OD3L 3FQWA 2V2TB 4P9ML 1T7YA 2EYSB 2N1KA 2ZCKH 4QXGL 3GSUB 2RQ8A 3DTXB 4JM2B 1UKQA 4X6CF 3TO2B 3NCCB 3DI2B 3GFUA 2FEEL 1YMMD 4ZQKB 1HIML 2FIRT 1DBAL 5CINH 3WIHA 3O9WB 5E56A 3RDTB 3ZTJG 1UG9A 2R4RH 2PCPB 3BWUC 2VERN 4GQ9L 5B4MD 3ULVE 3O2DL 4J4PA 1OAYL 1O5DT 1NC4B 1F4XH 2ZKHL 4NM4H 3S5LB 1WC7A 1GGIL 4DJMA 4DN4H 3T0XA 3LQZB 1XFPA 4PRHA 3UTTE 4O9HL 4QNPF 2DMCA 4EN3A 1QKZL 2WWMD 1DZBA 1TLKA 3VRIB 1QTYT 2I26N 3QIBD 4F3FA 3RPIB 1XR9A 2OM5A 3DVGA 5FO9A 2CRMA 3VFTB 4M6MH 4M7ZC 4AQOA 3TPUA 1U8IA 2PXYC 4DVRL 2ADFL 4UOJA 4M4PA 5KANI 4ZUSB 5GGUB 1X5JA 2WP3T 1BBJB 2P45B 5BQ7B 2X70A 4PJDF 3UZEA 4IHOB 5GRUL 3KLHD 3CGTA 1EBPA 1FVDB 5DTFB 5EUKA 1OCWL 3BT2L 5ETUA 5JW4N 2W38A 1Q1JL 1A7PL 1UWGL 1YYLL 1LO5B 4HS6B 4C83B 5JIIA 4ENED 4AH2A 3T3ME 2AV1B 3I02B 4H8WC 4OKVA 1QSFA 1IGFH 3TBVA 5CEXB 1KPVA 2BOCA 2FX8L 4PJ5A 3RZCD 5E4IA 1W72B 4KJYA 4ERSL 1UB5A 3BQUB 4P3CH 4UQ2A 2CIKB 1KCVL 4OFVA 5L88H 2D7TH 3VGEA 3WFBL 3AY4A 1N8ZA 2A1WH 2G75B 1AC6A 1RURH 1WIPA 4PJAF 1G6RL 4M1GL 3DGGA 2MKLC 3MXVH 4Z7WF 4OFIA 1EFXB 1A6VH 4N0YL 1UVQA 4F37F 5B39G 1U8KA 2NY2D 1DQDL 4BH8B 1JRHI 2A0LC 3H3PL 1HYRC 2R29L 3VWKB 1QHPA 3OXSA 4HXAL 3X11B 4F2MA 3FO9A 2PYEA 1B3JA 4KUCD 5FA4B 4L8SA 4UIMB 1CN4A 3JTTB 3T1WA 3MRFA 5TJWK 4KRPB 1A64A 4YR6A 3IFNH 3HKFA 1LP9F 2DBJA 5JORA 4PRHE 3STLA 5EBLA 5GHWL 4S1QH 1TQBB 5BRZB 1GH7A 2XZZA 2J1KA 4G5ZL 1I9IL 3VXSD 3REVA 5DQJA 3DV4B 1FNEA 3D39B 5HTSA 4GMSH 3FFCA