4AH2B

Hla-dr1 with covalently linked clip106-120 in canonical orientation
Total Genus 44
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
44
sequence length
220
structure length
198
Chain Sequence
MKMRMATPLLMQALSGDTRPRFLWQLKFECHFFNGTERVRLLERCIYNQEESVRFDSDVGEYRAVTELGRPDAEYWNSQKDLLEQRRAAVDTYCRHNYGVGESFTVQRRVEPKVTVYPSHHNLLVCSVSGFYPGSIEVRWFRNGQEEKAGVVSTGLIQNGDWTFQTLVMLETVPRSGEVYTCQVEHPSVTSPLTVEWR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Immune system
molecule keywords HLA CLASS II HISTOCOMPATIBILITY ANTIGEN, DR ALPHA CHAIN
publication title Peptide Linkage to the Alpha-Subunit of Mhcii Creates a Stably Inverted Antigen Presentation Complex.
pubmed doi rcsb
source organism Homo sapiens
total genus 44
structure length 198
sequence length 220
ec nomenclature
pdb deposition date 2012-02-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00969 MHC_II_beta Class II histocompatibility antigen, beta domain
B PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4ah2B02
3.10.320.10 Alpha Beta Roll Class II Histocompatibility Antigen, M Beta Chain; Chain B, domain 1 Class II Histocompatibility Antigen, M Beta Chain; Chain B, domain 1 4ah2B01
2GFBB 4LGSB 2IALA 1PZUB 4YHOL 4KQ4H 3RAJL 2GYSA 2YPLD 3QQNA 2X4PB 3T04D 3BH9B 4UIMB 5E94B 2PCPB 1ZAGA 4H26B 2ADGA 4IRZL 5TJWK 5C2BH 3R0NA 5TE6H 5B38A 4URTB 5F1IA 1LO4L 2BSTA 5HGDA 3WIIL 1QFPA 4Z7OF 1HNFA 1WWBX 4GBXB 4KK5C 1A64A 2XWBA 1KJVB 4Y19B 5ERWB 3SHSA 3GRWH 3QJFB 5E00B 3K1DA 2Y06H 4OB5L 1IM9B 4R3SA 1FQ9C 5GSVB 4M6MH 3B9DA 5DLMH 4OCLC 1AJ7H 4MDIA 4EI5B 1MFEL 4POZD 4OQ1A 3BKJL 4NKIH 1INEL 4QRUA 1E0OB 1TJGH 1WIUA 1EFXD 3EYOA 1FFNB 5EU6E 1X4XA 1FH5H 2NQCA 1DN2A 3TCXA 43CAA 2J5LC 5JDJA 3ULUE 1CFQB 3BUYA 3VCLA 5BRZB 1GGBH 4M02A 1QBML 1MELA 3D18A 4K3HA 4M3JA 3V8CA 2GITA 2PYED 3H9HA 8FABA 2QR0A 1NFDB 2WBKA 4JKMA 3VJ6B 1H0DB 1AY1L 2VISA 4HZAA 1FG9C 3OKLA 1MNUH 3RHWK 1IC5L 1F00I 2AVGA 4J1UB 3P30L 3BKML 3TPKA 5JLZB 3PV6B 4IIQA 4JB9L 5ILTH 3LZFH 4WW1A 1YMHA 4R4BA 4G8FA 3G9VA 5KAQG 2F53D 2NPLX 4TOYH 3WNMA 4Z7WB 1C8PA 4JRWA 1A7NH 3FT2B 5T33H 5IMLB 5FAAA 3S36L 3ZHKA 2UZXB 3LPGA 2YMXH 1SYVB 2FYYA 1Q94B 3D2UD 3SQBA 1BVKB 2H6PA 3IS1X 5IEKA 2HVJB 1DCLA 1P4BL 1E4KA 2J8UF 2NTFA 1CT8A 1MIMH 4MNQB 2P5WA 1FGVL 4XBGB 4RGOL 3NFNB 5A3ID 3JTTA 4XPHL 5DUPL 4M5ZL 4TVSa 4JFOB 4W6YB 1MFBH 1XIWB 2R4RH 3MLYH 3I2CH 3KPSE 3IDJA 2PO6D 1I9IL 1WUNT 4BSWB 2O5ZH 4TRPH 4HD9A 4CDGC 2JIXA 3TP4A 2VLKD 3VI4F 3L7FA 1PKQE 2DQHL 3IGAB 3FQTB 3ZKNC 2DBJA 3LS5L 4K8RL 3O45B 4ZPTB 4FZ8L 4YFEA 4PV8A 1JGLH 4TTDC 4HUMB 4RX4A 1TPXC 1KIRA 1A6ZB 3MACH 3HHRB 4U7KA 3MRFA 3VXPB 3T0WA 2Y5EA 1S9WA 4NIKB 4M1DH 3UTTB 1F4YL 2Z92A 4QEGA 2FX7L 5MEQA 4S1RL 2LTQB 3ECBA 2NY3C 3WCYA 3CMGA 5E08H 4QNPF 5KSVA 3N1QC 4NC0B 1BFOB 4D9RD 3MBED 3RUGE 5IJVA 5ESVB 1JCKA 3O6FC 3DTXA 2AEQL 3HFML 1GH7A 1VFBA 4KJWC 1W8OA 2AI0L 5AD0A 3WUWG 4FQLH 4MA8L 1BIIB 1DEEB 1NDGA 5HHXL 1B88A 4LCWB 1JNLL 5F7WC 2FNBA 3HRZB 5DVKA 2R2EA 1NAML 3CX2A 5ACZA 2HT4D 5IFAL 1NCBH 4NQXB 3SN6N 4CU7A 4I18C 4AM0A 2EDRA 5EU6A 4P3CL 1OTSD 3H9SD 2H8PA 1TCRB 4ZAKA 4QHKI 4UV4L 3ZKXC 2NZ9D 3NIDF 4M00A 2E7CA 1N5YL 1YZZA 4GJTB 2ENSA 4EOWH 4UDTB 1AR2A 1T7WA 3MRLB 3C08H 1CU4L 3EO1B 4X6DF 2VLLB 2GK0A 5DD3L 5ICYA 5CJXC 3GHBL 4GLRH 4DZ8B 4EDXA 4WEMB 1RZKL 2PN5A 1ZT1B 1RK1B 3GJFB 4IRJD 1AGDB 1S7TB 1ZLWH 3KDMB 1UCBL 3RDTD 3H7LA 4U0RC 5BOZG 1T0MA 1UYWH 1RUPH 4CJ0A 1J0YA 1OTTD 4GSDL 2RHEA 3VWJA 1FL5B 5EC2B 3BKYL 5KW9L 1UB6B 3QHFH 4HDIB 4MD0A 3K4AA 5J8OA 3PL6B 4OCRL 3ARQA 4LNRB 1LK3L 5DDHB 2DYPB 2OCFD 5IKCA 1AFVL 1BD2B 5FYLL 5I1EH 1VADB 4MZ3A 1W72A 4FQCH 4HC1H 5F7EH 3KPSA 3QIBC 2AK4E 5LBSL 1IFHL 3L9RA 3MV7E 1BOGB 4FXGA 4YBQC 2OJZH 2K9UA 4EZMA 3EOYG 4PD4K 3V5KA 1AD0A 1PKQA 3O9WD 2X1XR 2CLZB 3SY0A 4ODWB 5DURB 4AEIL 2ESVB 1CLYH 3QHZL 4HKXB 4U49A 3R4DA 4RAVB 2VLJB 1IE5A 1T3FA 4QXTA 1BQLH 1EEQA 4PRID 4HT1L 1FCCA 4IRSA 1KENH 4FQXB 5I1LA 2UUDH 2DQDH 3AAZA 5J57B 1D5XB 4KJPD 3CK0L 1YY9C 2NXZB 2BY2A 4JN1H 3I6LD 4JPIB 3MOQA 1Y0LA 4GRWH 4XPBH 4G43A 3WSQL 4JFDB 3MRGA 4D2NA 3L1OH 4MAUL 4JDVA 1S7UB 3PGCB 2FO1A 5BZDA 4L9LA 5INDA 4HBCL 4TNWF 4YUEH 1D5ZB 5HPMA 3HLAA 1BX2B 4GXVH 3MXVL 3BWUC 5CLWA 3OKKA 3VFUA 3WD5H 4Y2DA 5HDBF 5AYQA 4R26H 3ULVL 4OT1H 2DIJA 4DTGH 2NX5A 1S7QA 5IR1B 4ZO9A 3CFEA 4JY6A 4GKOA 4O2EA 2Z31A 3NZ8A 1ZVSB 1KCRL 4XC1H 3RWHA 3JWNC 3QI9B 4LLYB 4ACPA 5IUSA 1GAFL 1NC4D 2F54B 1B4JL 2YK1H 4UMGA 5GS0C 3VXSB 3MNWB 3EYUL 3PQYB 1Q1JH 4KKBC 1QSFB 1OGTB 4JO2L 4WI4A 2BC4A 3T65B 3W39A 3UJIH 1YEKL 4ZFZA 1UXSB 4L3EE 3TGXA 3TJEH 1GHFL 3ARPA 3NIGF 5BV7C 5KS9B 4PJEE 1TVBA 5KVFL 5HJ3B 1ITCA 4XXCC 1FORL 1V05A 3AGVA 5I19H 5T5NF 3VDCA 1B9ZA 3P0YH 1N8ZA 2V2XA 5D1QA 5IJKA 2F74A 4RZCA 2QHRH 1G7PB 3CLEL 4HUKB 1MJJB 3DRTB 4M5YH 2YD5A 5JHLH 2XWJA 3O6KL 2SEBB 5HI5C 5C86A 3D85D 5E6IA 4PRNA 4KK9C 3QNZB 1O0VA 1ZLSL 5M94B 4PRBA 3VFRA 3SDXE 3FN0L 1UA6L 3HE6C 1QQDA 3IFOB 5EOCL 1HN1A 4KAQH 4K7PY 5LCVH 4OLVL 3VA6A 5KSAB 1N6VA 1RIUH 2Y6SD 4OZ4B 2MCPH 5JUEH 2AK4A 4KZDH 4MWFB 4JG1L 2Q8AH 4X6BA 4XNQA 1C5BH 1KCUH 4JFZL 3OKOB 4WV1B 3REWB 5GRXG 1QBLH 1S5HA 4AT6A 4Q6IB 4JREB 5C0BB 3CU1A 1UZ6F 4JKPL 3BE1H 5T3XH 1P5UA 1EIBA 4WHYH 1I9RH 4P23A 3SQOL 5K9KB 3SCMB 4DQOH 3ULUL 3RU8H 4LCYA 4QRQA 4YLQT 3S35L 5D1ZB 5J4MA 1NL0L 1KTDA 3DGGA 1GZQB 3OTTA 4YE4L 3ULUF 4PJ9D 3RVWD 1PLGH 1MWAA 1A1MB 2FL5B 4Z7NE 1FE8L 2VXUL 3TBVB 4ENEC 5TPWL 2B5IC 2H9GB 3GSWB 1I1YA 1URLA 1FN4B 2NLJA 4ERSL 3KJ4C 4J7RA 3GNML 1II4E 1JNNL 5GPRA 5T1KB 1LD9B 3KS0J 4I77L 3PF2A 3RWIB 3MUY1 2DMKA 1UH3A 1YYLH 2NY2D 4LDLB 1TZGL 4FHBD 5TDNA 3GSOB 3IVKA 4ETQA 1MQ8A 2CIIA 4NRZB 3WIHH 2VZSA 2BDNL 4OFDA 3ILPA 4R6UA 4P2RB 1W72L 4Q74A 2ERJC 2A6DA 1G7LA 1OP3K 1L6XA 1QLEL 4WGVB 5HYSA 5ITBL 3SGDI 5JR1H 3IETA 4Y4KC 4X5WA 1PSKH 2EO1A 4NGHH 2EYSA 2VLMD 3QP3A 4OTXL 1LQSR 4L3EA 2D9QB 2V5SA 3GFUA 3FAWA 5DR5H 3VFTA 5EU4B 5GGRA 4PJEA 3Q1SL 3LDBB 2CDGB 4R97B 5EO1A 2MMXA 3V0VA 1GRWA 3DURA 5F1NA 1JYWA 4WTXA 4OKVB 3TT1L 4KZEH 4NSKA 5EORL 35C8L 3LKPB 3TH3T 8CGTA 4HIEB 1JGUH 1BZ9A 5ID1B 2V5YA 4WO4C 5D93B 1YQ2A 3SDXA 5IG7B 3C5SB 2Q86A 4U3CA 5F8RC 5SX4I 2IFFL 1CK0H 2YXFA 4PFEA 3V5DB 4XWOD 1FDLH 2P8LB 2QSTA 1BMGA 5DQDL 1JHLL 4ZPVA 1TVHA 3LEYH 1XGQA 4LEXH 1OARL 1Q0YH 1GJIA 3CLFH 4O9HL 4BQ8A 4XVSL 1Z0NA 1AGCA 3F6LA 3L95A 3VH8G 5D7KD 4WU7A 3WIFA 1PEZA 4U1KB 4ETYA 2CKBB 1BP3B 4R96A 2CR6A 4WVRA 1Q9WA 5DMGC 1UENA 1U8JB 3CVHB 4A6YA 3N06B 3FRPA 4JFYB 4NCC2 1LEIA 3UJTL 4AL8L 1B0RA 3MO1A 2EDBA 4WU5A 4XT1C 4XMPH 4R4NC 1QLFB 4V2CB 1MFDH 1YNLL 3E3QC 2R1YB 4H0IA 4LP5A 1HH9A 4JFFE 3UJJH 1T7XA 3ABZA 4TVPH 4LCIL 4WI3A 5A2JH 4PG2A 4R0LA 4QHNA 4XHJD 3ARGC 4K3EH 3OMZA 2DD8L 2VH5H 3BH8B 2WINA 4XVUC 2A2QT 4FFYL 1N59A 5GRVL 3G6JB 1J11A 1D6VH 4LLAA 2Y72A 5I16B 1HHGA 1M71A 1P2CA 5C0EB 5TGBA 3KYMB 3OXRA 3MNZB 1IL1B 2FD6L 1TENA 1N4XL 4U1MA 5KBNC 3EO9L 3CXHJ 3MOAL 4YR6B 4PRAA 3GMOA 4RBPH 3C60B 4I0PA 2VZOA 1CFSA 2VIRB 5BRZE 4NDMB 5F1OB 2X9YA 4ODVL 4NRXB 3RVVC 1NFDE 2EDWA 5I1AA 2WUCL 1S9KC 5AZ2L 2ZUXA 5CZKA 5FO7B 1MJUH 3SKMA 2OMNA 4PYHA 4GKZB 3KWWA 4D8PB 1E27A 2XQYG 4WTWA 2QL1A 1O7SA 1NCCH 1RVFL 3EJYD 4BH8B 1PAMA 2EIBA 2Y07H 2A74B 4OD1H 5FYJH 4BQCA 5ALBL 2BP3A 4N1HB 4ZFFB 3QO1A 5E8NA 3OR6A 4HIHA 1FYTD 1R5IB 2AEWA 2A6IA 1R6VA 2XZAH 5D2LB 1MWAL 1G7QA 2DTMH 3HMXA 1HYSD 4MNQE 3LHPL 1KPUA 3PWLA 1Y18B 4LVHC 1XF4B 4PGCB 3RNQB 1AHWB 4D0DB 4XCFL 4DFIA 1MRFH 4ZMAT 1X5LA 1X44A 3HNTH 4Z95L 4PJDE 3O2DA 3ZKQD 1EHXA 4KUCD 4XAWH 4IOFD 4XPGL 4HJGB 3L5HA 3O81A 1FZJB 4EN3D 5FA3A 2OLDA 1XGUB 3UPAA 2FX8L 4CU6A 4U0QB 1XCQA 4FFVD 3BEVB 4DVRH 3HNVL 2VXSH 5F7LB 4BSVB 1Z9LA 1CE1L 3S36X 5F9JA 1RJCA 5C0RH 1JPGA 1A3LH 3IDXH 3STZA 1J1XH 3O6LL 4JFFA 4LSQH 4PYGA 4Y1AB 4HGKC 4XVTH 4Z18A 4HKBB 4P46C 3QWOB 5HHNB 2H41A 2X4PA 4S0TD 4UIMA 1A6VL 5E94A 4NNXB 5DO2D 5JIPA 1P6FA 4KV5F 2Q8BL 2WIMA 1Q9LA 3CIQA 3BPCB 1R5WB 3DYOA 4LRIC 3SQOH 5EN2B 2F15A 2C26A 1S7RB 4GBXA 3X14B 3ARDB 4HJJH 1KJVA 5H2BA 3O3BB 1ONQB 3DI2B 1OTUC 1FCGA 1H3UA 3RTQB 1MVUB 2IAMB 3QJFA 2EDHA 4HV8B 4XCEA 5E00A 2OXGA 1CIDA 3GSNA 1HWHB 5I1HL 4LCWE 1WWCA 4LU5H 5GSVA 2NY5C 2XN9B 4ODBD 1I75A 1KN4L 1FNSL 3RIFF 3UYOD 1CWVA 4EI5A 4CBPA 1RZFL 4D9LL 3B9KD 1JMZA 4FQQB 4HSQA 1FFNA 5D6DC 3CUPB 2W59A 4HHAA 2KL6A 4NBXB 4YXHL 4NQED 4HGMA 3SDXF 5BRZA 4LHUD 1OM3L 4P0DA 3LMJH 3ESUF 2CLRB 3FB8B 1NFDA 4QT5B 1BVZA 3VJ6A 1H0DA 5HYJB 5DMJB 1QYGL 4OBSA 4YPJA 5HDLA 3L5JA 2XTJD 5FHAL 2NY1C 3BQUD 5JLZA 3PV6A 3QPQD 3TT3H 2AXJA 4OGZA 1FRGL 3QEGL 3CPLA 3BKCH 2PR4L 2W65A 4LF3B 3BMVA 5IMLA 2IG2H 1G6RB 1RIVH 5E2TH 1WIOA 1NGWB 2E9JA 2PXYD 4YIQB 3R8BB 1SYVA 1Q94A 5EZJB 3BPOB 1BVKA 4KU1A 3QCUL 3EOBB 1GOHA 3QXAB 4OLUH 1F45A 2HVJA 5FO9B 3EZJB 2IGFH 3CJJA 4MNQA 5DK3A 4XBGA 4BZYA 1KV3A 4MDJB 1KELL 5E2VH 1BD2E 4FXKB 3REVB 4JFOA 3ZKMC 2HVKB 4Z7NF 3S5LB 1XIWA 1R24B 4RMQA 1SBBA 4PJDA 2VDML 2GTWB 1F4HA 3OAYH 2YPKB 2UZIL 1KYOJ 4BSWA 1A7OH 1TCMA 2OSLB 4GW5B 1JVKA 1HIMH 4NQUA 3BP4B 1NBYB 4O2FB 4Y16C 3T8XB 2YRZA 4QKXB 1OY3B 1QRNB 2X9WA 5IIEB 3FQTA 4UT9H 4HEME 4HCRH 1LE9B 3PWNB 1DSFH 1IAOB 2ESVE 3INUL 5JIKA 4PJ8B 1A6ZA 2P49B 3P4LA 3VXPA 4OD2B 2X41A 1T1YA 5HI4D 2I25N 4HWEL 4G6JH 5DUBB 4BZ1L 4DKEL 3DETC 1EGJA 3ZYOA 1MCBA 3QG6B 4UQ3B 4POUB 3UTZB 1BFOA 4JFDE 5CJOL 3ZE1E 4K8RD 2ZCHH 3D87B 1EUTA 3HG1D 5FKAB 1CLZH 1K2DB 1LMKA 3TYFA 1FZMB 2FEDD 2UYLB 3CXHK 2A83B 1NAKL 4U3HA 3R8QA 3VGAC 1XEDA 4XP5L 3RWDA 5HPOA 5KTEH 4WHYG 5ECJE 1DEEA 1MREL 4LCWA 3HB3D 3HRZA 1KEGL 1EO7A 2XKNB 5TE7L 4Z0BH 4KFZC 1AD9B 3EBAA 4XMKH 4YGVB 3MYZA 5D7JC 3HMXL 3JV6B 1X9QA 1BAFL 4G6ML 1OP5H 5E8PB 4M1GH 2ATKA 4JQIL 3FTGB 4Z7QE 2F54E 2JJSA 1CFVH 4O4YL 1DUZB 3VXSE 3HCVA 4NN6B 4UDTA 4JFED 3O2DL 3PQYE 4ZTPL 4LGRB 1QSFE 3QIWD 1KFAH 1INDH 2IBZY 5CIPB 1MHEA 2BHZA 3EO1A 2VLLA 4ALAH 5E24E 3MRQB 1IEAB 4KDTC 4DZ8A 2H2PD 4OBRA 3VXTB 3I02B 4CVZB 2VDKH 1ZT1A 3TN0C 1BZ7B 3C09B 3GJFA 5KS9E 3NVQA 4FQ1H 1AGDA 2ZZUT 1S7TA 4H8WC 5H94B 3KDMA 4Y2OA 1RUKH 5DGQA 1FVCA 4YAQB 2RB8A 1T1WB 1FL5A 1NGZB 1WZLA 1YNKH 4WI6A 1DQTA 5EC2A 1UB6A 3FB7A 4I0KA 1ZV5A 5CJ5A 4F2MB 5F89A 1U8QB 1G9EA 1CVSC 5BS0D 2DYPA 3WFHB 4S0SD 1NFIB 1QNZL 2NY4B 1CBVH 3DO7B 3F7PC 1BD2A 5CGTA 3O2WL 3QSKB 1VADA 1R3LB 2AKRB 4JG0L 4CVWA 1JNJA 4WUKL 5HDQH 5IBUG 5FHBL 1GOFA 4QF1B 2QSQA 3FT3B 1PG7L 4YDJB 1MRDH 4G5ZL 4NO2B 3GSNL 2AEIT 2AJVL 4HFUL 1JPSL 1DBKH 2APVA 5GRJH 2CLZA 1ZHLA 4ODWA 5F21B 5C0BE 3TNNB 3K8LA 2ESVA 2Z9TA 3VWKC 4HKXA 5FYLD 5CFHA 1V3MA 5I18H 3U0WL 2ZUUA 1S3KL 4FQXA 1FLRH 3S37H 4NT6B 3VXOB 1D5XA 5AG8A 1IEHA 4XNYH 4NO5B 4JM2C 3MLXH 3HE6B 1YN6B 2B20A 4F33B 1RJYB 1RK0B 1EH9A 1NFDF 4JJ5B 3JWOL 4E41B 5C0GB 4QO1A 3QG7L 1D5ZA 4EBQH 4PV9B 1MAKA 1BX2A 5B38G 5CS7A 3QDHA 1OAXH 1RZJH 1KTRL 1VDGA 2X7LA 1U6AH 4FNLL 4Y8DC 1WBXA 4DCQB 4Q9QL 4JZJB 2VJXA 1KIUA 5IR1A 3S35X 2EZ0C 3BT2L 3F7RA 4N90E 1A6TB 1M05B 5DVMA 1ZVSA 2BFVL 4L8DA 1VGEH 3QI9A 1WAAF 2F54A 4P2RE 3VXSA 2HTLC 3EGSB 3MNWA 1IILE 3PQYA 3UTPE 1QSFA 1OGTA 1UWGH 4CMHB 3DRQB 3T65A 3RX5A 1I7ZB 4CN6A 5CIPH 2GW5A 2N1KA 4GKNB 4Q9BA 3RWCB 3TBTB 2XPGB 1UXSA 3ULVD 4WNQB 3SDYH 4PJDF 1FL6B 3HC4L 4C59B 1XZ0B 3FFCA 1LHZA 1KJMB 2R2CA 2P5WD 5A1AA 5KS9A 2F5BL 2BSED 3PE9A 5JW4R 3FT4B 1D6EB 3K3QA 5HJ3A 5EFIA 2WWKT 5MERB 5DMIL 4P4KC 3SE8H 1NGXB 1WICA 1C5DB 1G7PA 3MOBH 4MJ4A 3WFBL 1MJJA 3DRTA 3QZWB 2SEBA 3Q5OA 4JANA 2FATH 1EGJL 4K94C 3JVGA 1G1YA 4KTDL 4U3XA 5A2FA 3U7YL 1N64H 3P0GB 2JIXD 4KUZH 1F58H 4AIXA 4A6YH 2ZSWA 5IBTL 1FGNH 1ZKAA 3IFOA 2XIDA 4I1NB 1U8OA 5AAMA 3TJHC 5DF0A 4OZ4A 4MWFA 4RX4D 5GS0H 1NANI 3EKCA 5GS1B 3H7BB 5K93A 4Y4KB 4GAFB 3OKOA 3QUYA 2APBA 3SPVB 3N0PB 1JF6A 1OAQL 4Q6IA 3T4YB 2W9EH 1HDMA 1IBGL 3O3AB 5C0BA 5BV7H 5IP4A 4FG6D 3T77B 2Q87A 4GMTL 1RUML 4OD3L 5F96L 3V4PL 3VA2C 1T5WA 2C1OB 2QSCL 4LRNH 4OZIB 3L7EB 3SCMA 3RVUD 2R0LH 5K9KA 5T5NG 4YDIH 1F3JB 5D1ZA 4HUUA 1VKXB 3SE3A 1QFOA 2DMCA 1GZQA 4G7VL 4EDWH 4WO4B 4UB0L 1D9KB 1I8KB 2H2SC 2BSRB 4J4PC 4L1HA 2VXVH 4WEBH 2FL5A 4M8QB 1BJ1J 3VFNB 1RULH 3BIKA 1OWWA 5KSBB 3MXWH 3F62A 5CP3H 1HKFA 5EU6D 1FN4A 3ULUD 2FDBP 3IF1B 1FNHA 3N85L 3PP4L 3P9LB 3G6JE 5T1KA 1LD9A 4M6NH 5IT2H 4KXZI 2B1HH 3GSOA 1QFUH 4HWBA 2X1WL 4LASL 1IGMH 4JKKA 3Q6GL 1BIHA 3TIDB 3NABL 2FRGP 3FL7A 4P2RA 2LVEA 2NXYD 5C6PB 1NAKH 2JB5L 2Q3AA 1NCNA 2R29H 3TA3B 2RAMA 1PGRB 2I60H 3U0PB 5I2IB 4P3DB 1S78C 5FCUL 3VWJD 2E27L 5IB2B 4NCDA 4ZSOE 4OCXL 3MODH 1EVUA 1H3PL 4PUBL 3KPMB 5EU4A 3ARGB 1T2JA 4R8WH 4HX1A 1VB9A 3FQRB 1TETH 3TWCL 4HS8L 3CC5B 5MI0C 2CDGA 3QUKB 4LFHD 3SKUD 1Q8MA 4ZNCD 5JXAH 2Y5TB 1AXIB 2X40A 3ALXA 3NN8A 4OKVA 2PNDA 3MPCA 3KPSD 1Q72H 3LKPA 4HIEA 2IMMA 1LEGB 4QXUL 1CF8H 1MHPH 3CDGB 3SDAB 3G6DL 4M62L 1NLDL 4PJCF 3PUCA 4RFOL 5IG7A 3C5SA 1MHCB 4RRPA 4KRPC 2BNQB 5D2LE 2P7TA 4PLNC 1KB9K 2BVQA 1R3IL 1XT5A 5ADOH 4C4KT 1IC7L 3WLWC 5I71C 3RWGA 3KG5A 5J1TC 2IQ9H 2LU4A 4DVBB 4TUKH 4GG6B 4IRSD 3V0WL 1NEZG 1V7NL 2X1QA 4DOHB 1RPQA 3MYJB 5I1KH 4U1KA 1A7PL 1LO0H 2CKBA 4H20L 5F3HA 4UTAL 1U8JA 3UDWC 3CVHA 2VXTH 2MHAB 4GKSB 2PTTB 4JFYA 4UZGA 4OI7A 4D3CH 5DHXB 3MV8B 2R69H 3DJ9A 1CGUA 4ZUSB 2J88L 3T08A 4JQXC 5H35B 1QLFA 2FCBA 4P5MB 1KULA 1CGSH 4LK4A 1G7IA 2R1YA 5K9OB 2W91A 5J0BA 3GUTB 4Y1AE 2VDPL 4NO3B 4Y2DD 4ORGB 3GBML 2FO4B 4KQ3L 1MLCB 4KROB 3FZUD 1MIEH 5HHVL 1MRCL 3I3BA 2X4RA 4HUWB 1JGVH 4IJ3B 3M8OH 3TBSB 1M4KA 5FUCE 5LGJB 2Z31D 5E5MA 5I8OL 1JFQH 4DGIH 1NUGA 3G6JA 2JK5A 4WCYH 4XI5C 4QXGH 3ES6A 5D6CB 5I16A 3RGVB 1Z9MA 5KS9F 2W0LA 3MUJA 4WFGE 4HIXL 5C0EA 5FUOL 3OG4B 1ZA3B 3KYMA 4XP6L 3VGHA 3MNZA 4H25B 4L8SC 1IL1A 3S6CA 1BFTA 3G08B 3IB4A 1NBQA 2XN9E 5EA0H 4MQSB 2GUOB 1RMFL 2YD6A 1B4RA 4C57C 3HNSL 1MCRA 1IAMA 1YEIH 2F8VA 3I50H 3WXVL 3LS4L 3C60A 1FBIH 1J1PH 1BF8A 3B9AA 2VIRA 2XACC 2YD4A 1RIHH 5D1QD 4NDMA 2CO7B 3F65A 3V7AG 4PGBB 3AY4A 3V6ZB 3ETBF 4NRXA 4ZSOA 1GIGH 5DEFB 4PB9H 1V5JA 5E6ID 5HYJE 2AAVA 5HGHB 5FO7A 3KPRB 4BUHA 3IDIB 1KOAA 3S4SB 5JQHC 4B41A 3C5JA 1T20A 3ARUA 4Z5RA 4BH8A 3QXUA 1U8IB 2A74A 2AK4D 4MXWH 2ORBH 1A7BA 4LHQB 5A16B 4QHMB 3MV7D 4ZFFA 5GXBB 3I6KA 1FP5A 3O3UN 4YFLI 2VRAA 3JTSB 5I9QC 5L88H 2DM4A 5KOMC 2WBWB 3DUUB 1HXYB 4LAJH 5D2NB 1BFSA 5CZVL 3VGFA 2DI7A 1N26A 1ZSDB 4PGCA 4OZHB 3RNQA 4PRDA 2HLAB 5F1SA 2JE8A 4P23D 4Z8FL 4PB0L 1ZHNB 3PDGA 3QAZC 3DYPA 2HMID 4O2CA 4IDJL 5E7FA 2NNAA 5T1DH 1H15B 1EJOH 1YECL 4OLYL 1CI5A 3B83A 3D3VB 4HWBL 1VEOA 1QRNE 1JPST 3ARFA 3BEVA 4BSVA 4HUXB 3H3PH 5KVMC 1C1EH 1S9YB 4Y5VC 1X7QB 2DBLH 3C2AH 3K81A 3B43A 4RWYH 5TFSL 5CEZH 3BIAX 3GMRB 2XKUA 4Y1AA 1P4IH 2AP2A 3QWOA 3EYSL 1UWEH 1IGJB 3LY6A 4C54A 3FO0H 4XCCL 4NNXA 2HA1A 4TUJB 5ENWB 1R5WA 4HK0A 5F6HJ 5I74B 1GPOL 3QDGB 1N0XH 5EN2A 3PP3H 4JY5H 5TQ2L 1S7RA 1BQHG 1WLHA 3ARDA 4QGTA 4RGNB 3ARBC 5E4IA 1D5IL 4D0BB 3O3BA 1JTOA 1ONQA 1RUQL 3DMMB 4E5XB 3BDYL 3RTQA 1MVUA 2IAMA 5GJTH 1OLZA 4HV8A 5IROA 1KIPB 2I9TA 1FAIL 2CRYA 2Z93B 3RBGA 4KKLC 2XN9A 1G7MB 3ZT7A 1V3JA 4L3ED 1NMBL 4PJ5B 4XAKE 3AS3A 3MGTA 4FQQA 5E4EC 4CGTA 2ZWLT 3CUPA 4XZUB 1DE4B 1LO2H 3AM8C 3DROB 3RKPA 1BFVL 4BYHA 2D4FA 3WO4C 5DMKB 1CG9B 3W9EB 3WV0A 3EOAA 2X44D 4QT5A 1OQOA 2E9BA 3WHXB 5HYJA 2CKBL 4PJIB 3QRGL 4FA8A 5INCA 3CVHL 3CFJA 1AO7B 2G75A 1MAJA 1Q38A 3NABH 4K7PH 4FXLA 2R4SL 4QHUA 1X5GA 5J13B 3WKMH 1WF5A 2YSSB 4FFZH 3UZQA 3ZDYF 1G6RA 1R0AH 2AJ3B 1NGWA 1SM3H 1IAII 2NY5H 5EZJA 4TQEH 4P9HC 3TFKC 1MJ8H 3EOBA 3QXAA 3MBXL 5FO9A 2HRPL 1EBAA 5D7JB 5SWSB 4UAOB 5ADPH 1AR1C 4G6FB 5L6YL 1ETZA 1R3HB 4OZFH 4QRTB 4I8DA 3P4OA 3U30B 1RD6A 1KJ2H 1KXVC 4MDJA 5D7IB 3REVA 1TQCC 3K0WA 1R24A 1W2KT 3PGFL 4NHUB 2LE9A 2YPKA 5E99H 1QUNA 2OSLA 2QADC 3V4VH 4GW5A 3FMGL 4KHXH 5HBBA 3BP4A 4O2FA 3T8XA 3I75B 1IAKA 2QTEA 1QRNA 1HEZA 1OD9A 1N6QH 1SEQH 1UM5H 3UAJD 4YQXH 3T3MF 1LE9A 3PWNA 1IAOA 2EIDA 4PJ8A 3RVXD 1J0IA 5SV3A 1P1ZB 4YDVB 1ES0B 1DBAH 5IQ7H 2BY3A 4OD2A 5DUBA 4LIQL 4XPTL 1RHHB 4QLRA 2B1AH 2O26U 1YQVL 2BRRH 2AXGB 5DEGB 3GI9H 2CJUH 4XCNB 1NCUA 5C0CE 1KBGL 4ODXB 4UQ3A 3C87A 1YYMH 4WDIB 3UTZA 1HOCB 4FP8H 3X3FH 4K3DL 5B22A 5FYKH 3QDME 1FZMA 3P0VL 1T7VA 2UYLA 2A83A 4GAYB 3C6LB 4YZFE 4E41E 4UV7L 3TO4C 5EZLB 4I0PD 1PYWA 1S9VB 4U6TA 2VC2L 3RA7L 1DQML 3QPXH 1HILA 1U93A 4M1CC 5I75C 1E4XI 3LV3B 4YH6A 1AD9A 3ZL4L 1OPGH 3IU3B 4ISVB 3WJLA 1R3JB 4YGVA 1BVLA 2CK0H 5C0AB 5E8PA 4LCUB 1IM3B 5CCKL 3AREB 4F7PB 5FGBA 5E95B 3SGKC 3ULSA 1NCWL 1OLLA 3MJ9A 2DIBA 5T1MB 1D7FA 1DUZA 2IBBA 5IM7B 2E5EA 4YDLB 2D31B 1QEWB 4X6CB 1FVEB 4JO4H 4N9OB 1KCLA 5FO8B 3MRQA 1NGYA 3MLRH 5KJRL 1IAIL 3I02A 5DC4B 1WCBA 2AJUL 1I1FB 3L3OB 3O11B 3K4DA 5H94A 1WGOA 5TDOB 4DGVH 1XR9A 2AXHA 2XI9A 3MZGB 1YJDC 1A6AB 1P53A 4N5ED 2YPVH 4YAQA 1T1WA 1NGZA 3HZKA 5DHVA 4GT7A 4F9LA 3IJYB 4Y4HB 4HPOL 1TXKA 4F2MA 1U8QA 2AQ3A 1NFIA 1OAZH 2B4CC 3DO7A 3ALPA 5EC1B 3TIEB 7CGTA 3QULA 2AKRA 1R3LA 3QUXA 4H0GA 4UDUA 4POZC 1WTGT 2AJXL 3EAKA 4QF1A 3R0MA 4QHLB 3FT3A 5EU5B 2GY7B 1A6UH 2UWEF 4YDJA 2VMFA 1EMTH 4KVCH 4JFFD 2NY6D 3GBNH 2VABB 3A6BL 4GQ9L 4NO2A 1DVFB 4ONHB 3GMQA 4YWGH 3GSRB 3FOLB 1BLNB 3N9GL 4N0UA 4GOSA 3DOSA 3T0EB 3IRPX 2Z0BA 1JWSB 3UTOA 3I6GB 3F7VA 4H8WH 2GCYA 1T1ZB 4OZIE 4UILL 5JZ7D 1H5BC 3WUZA 4GBXD 3JWDL 2QQKH 1BGXL 3VXOA 3IDUA 1SBSL 4Z77B 2MSPA 1T1XB 1UM6H 1IM9D 4C58B 5C0CA 1PEWA 2XQYK 3WFCH 4LARH 3WJJC 3MLUH 1YN6A 1E4XL 2VXQL 2P8PB 5ALCH 4EI5D 4F33A 3QDMA 3SO3C 5KSBE 1RK0A 1OT1A 3LEXA 1NGPH 1QFWM 4JJ5A 2ZCLL 1R3KB 4E41A 1BBJB 4XNZB 5A3IC 1KPVA 5DGRA 4U1GB 5BOPA 2EIZB 4OZGB 4YHZH 5CMAB 5BRZD 4JLRA 5D70H 1G6RL 2W0FB 3C9NB 3KYOB 2V2WB 1QPPA 2PO6C 6FABH 3GK8H 3O8XB 4JZJA 5GGVH 3IS0X 1FC1A 1SY6A 4B50A 4NJAH 4DN3L 5CSZA 3SDCA 1YEGH 3BD5A 5JXED 4U1SB 1M05A 3TBYB 1P7QB 2B7DT 1P4LB 2JTDA 4ZG1A 2B2XL 2V6HA 3MGOB 2JELH 4ZYKB 5SWZB 3C6SB 4RAUB 5LQBH 2EKSB 4AYFA 4NZTL 1OP3H 2R56H 3NPSB 3DRQA 4XH2A 5KG9B 4TSBH 4Q9CA 4JRXB 4GKNA 3RWCA 1CFNB 2XPGA 1ADQH 4MQ7B 4X9FA 4WNQA 1DBMH 4OI9A 2GTZB 2I27N 1F97A 5SX5K 12E8H 3OJVC 4L8BA 5D7LE 1KJMA 4MNQD 3EOTL 1DL7L 4XNXL 3MRNB 5MERA 4F7MA 4QRSB 1NGXA 3MBEC 1RU9H 1C5DA 2Y7QB 4U31A 4NNYB 1XIWD 5I30H 4A2LA 5CEXB 2AJZA 4NM4L 3OXSB 4YK4B 3QZWA 1MI5B 2VUYA 3DIFA 2V17L 1HWGB 1HXMB 2YXMA 2HJLB 5DSCB 1JTTA 4JPKH 3L3IB 2BHUA 4K7PX 3VFSB 4OFPA 5BXFB 3QRGH 1I7TA 3LEVH 2HT4C 2IC2A 3GMPA 3MLVL 4WEUD 1G9ML 2EE3A 4UNUA 3TV3L 2L7UA 1NSNL 4MB3A 4K7FB 2XKSA 1OTSC 3VMOA 3PNWB 5GS1A 4NJ9L 4XMLH 1LO3L 2OTWB 4GG6E 5JMOC 1IGIH 3SPVA 2NZ9C 2OZ4A 4LCCA 1U2HA 4DOHE 4FZEL 5I1CL 4O5LH 4X7SH 4YHKH 2ZOKB 3O3AA 3QJHB 4WRLA 32C2B 2EDXA 5FKPB 5AWNL 3MV8E 2C1OA 1FAKT 3L7EA 3B6SB 1ODAA 3WO3B 1F3JA 1NUFA 3IDYC 3O41B 1GOGA 4FQPA 4OLEA 1VKXA 4Q2ZB 4IRJC 3CFCH 3MJ9L 4Y5YB 4K94H 4M9OA 4QCIB 4LCWD 3RDTC 1MEXL 1TDQA 4WY7H 2DWEB 1D9KA 1KJ3L 1I8KA 1OTTC 2R15A 2BSRA 2NW2B 5GGTA 5E2JA 3WEXB 4M8QA 4QRPB 1NJ9B 3VFNA 4XCYB 1HKLH 5KSBA 3VFGH 3GIVB 3STLB 2XQBH 5CD3B 1RURL 1NCAL 4AENB 4I3RH 4L4TB 1XF1A 4LSVH 4PJFF 3WN5C 3KLSA 3P9LA 4N8VG 3B8YA 3D9AL 5LWYL 3MLZH 5D7SH 1UWXK 1A6WH 1JGEB 1HZHH 2DQUL 3HPLB 1OCWL 3P9WB 1MFCL 5I0DA 1YEEH 3BZEB 3DO3A 2APXA 5DRXA 2W07A 3TIDA 3O9WC 2CK2A 3NPZB 2ZNWA 4ZFGH 5C07B 1U3HB 1XGTA 3CDCA 4OUUB 4Y0GA 3QQ4B 1SJVA 3QWRA 4QHKJ 3TA3A 2FX9H 4JJHA 2R39A 4GFTB 3VMNA 5I2IA 3U0PA 4P3DA 5CJQL 3VG9C 3HA0A 3S88L 4XPAH 5IB2A 5DUML 4OF5A 3DX8B 1UG9A 3K2UL 5D7LA 1L0YA 1XGYL 4KJPC 4W4OC 3D48R 3BPNC 2DYPD 3CC5A 3RRQA 3KPRE 4KPHL 1NFKA 1IZKA 1BD2D 1FL3B 2UY7A 2J4WL 4BH7A 4GXUN 5LAXB 3FONB 3MRJB 3IKCB 3M17A 4UTBH 1LEGA 2FIKB 2OM5A 3GM0A 2VZUA 2WQ8A 3RI5K 3J8F7 3CDGA 3SDAA 4PLOB 2BNRB 2XNAB 3OAUL 4LVOC 4UIKL 3WJJA 4RA0C 5IHLB 1CXEA 1CLOL 3W5NA 5DT1L 3VW3L 3QBTB 5D2NE 5DURD 2F58H 3ZYZA 2Q76B 1KN2H 3QH3B 5LXGH 2ESVD 4O51B 2Z8VC 4OZHE 1J0ZA 2JJTA 3PIQB 2A0LD 4DVBA 4YHNB 4GG6A 1BJMA 3H42L 3OKNB 4NWUL 4FQXD 4IM8A 1AI1L 4LSTH 5JNYB 4F9PC 3OPZH 3BSZH 3MYJA 4YZFF 4WFFE 1SEBB 3CSYB 2NXZD 2FHFA 1JWMB 3VD3A 3FRUB 5F9WC 2MHAA 4GKSA 2PTTA 4JN2B 5EOCJ 3D3VE 1SY6L 3UCRA 3MV8A 2X4OB 4JFDD 3K2MC 4ZUSA 3NCYS 5H35A 4LOUD 4G9DB 4L9DA 4OZFG 1QD0A 5K9OA 3GUTA 1DP0A 5FGSA 2DM7A 1UVQB 4OSUH 4LSPL 5I9QB 2DAVA 1VCAA 2IH3B 3VRLE 4NO3A 1TZHB 3NFSL 4ORGA 3KR3H 3KS0H 2FO4A 1A7RL 1MLCA 1MHHB 2ZOLB 4HUWA 4LSSL 1I4FB 4RFNB 1U0QA 4NQDA 2HTKD 5L7XH 2DJUA 3MCLH 3QDGE 3OKMB 1QSEB 2YR3A 3QI9D 4DKDC 5D6CA 4LLVB 2F54D 4RGNE 3RGVA 1X3DA 2Y6SC 3VXSD 2IADB 3PQYD 2YN5A 2E7MA 3BJLA 1QSFD 1AE6H 1ZA3A 1T4KA 1L7TL 4UT6L 4H25A 4PJBB 1YEFH 2DN7A 3G08A 4EJ1C 3T0BA 3KAAA 2GUOA 3SE9H 1QFHA 2HWZL 2X4QB 3MJ7B 3EDJA 4OI8A 2AEPH 1KUMA 3T2QA 3THML 5HDOA 5JQ6L 3B2VH 3PWUB 4PGBA 2IFGA 3V6ZA 3MRDB 2A1WL 2OZ4L 5DEFA 3L5IA 2D0HA 3NA9L 4PJIE 4PJ9C 3RVWC 4J8RB 3KPRA 2C7UA 3IDIA 3KNBA 1KEML 5C92A 4OLXL 2VZTA 3S4SA 1AO7E 1LNUB 3G5YB 2AJSL 3HAEH 1U8IA 1NGQH 1OAYH 4G9FB 5A16A 1IT9L 4QHMA 4DW2H 1JPFB 3EO0B 1FO0B 5EO0A 4PGZA 2BRQA 2CRZA 1ZANH 3QUYD 5CKGA 3JTSA 3U9PL 1F11B 3DUUA 1D5MA 1HXYA 3O6MH 1GC1C 5GGTL 5C0BD 4UI2A 1NH6A 2JB6A 2NY2C 5DRZB 2Q1EA 1ZK9A 4OZHA 3IKKA 4PJGB 1CR9L 2HLAA 3CMOL 5D7IE 2DLIA 4PJXB 4J3VA 3SCMD 1V7MH 4ONGH 2NYYD 1XF5B 5D1ZD 4HQQH 2MCG1 1YEJL 1U8HB 2OX5A 4NUGL 2EDLA 3UMTA 3FB5B 1H15A 3GJEB 1CD0A 5BW7C 1XR8A 3MV9B 3D3VA 5F9OH 5DQ9B 2IPTL 4HF5L 4JHAL 1BEYH 1JHTB 4HUXA 1S9YA 1ZLUK 1X7QA 3W11D 2F9BT 2XZCH 2YUVA 2HN7B 3WDIA 1L9NA 3P11H 2CSPA 5T1KD 3OX8B 1Y6NR 5CJ8A 5D5MB 5DJ2B 1F4WL 1IGJA 5AUMB 2IPKB 3KJ6L 4GRLA 5ISZB 3IJSB 2I5YL 4TNWK 4XPFL 1HINH 2BNUA 4TUJA 2OL3H 5ENWA 4JY4B 4X83A 2C3GA 4N90D 2O5YL 4XBEL 2PTUA 4R7NB 1TQCB 3QDGA 4L4VB 3TBWB 4PJ7E 2H3NB 4XWOC 4P2RD 3D1MC 5I8KH 5DD0L 1DQLL 3DMMA 4E5XA 2QADB 3UTPD 5M7QA 1KIPA 4Z7UF 3GIZH 2WW8A 2Z93A 1X5XA 2H32A 2EDNA 3B5HA 2GY5A 2BXZA 4K3JH 1G7MA 5EBMA 1MCCA 3FHAA 5E2WH 1FIGL 5FGCE 4K23H 3GO1H 3MX0A 4XZUA 4I3SH 1CICB 5TF1L 4EIZC 2WLZA 5ABDE 3H3BC 5DMKA 3S97C 4OFYA 3KXFE 3W9EA 2O5XH 5B39A 4QXWA 3VGEA 4MMXC 3FO1B 1WT5A 4R7DB 2GJZB 3WHXA 2AABH 4X6CE 3LH2H 4WW2C 4PJIA 1CL7I 4GG6F 3GZKA 1G9NL 4OJFL 1AO7A 1Q0XL 4XHJC 4XRCB 2VN4A 4BK4A 3DX9B 2XFXB 2P5EB 1H3WM 5DTFB 2VQTA 3MR9B 1DQJA 3DBXB 3GMNB 3QQ3B 5FM5O 5IHBA 4YXKL 2D7MA 2I07B 1ZE3C 2XV6B 5CSGA 1KNOB 1TLKA 3RL2B 1R3HA 4QRTA 2MOVA 2B8OT 2HYMA 4NM8H 3SGJA 4NHUA 4V1DB 4FQJL 2C1PA 4Y7MA 3GMLB 1GGTA 5E2UL 4ONOA 2BY1A 4KI5E 1K6QL 4JRYB 3B4NA 4H1LH 4RAHA 4RIRB 1MF2L 4NKDB 4U1IB 3NH7L 5L2JA 5D96B 4JCLA 3T0EE 3E6FB 3MRPA 3OQ3B 1I9JL 3CFDA 3QUMA 1P1ZA 4YDVA 5CD5D 2VDRL 4P49A 1DFBH 3EJYC 5ESQB 4IBLT 1RHHA 4P9HH 2AXGA 4MAYA 3IDGB 5DEGA 3V6OE 1K85A 3ME0A 4OF0A 5DEZA 5F7UA 4XCNA 5K9QI 1YEHL 3O4LB 2FB4H 5KOVC 3BZDA 4XX1E 1WEJH 2VSCA 4WDIA 1J5OL 3TVMA 3QIUB 4WHDA 3O2VH 4PJ7A 1ED3B 3MRRA 3TZVB 2HJFB 1HYSC 4GAYA 3C6LA 3C60D 5EZLA 2P8MB 2IBGA 3WE6B 1S9VA 3B8SA 3FQWA 4OZGE 5DWUH 1K4DB 3CH1A 2J8HA 5GGQH 4MMZC 3PJSA 4UT7H 5FM8A 3LV3A 2R8SH 3IU3A 4KKAD 2DL9A 2OK0H 4ISVA 5KVEH 4IOFC 5JPMB 1MAMH 1HSBB 4NQSA 5BQ7B 4LSUL 4O58H 4EN3C 1CL7L 4LCUA 2VAAB 2WWKO 1IM3A 3SEPA 4FFVC 2YD3A 4S1SH 5EZIL 1O5DT 3BYYA 3KXFA 2IBZX 1S7SB 1LDPH 5T1MA 5SWZE 2QQQA 2X4TB 2D31A 3QHTC 4QTIH 5J11C 1QBAA 4X6CA 5KN5B 1FVEA 2W9DH 3V6BR 3X11B 3HR6A 4L3CB 5GJSL 3DYMA 1UXWA 2J6EA 1EDQA 2D03L 3QB7C 2ITCB 1I1FA 2DTSA 2MKWA 3CZJA 3L3OA 2AJYH 4Y4FB 3BRFA 5J7CC 1DBJL 5DO2C 4NHCH 3W2DL 3O11A 5TDOA 4WWKB 1VFOA 2G9HB 3GSUB 2ED7A 2OR9H 5IVXF 5CHNB 4XB8A 2PO6B 1KTLB 3DV4B 1YPZB 4JFQB 4NP4H 1MI5E 3LQAL 2FR4A 3IJYA 4Y4HA 4NFBA 3MFFB 4FFWD 2K3TA 4HULB 4YJZL 2F5AL 2A77L 5EC1A 3ARFD 3TIEA 3VRLF 3C2SA 2FJHB 4J3UA 1EAJA 4MJ6B 4JPWL 3WUWB 2Z8SA 4WHTB 4QHLA 3B9KC 3LIZH 4PP2B 5C1MB 2Z35A 3LB6D 3VGGA 4MA7H 1VFAB 3MUGB 3ZT6A 4Y1AD 4W68A 3Q6FB 5DA4A 2ICEB 4NQVB 1DVFA 2FBJL 4ONHA 4QGYA 4W81A 4KY1H 4NO0B 1J0HA 1ZOXA 3FOLA 1BLNA 5AAWA 2W38A 3VFMB 3ZYJA 5J1AB 4WI8A 3GKWL 4B0MM 3I6GA 5GZOD 3BPLB 5I15H 2XTJC 1FPTL 3UXFA 4Z7VB 1T1ZA 1J88A 4JAMB 3BEWB 4X4XB 3BQUC 3ARDD 3QPQC 1YJDH 4FQIL 4CKVX 3RWFA 43C9A 1CS6A 4WFGD 1J1OL 4LMQE 2IAMD 4N9GB 3RTQD 3V6OA 1F6LL 1RZ7L 5DRWA 3QWQB 4Z77A 1T1XA 4W6WB 3KYKL 4X7CC 2XN9D 2PXYC 3D0LB 4EXPX 2B4CH 4PJHB 1E4WH 1I1RA 1XGRA 2OQJB 2X4UB 4QRPE 2P8PA 4XC3H 4C56B 3F7QA 4XVJH 4EI6B 5ICXB 1IC4H 1R3KA 1BBJA 3L3GA 4NFCA 4YO0B 1WZ1L 5GRVK 3A6OA 4OZGA 5K9JL 5CMAA 1JYNA 4NZRH 1S7VA 1IKNC 1NBZB 1LK2B 2W0FA 4ZD3L 3C9NA 3KYOA 2V2WA 3UC0L 4LPTA 3GI8L 2X1PA 2C4FT 3O8XA 3LRGA 3MRBA 4KHTL 5CSBA 5HYJD 4YHMH 4LSRH 2VWEE 4NZJA 2F19L 2R2BB 3U46B 4PJAB 3TBYA 1P7QA 2EH8H 1P4LA 1AH1A 1ACYL 3KPNB 3MGOA 5SWZA 4RAUA 3OBAA 2EKSA 1U95B 1EFQA 5JIHA 5B4MD 4OIIL 3C8DA 1UACH 4OGAD 2Q6WB 3QEQE 5GS3A 5HI4C 1KG0B 3UO1H 2RIKA 5D1XA 1CFNA 2VDOH 4MQ7A 4PTUB 5MP6L 3B2UD 2GTZA 1ZHBA 4FABL 2Q7YB 4AEHL 1OF2B 2NY0D 4KGLA 1RY7B 1ZEAH 3MRNA 4QRSA 5FUZH 1A1NB 2V2TB 1PD6A 4K8RC 2Y7QA 4S1QH 1J8HE 3X17A 2HH0H 3OSKA 5CEXA 1HCFX 2FEDC 1WITA 3ZE2E 3OXSA 5DJ0A 2G5RA 1GGCH 5FV2A 4R9HA 2HJLA 5DSCA 4X80H 2JCCB 4PGJA 2KPNA 4KMQA 2BNRE 3L3IA 2WBJB 3HB3C 5BXFA 1A0QL 1QRND 2YUXA 1X5FA 4MSWB 2EDOA 3GB7B 3QUZC 5FF6B 1CDYA 1MCPH 2R2HB 3T3PE 5I1IL 2X6MA 1NLBH 5I1DB 5DS8B 4PJ8D 3PNWA 5ITFB 2EE2A 3UPRA 4PJ7F 3BP5B 1IKFL 2X1OA 3HAEG 5C3LD 1N2RB 1I8LC 1BREA 1A7QH 1U36A 2ZOKA 3HR5B 3QJHA 3SBWC 3QIWC 1JP5A 3BPNB 3I84A 4L8CB 1VACA 1YMMB 3CAFA 4P57B 5FKPA 5F6HI 4I4WB 4XBPB 2GQHA 2H2PC 1IJ9A 2EDKA 3UYRH 5CBAA 3O41A 4RGMB 3NTCL 4Q2ZA 4Y5YA 5IESL 1JPTL 5HVGB 2COQA 4HFWA 4CMMA 1VENA 4NZUH 4QCIA 2DWEA 3DARA 3UBXA 4U6VH 3WFEL 4BQ6A 2NW2A 4ZOAA 3WEXA 4QRPA 4XCYA 2J6EL 4XAKD 2DQIH 4LPUA 3GIVA 5EOQL 1FYHB 1WCQA 3TLRA 1P7KB 5K33A 1BQUA 1RZKC 2NY7H 3HC3L 1DLFH 3NAAH 2DLFL 1QSEE 5JW3L 5TQ0L 3N50A 4RMSA 3RIFK 4HIIA 2YA1A 4PGEB 3L6FB 4N0YL 4DWHA 4Y5XC 3IFPA 1JGEA 3PWVA 4F57H 5KVGL 5EOTB 3VMPA 3FQUB 3BZEA 3T2NH 5I73C 3L5WB 2FSEA 4M48H 4MLSA 4D94A 1JZ6A 2JF1A 4OF3A 4PS4H 4TSCH 3RX7A 4JZOB 1U3HA 1WV7T 3BESR 1CLCA 3FOMA 2ADIA 3QQ4A 5C6TL 5K59E 3CVIL 1ZGLP 3ZDZF 1LP9F 5E8DH 4KMTH 3V6FB 2OR7A 3IDNB 3QEQA 4GAJH 1PJ9A 2ZJSL 3J7HA 5DJYB 5L9DH 3QISA 5IFHL 1T03H 5IMMA 2V5RA 3F58L 2NY4D 3MA9H 1WVZA 2EC9U 3QUXD 3B9VA 1J8HA 3IU4L 1GGIH 3FONA 5DFTA 3MRJA 4G9FE 3IKCA 1A4JB 4DGYL 2DL2A 4S2SB 5DK0B 2FIKA 4RISL 1Z3GL 5LGKA 4LLWB 4HXAH 2XNAA 4EUPH 3FB6A 1SMAA 5C71A 2DDQL 5C0IB 5L0QC 4ZO7A 4KVNL 3QH3A 4WW2F 4O51A 1RV6X 2HKFL 3D5OF 4KGJA 1OSPL 4Q9RL 2PTVA 4PJGE 3PIQA 4PJXE 4YHNA 4BZ2L 1FNGB 1I3RB 3HE7B 3OKNA 4F7CB 5I17B 4IIQC 5DRNB 3UBXI 4O02H 4DN4L 5JNYA 1MFAH 1GZPB 1ACZA 2BXYA 2QKIA 4R4FH 3V79C 1SEBA 5E5RB 3CSYA 4APQB 4K71B 1JWMA 5C0CD 4M6OL 2ED8A 3HZYB 3FRUA 3PHQB 2I9LA 4JN2A 3MRMB 3L3DA 3ULVC 5JHDE 1BBDL 1AC6A 1BJ1H 2H1PH 3QDMD 1E4KC 1TTUA 5MENB 1WSST 3I9GL 1K8DB 3TEUA 4E41D 4G9DA 3DVNB 4YXLL 2VQUA 4JO1H 3ZTJH 1B3JA 1BWWA 1UVQA 2HKHH 3A67L 2R0WL 3EYFB 3OG6B 4M43H 4G42B 5D5ME 5TE4L 3U7WH 2H32H 4JFHE 4GUPA 5D72L 2YEZB 5ISZE 2ZOLA 3S96B 1Z5LB 3A6CH 1I4FA 3HRPA 1NUDA 3SDCD 3VGDA 4MXVE 3ARSA 4H1LG 5BZWB 4L4VE 1KLUB 1CXKA 1QSEA 1X5ZA 2E7BA 1EUUA 5IWLA 4LLVA 3LSOB 4XNUH 3V4UL 2IADA 2HFGH 5BO1H 2VDNL 2WUBL 5T3ZE 4ZTOH 1JNHB 5DD5L 4M7LL 5EIIA 4ELMB 4JHWH 1EEUA 1FFOB 1X5YA 3RWJB 2YC1B 5GGRY 2BSSB 2X4QA 3MJ7A 1U8PB 5H37H 2MQCA 4FG6C 1GXEA 4H5SB 3FN9A 3VH8B 1TZIB 5IK3A 3RVUC 3SE4A 2A9NL 4JDTH 1XF2B 1C7SA 3PWUA 1MCOL 4R90L 5HVHB 5GGSB 5T5FL 1NEUA 2Y36L 4L4JA 4MA3B 3ROOB 1E6OL 2BJML 4X5LA 1EHLL 1AXSA 3PWJB 4X7DC 5ESAB 5J56B 1QKZH 3G5ZA 1LNUA 4KUCF 1HHKB 2UZYB 2BVOA 3QNYA 4G9FA 1F13A 5IEHA 4UU9B 4G8GB 4X0KB 4OGXL 2OP4L 2P48B 2P5EE 4OV6F 1JPFA 3ULUC 3EO0A 2CGRH 1FO0A 4OIIH 1NCTA 1A02N 5BVPL 1HHJA 3U2SB 1SHMA 1F11A 3QCVL 3KVQA 5LGHH 1NMCC 2WK2A 3DGCR 5DRZA 5EPMB 4YEEA 4XP9L 2EH7H 4GW1B 4PJGA 1A4KB 5F7FA 2PW1B 4HPYL 1QR1B 1HSAB 3GHEL 2AGJH 5I1GL 3QUMH 4TSAL 1XF5A 5A43C 2NXYC 4V1DE 1BWMA 1KB5H 1U8HA 4EKXA 3F8UB 4O00A 3VI3F 1BM3L 3WXWL 3GJEA 1HQ4B 4OM1L 1D9KD 3VWJC 4JRYE 4AG4H 4DAGL 5DQ9A 1I85A 1BPVA 5JHDA 4YHLH 1JHTA 2A9MH 4DFHA 2ZSVB 4BFIB 4ORZC 4HWUA 1A14H 2HN7A 4J23A 4ZXBB 2OJEB 4U6HA 1ZWIB 4GMSL 2IJ0C 5EWIL 4DZBB 4G7YL 5D5MA 1IGFH 1VPOL 2A6JA 5DJ2A 3WKNA 5LVEA 4MVBD 2BVPB 5AUMA 3LD8C 1GC1H 5JMRA 5ISZA 1F5WA 1OSZA 5IHUH 1CXHA 5FGRA 3O4LE 2EDDA 4R7NA 1A8JH 3TBWA 2H3NA 4OLWL 4P9MH 4GRMA 1I8MB 2AXFB 3QWRD 5KSUA 1AP2B 5DJDA 5JW4M 3TA3D 1C08B 3CH8A 4G3YH 4IRSC 1L4IA 4PY8I 3ZE2F 3GGWB 5D7LD 4KK6D 3WBDA 3HZMB 2DWDB 2JJUA 3SKJL 5B3JE 3BD3A 3EFFA 1CICA 1DBBH 2CMRH 2EDQA 2ZCKH 4F15B 2B0SL 1TITA 3IAGC 3WS6A 3AB0C 5CGYD 2VE6B 4L9LC 4XP1H 3T3PF 4UUJB 5EUOF 3FO1A 1AGFB 3CXDH 1CN4A 2GJZA 5GGSY 4J6RH 3SDAD 1FYTB 5C08B 1ZHKB 2MFNA 1JWUB 3V0AC 4Y2DC 4F7TA 4MJIE 3U36A 1F4XL 4XRCA 1A9EB 4FTVB 3FZUC 3RI5F 1SMOA 1IEBA 4HS3B 2XFXA 3ISWA 1KCVL 2P5EA 3EZ8A 2Z31C 3MR9A 3DBXA 3GMNA 3QQ3A 4QY8B 3P40A 2VDQL 2VKWA 3HI6L 5F72S 1C12B 2VZVA 1YEDB 1UEMA 1YPZE 2I07A 3VD5A 1KNOA 1JRHI 2V7HB 4LLQB 4I13B 5DJ8B 1AQKL 1EJ6A 4EN3B 1SJXA 4JGMA 3MV8D 2ZP0T 2DQTL 5KANG 1NBVH 5I76A 5IW3A 1WFOA 4AMKH 4P2OB 4JGJA 3AU1A 5F7NC 4AZ8A 3U4BH 4V1DA 5BMFL 1WIPA 3KPTA 3GMLA 5ANMB 1UB5B 4P5TB 5IJKC 5D1QC 4HBQA 4HK3N 3VXUB 2OI9C 4JRYA 2Z4QB 1L7IL 1ZGLA 1H8NA 4NKDA 1T5XB 3WS3A 4KROD 2MPAH 5E6IC 4GRWB 4MCZB 5E1AB 4OCSH 4M7JH 4NQDD 1OD7A 1PY9A 5MHSE 1UCTA 3PP3K 5C0JB 2V5MA 3IFNL 1EBPA 1RUAH 5L8KB 3RGVD 5ESQA 7FABH 5CILH 1AGEB 4KJYB 3C8KB 3RVTD 4CW1B 1RSFA 4DK6A 2XZZA 4XP4H 1T0NB 3O4LA 3W0WB 2DQCH 1F6AA 1BHGA 1E6JH 1U91B 1YC7A 3QIUA 4M7KL 1DQDH 4M03A 2ADFL 4C56E 2WAHA 3GJFK 1MPAL 3TZVA 1SJEB 1IZJA 1AQDB 5E8EB 4JR9H 5GISH 2P8MA 4NQEB 4H88H 3WE6A 4EQ3A 4P23C 4Z76B 1K4DA 5AZEL 4ESKA 4L29A 1EXUA 1RFDH 1A2YA 1FO0L 2N4IA 2EXYD 2HMIC 3PGDB 4HXBH 4KJQD 1IQWH 1MCJA 5JPMA 4TULL 5BQ7A 3KPRD 2UY6A 5F3BB 4PJAE 2X2YA 5EZOL 4U1NB 1S7SA 1S5IL 5E8OA 3X3GH 2X4TA 1NDMB 4YDKH 3RY5A 4GAGH 2EDEA 5KN5A 3X11A 5GSRB 4L3CA 2QQLL 1T2QL 2PXYB 2ICCA 5B8CA 1KC5L 3OGCB 2DB8A 3IFLL 4MJIA 2ITCA 1KIQB 1CGXA 5SX5H 1U58A 5J06A 4JM4H 3HMWL 3BW9B 4Y4FA 3BP6A 1JRHL 3O4OC 3QXTA 5DD1L 5FK9A 3ZTNL 2X4NB 1MQKH 5EULV 3SOBL 1OWRM 3B9EA 2G9HA 3U1SL 5EU7E 2O93L 3GSUA 1HHHB 3EHBD 4OLZL 2E8YA 3D6GA 3DV4A 3WFDH 2J8UB 4JFQA 4ZS6D 1LILA 2G5BB 4WFFD 2R1WB 4MHHG 4OV5B 5AYUL 2JCCE 2A6KB 3MFFA 2C3HA 4M93B 3EW3B 2ARJQ 3D3VD 4QRRB 5D71H 1FSKC 5IGXH 3NZHH 2FJHA 4TNVF 4MJ6A 3WUWA 3VXMB 1KACB 3MLSL 4WHTA 4BELD 4L5FL 4PP2A 4F58H 3OB0K 1VFAA 4XWGL 3MUGA 4ODUB 2XYCA 3NIFE 3Q6FA 2ICEA 4WENB 5T3ZL 5CINL 4CN1A 1Q9KB 4NO0A 5HHOB 5JW5B 1FJ1A 2YD7A 4GRLD 3NGBC 2CKNA 3QYCA 5J1AA 4NWTL 5TF0A 3WNNA 3B5TA 1FFPB 1XGPB 1YMME 2QQNH 3RUGA 4EUPG 2HFFA 2VDLL 3QDGD 2DQGL 2EYTB 3BEWA 4X4XA 4BFGA 4RGND 2ZUQC 1U92B 2ICES 3DMMD 5GRUL 4PTTB 3FCTA 1HQRB 4N9GA 5JOFB 4Q0XL 3WL9B 5E9DE 1K3ZA 4YHOH 5J6HB 5BCAA 3RAJH 3D0LA 1ZTXL 4TPRL 1MJ7L 4ZS7L 2OQJA 4C56A 3QUZB 1AXTL 1MSPA 3U4EA 5IQ9B 4EI6A 4IRZH 5ICXA 4KTEL 2F8XC 1LO4H 4YO0A 3WIIH 4LBEB 4NN7C 2AK1L 4U7MA 3ULVF 2D7TL 4I48B 3HI1B 1NBZA 4OFYD 1LK2A 2HLFD 4LVNB 2K1MA 4DKFL 1I3GL 1UWXH 4OB5H 5HGAA 3QIWB 2ZUWA 4CVXB 5HSFA 4Z0XA 3ZTJG 3PWPB 4U6YB 1SVZA 2R2BA 4M7LT 5IBUB 4NNPL 1AO7D 4PJAA 1UEYA 4PG2C 5IFJA 3IDMB 4R0LC 1MFEH 3DWTA 3HS0B 3BKJH 3IXTB 3LRSB 1INEH 1CFTB 3E8UL 3KPNA 2MQ0A 3UAJC 4GH7B 1QVOB 1CDIA 4JPVL 5IMKB 5CUSL 4M9PA 5F6IB 4X6DB 3RVXC 5F7HA 1F90L 3ZT5A 4OCWL 1QBMH 1P7HL 2Q6WA 3R1GL 1KG0A 4LPCA 3RY6C 4HWNA 1X5KA 2EEBA 3CD4A 3UTQB 3BZFB 2H26B 3B3IB 1FNEB 5B39G 2Q7YA 3GKZA 1AY1H 5C9JB 3VD9A 3DX7B 4G6FD 3UP1A 3UYPA 1IC5H 1X5HA 1A1NA 1J05B 3P30H 3BKMH 3MLWL 4JB9H 4KRMB 5L2KE 4OCNC 3HI5L 5JDSB 1IGCL 1UT9A 2ZG3A 5H37G 2DQJL 3MV7A 2P24B 4I0PC 3S36H 2JCCA 5J3HD 2WBJA 1QBBA 5I73B 5ACLA 4EEEA 4UINL 1BJ8A 2FZ3A 1P4BH 2ZPKL 4P2QB 3RL1B 3N1PC 1FGVH 3EYQD 2ADGB 2R2HA 4RGOH 1XH3B 5DUPH 4XPHH 5B38B 5I1DA 5DS8A 5HGDB 4M5ZH 4OGYL 1B2WL 2FJFB 3OR7A 1OGAB 2XWBB 1I9IH 3BP5A 4HKZB 4Y89A 4MAYD 5C9KA 5F7DB 1MFNA 3HR5A 4L8CA 4YHYC 5BVJB 1TJIL 1YMMA 2MJWA 2DQHH 3H8NA 4I4WA 4XBPA 3TVMD 1UGNA 1QFWL 3LS5H 4K8RH 4FZ8H 4QRUB 2WMPA 3QCTL 5MENE 5JOPE 3EYOB 1EX0A 3C6LD 4FRWA 25C8L 1B0WA 5E9DA 3G5VB 5C7XL 3LQZB 2HRLA 2GJ6B 3D18B 4GS7C 3C5ZB 1LE5A 2GITB 3OZ9L 4N5EC 5I6XB 1EPFA 1F4YH 2FX7H 4S1RH 3RKDD 4X5XB 4KH2A 1P7KA 5L8LB 1XFPA 3FQNB 2EICA 5KVDL 3ARED 2AEQH 3HFMH 2XZQL 3KXFD 4WW1B 4U6XA 4G8FB 2AI0H 2RCSL 4PGEA 1PFCA 3T1WA 3UX9B 4MA8H 4JHZA 2IANB 5GRYA 3UTSB 5HHXH 4N8CL 1JNLH 5HI3D 2NY6C 1NAMH 3FQUA 4OQTA 5IFAH 4HIJA 1HH6B 2ZUVA 4ELME 3P73A 5IEKB 1TFHA 3MLTB 4YBLB 3NACL 3QQ9D 1QOKA 4V2BA 1OAKL 1N7ML 4P3CH 5EBLA 5BJTB 4U1HA 3JTTB 1TJHL 5I8EB 3NCJL 2E9IA 2KQNA 4UV4H 5JZ7C 3VG0L 3IDNA 4GBXC 1N5YH 3L5XL 1FFRA 5DJYA 1CU4H 2L7JA 2DLGA 2KUTA 1I1AB 2QBWA 1LGVA 4XNMA 4Y4HD 4D0CB 4MS8D 2RJMA 5DD3H 1GGYA 4HH8A 3GHBH 1G0XA 2GAZA 1RZKH 4X4YB 2ZKHL 4EI5C 5L2KA 3MCKA 1YUHB 1JMXA 5F8QC 1A4JA 4G8GE 5E03A 4S2SA 5DK0A 1UCBH 5F97E 4CUCA 4NZDA 3RUGF 1SVCP 4KI5D 4GSDH 4I3GA 3Q3GA 1DVFD 2IF7A 5KW9H 3BKYH 2P45B 3MRHA 5MEQB 4Q58C 5C0IA 4OCRH 4MB4A 3ECBB 1LK3H 3T0ED 1WQVT 3TYGL 3JSSA 4TTGA 5GIRB 1AFVH 5FYLH 3HC0A 5JXEC 5I1JL 1FNGA 3DSFL 3HE7A 4F7CA 1VFBB 3JWOC 2Y23A 5I17A 1KCSL 3P3YA 5LBSH 3NFPB 1IFHH 3I85A 1GZPA 1WK0A 1ZA6B 4NPYB 3HZYA 5FECA 3PHQA 4R2GB 2OTUB 3MRMA 4ODHL 3MTRA 4P59L 2LABA 1TVDA 4AEIH 3MV01 5MENA 3QHZH 1K8DA 1ZLUH 2FGWL 3ILQD 1C5CL 2X10A 4K07A 2H8PB 4ZAKB 4ODTL 3MJGX 4HT1H 2PYFA 3RY6A 3NCMA 2C5DC 1XIWC 1A9BB 3GRWA 4G42A 4Y19E 4YX2L 1I9EA 4QTHB 1OAUL 4RMWA 3CK0H 4HW6A 3O8XD 5DYOA 1FNLA 4QWWD 3S96A 4LAQL 4OCMC 5ICYB 1Z5LA 3WSQH 4LQFL 1EEYA 3EDEA 4MAUH 1P7QD 4DEPB 3SDDB 1JL8A 1KLUA 2UVFA 4HBCH 2NXYB 5SWZD 2YA2A 5F88A 3RP1A 3TNMA 1JNHA 3MXVH 1ZT4B 3VWJB 4ELMA 5D1XD 1HI6B 3KLAB 3ULVH 4K2UL 1FFOA 5FEBA 2YC1A 5C0DB 2AQ2A 2BSSA 1A5FL 1ZMYA 4FQHA 1BZQK 2LTQC 1U8PA 3A0OA 4H5SA 1XCTB 1NEZB 1KCRH 4OCYL 4X6FB 1TZIA 1GAFH 1B4JH 2F8OA 5MEPA 3EYUH 2J7LA 1MI5D 1UJ3A 4NC2B 4Z7WE 3GSQB 3V95A 4JO2H 5GGSA 3BAEL 4MA3A 1FYTE 1UM4L 1YEKH 4ONFL 4JO3L 5C08E 3VFPA 3PWJA 5ESAA 1GHFH 3EUUA 5EIQA 1HHKA 4FTVE 2DQEL 5KVFH 4FQ2L 1M1SA 4UU9A 1K8IB 2J5LB 4G8GA 4K9EL 1FORH 1RZ8B 2DLHA 5EUKB 1T3FB 1T89A 4IRSB 3RZCA 3CLEH 3G6AB 2VN7A 4PRPB 2JJSC 3O6KH 3U2SA 5I66B 1G0YR 5DJZB 2Y25A 1ZLSH 5EPMA 1CZ8L 1Y0LB 3FN0H 4XTRD 1UA6H 4GW1A 1A4KA 1QR1A 2PW1A 5EOCH 1EO8L 2CH8A 4OLVH 3WNPA 1Z0MA 4L9LB 4JG1H 2GFBA 3W82A 2PETA 3FO2B 5HPMB 5ANME 4JFZH 2XA8L 1HQ4A 1VERA 4OM0L 3VXUE 3VFUB 4OQTL 3BH9A 4QRPD 3UTTE 3EFDL 2PCPA 4H26A 5HXMA 1CGYA 1MCNA 2ZSVA 4JKPH 4GRWE 4BFIA 2NX5B 4MX7B 1S7QB 3CFEB 4IMKA 2XRAL 3V52L 2P46B 2Z31B 2Z8WC 3ULUH 4ZXBA 3S34L 2OJEA 3RWHB 4NOBA 1ZWIA 1NMAL 4LKXB 3S35H 4PJEF 4Y19A 3DSNA 5ERWA 1NL0H 3RGHA 2BVPA 3BYTA 2ICWB 2DJ4A 4YE4H 3S3PA 4PGDB 1IM9A 2R0KL 2RBLA 1EZVY 5F7KC 3W0WE 3WLBB 4BKLB 4ZFZB 1FE8H 2VXUH 5TPWH 3UBXG 1X4YA 1CGWA 4S1DD 5D8JL 1TPXB 1I8MA 1U3HD 3ARXA 4ERSH 1CFQA 2AXFA 2KBGA 4NQEE 2R0ZL 1G6VK 3GNMH 5EBGA 2A0LC 3N1FC 1JNNH 2WM0A 2F74B 3QEQD 2OI9B 2P42B 4RZCB 4FQXC 4I77H 1T66D 3GGWA 2NY3B 5E6IB 1TZGH 1TIUA 2DWDA 2NXZC 3AVEA 1DJSA 4W4NA 1F8TL 3S3JA 5JXEA 1H3XA 3O6FB 4MCYB 2BDNH 4J1UA 1J8HD 4AQOA 2WNGA 2O61B 1W72H 4LOUC 2VE6A 1QLEH 4Z7WA 1MH5B 3MA7B 4UUJA 4CU8A 1T83A 3FT2A 1WZKA 4NN5C 5ITBH 4NQCB 1AGFA 1UKQA 2BNRD 1JF1B 5C08A 4CNIB 1ZHKA 4KQ4L 3WYRA 4LHUG 4OTXH 4I18B 2NR6D 4AT6B 1FLTX 4HG4J 3U7AA 3BWAB 4QYOB 1A9EA 3Q1SH 4FTVA 3NFNA 1LDSA 4HS3A 5C2BL 5TE6L 2HTKC 4P23B 3ZKXB 4HC1A 3ARZA 3TT1H 5EORH 3QI9C 1D5BB 35C8H 4QRQB 4QY8A 3LN9A 4MNHB 2EEAA 2J8UE 3GRWL 2DOCA 3H6JA 2V7HA 2Y06L 4LLQA 1BQSA 5IHZB 1MWAB 4M6ML 3CCHB 4QRRE 3IGAA 5DLML 1AJ7L 1BQHB 3LCYA 2IFFH 3PABB 3JXAA 3O45A 4ZPTA 4NKIL 5DQDH 1JHLH 1TJGL 3VXME 5T3XE 4P2OA 1FH5L 4M6AA 1OARH 2VLJE 4U0RB 5ANMA 4O9HH 3L3HB 4XVSH 1GGBL 4P5TA 2W0PA 4P2YA 1TNMA 3VXUA 2Z4QA 5HHOE 3UTTA 1Y6MR 2HG5B 1T5XA 1PZ5B 2D3VA 3JVGC 4MCZA 3WHE1 1DTUA 3UJTH 4AL8H 2BK8A 5ESVA 1MNUL 5C0JA 3FO9B 4LLDB 1QSED 3QIBB 4U2ZA 5ILTL 3LZFL 2J8OA 2OBGA 3GMMB 1YNLH 2M26A 3KPPB 1RJZB 4TOYL 3NMEA 3LAFA 1BIIA 4KJYA 1A7NL 3IETB 5T33L 3C8KA 4QNPE 4NBZB 4CW1A 4GLRI 3OKEB 1T0NA 3W0WA 2YMXL 3QUYC 4LCIH 4WV1C 3U82B 2VNCA 4NQXA 1PG7W 4P59H 4Q6IC 4JREC 1MIML 2DD8H 3D0VB 1AQDA 5I8CB 5JTWA 4FFYH 1TCRA 1HCVA 3DURB 4MGXA 4Z76A 3L3KB 3SCMC 5EH1A 1QHOA 1MFBL 2NYYC 2R4RL 3MLYL 3I2CL 4N68A 5D1ZC 1BZ9B 3MRLA 3SE3C 2XG4A 1CQKA 3NGBB 2O5ZL 4TRPL 3SGDH 1JI1A 4AEFA 3PWPE 2FD6H 3SDXB 2EDJA 1JZ4A 3SO5A 5F3BA 1N4XH 5C0ND 1SYSB 1T80A 3BFOA 3BRDA 3DI3B 3NIDE 1RK1A 1CFBA 3EO9H 3MOAH 1UKSA 4U1NA 1NC2B 1JGLL 4ZPVB 1TVHB 4G9FD 1CDBA 1XGQB 3W11C 3M1BB 5GGUB 3MACL 4X6DE 1NDMA 2W92A 5GSRA 1AGCB 4ODVH 3L95B 4M1DL 4WU7B 3WIFB 4HDIA 2WUCH 1KIQA 3PL6A 5AZ2H 1Q9WB 4LNRA 2PUQT 4NC1E 3BW9A 2A38A 5DDHA 1D3CA 3U0TB 4A6YB 5C70A 5E08L 4X4ZA 3MO1B 15C8L 3O0RL 4WU5B 5SX4H 1RVFH 2D7QA 5HY9B 5LKNA 2YS4A 4X99B 5ALBH 2J8UA 1RZIB 2GT9B 4Z9KB 4FQLL 1BOGA 2R1WA 1HH9B 4OV5A 2XY1A 2A6KA 5F9AC 4QRRA 1GSMA 1RQ5A 5FA4B 3U83A 4POYA 3STBA 1MWAH 1NCBL 3VDAA 5BV7B 5JHDD 2V9TA 4P2QE 3LHPH 3VXMA 1N5AB 3NCEB 3LDBC 4RAVA 2VLJA 4XCFH 4I5BB 4ODUA 3OKDB 1N59B 4Z95H 4WI7A 1OGAE 1Q9KA 1M71B 2ID5A 5HHOA 1P2CB 4E42B 5JW5A 4EOWL 4JFHD 4XPGH 3C08L 4HWZB 5ISZD 4JPIA 4TVPE 4YFDB 5D93C 1N6UA 2FX8H 4JFDA 1FFPA 1XGPA 3HNVH 1RJLB 1S7UA 4L4VD 2E7LC 3PGCA 2EYTA 1CE1H 3TM6A 1F02I 4ZUTB 1U92A 4PTTA 1HQRA 3O6LH 5JOFA 1OT2A 5GS2H 5T3ZD 4J3SA 1UYWL 2OR8A 1RUPL 2GJ6E 2X42A 5J6HA 1A6VH 3QHFL 3P4NB 4Z7WF 5I1AB 5J9PB 3VXQB 3WIHA 2Q8BH 1CICD 5J6GB 4TN9A 3WHE0 4LBEA 5I1EL 1FG2B 2MTPA 4LLYA 2VOTA 4I48A 3HI1A 4FQCL 4HC1L 5F7EL 5HDBE 3UTSE 5CZXD 2IANE 3QO1B 5I1HH 4JQVA 4HIHB 3PXHA 5IW6B 2OJZL 5DC9B 1KN4H 1FNSH 4N0FB 4NKOB 2B5IB 5GRWA 4HG4K 3IDMA 1RZFH 3HS0A 3IXTA 3LRSA 4D9LH 1CFTA 2C9AA 3QXDB 1CLYL 5IMKA 3KJ4B 4ZO6A 4YXHH 2P5ED 4X6DA 1BQLL 2DIAA 1OM3H 1T2XA 3SJVB 5CD5C 1KENL 5FYJE 4PIRF 2DQDL 1KYOK 3NIGE 1MCSA 3NA4A 2H26A 3B3IA 1FNEA 3P9MB 2QJDA 3QNZA 1QYGH 5C9JA 4JN1L 5JPNB 5HHQB 4XPBL 5FHAH 3QA3B 2B39A 1J86A 3L1OL 3BMWA 1J05A 1I8IB 5JO5B 5KSAA 1A3QA 2ERJB 1FRGH 4JCMA 4GRWF 3QEGH 4V1DD 2PR4H 3STZB 4YUEL 1JGDB 5HGGS 2P24A 3C60C 4JFFB 2NY6B 4WV1A 4WIQA 4GXVL 4N0CD 3REWA 1U3ZA 4PD4J 4JRYD 3BISA 3WD5L 3QCUH 3AY4C 3V2AR 4R26L 4OT1L 4KKAC 4P2QA 3W5MA 3RL1A 4DTGL 2X05A 2WLYA 1Q9LB 1XH3A 1KELH 3EJJX 4XC1L 2FJFA 1YA5A 2DM2A 1OGAA 2VDMH 2YK1L 5H2BB 2UZIH 4HKZA 3MGAA 5JORB 1UZ6E 1Q1JL 4XCEB 1KLFA 5F7DA 1JN6B 3GSNB 4LVEA 1UKTA 3UJIL 3O4LD 4Y8AA 5BVJA 1A1MA 1I1CA 3QIUD 3TJEL 3TBVA 1F3DJ 2J2ZA 1V3KA 2H9GA 3VE0B 1JIBA 1B6DA 3GSWA 3TZVD 3ZZ1A 3INUH 2BCKB 2R23B 4HHAB 4RA3A 1AHWC 5I19L 3K4ZA 3G5VA 3LQZA 3P0YL 4HWEH 2GJ6A 2QHRL 3C5ZA 3IXAB 4BZ1H 4DKEH 5JHLL 4M5YL 4BA8A 5E5UB 3RWIA 4X5XA 4EXKA 4NRZA 3DPBA 4FFWC 1V3LA 1G7JB 3HPJB 5IVZB 5CJOH 3FQNA 4OKDA 3DXAB 2IPUK 3ARFC 4KAQL 5LCVL 4CL7A 1RIUL 2MCPL 5JUEL 4KZDL 4XP5H 1T22B 3CPLB 5KZCB 2W65B 3LB6C 2IANA 2Q8AL 3UTSA 4RNRB 1MREH 1C5BL 1KCUL 1KEGH 5TE7H 1HH6A 3UPCA 2G2RB 1QBLL 3MLTA 4MJID 4M61B 5LG1A 3UEZA 3HMXH 1IAIM 3KPOB 1QLRB 4Y4FD 3BE1L 1BAFH 2M8XA 3VD7A 5HVFB 4G6MH 5T3XL 1OL0A 5BJTA 5GZND 5FUCC 5GZOC 1I9RL 4WWKD 3QFJB 3BGAA 5I8EA 2E8ZA 4DQOL 4JQIH 3LKQB 3B5GA 2BOBB 3RU8L 2QEJA 4O4YH 4PJDB 3ARDC 3O2DH 4ZTPH 3RTQC 2IAMC 1I1AA 4AH2B 5IROC 5ID1A 4D0CA 3LKSB 4LPYA 1PLGL 3BI9X 4G6AD 2E7LA 4PLKD 3V5DA 1Y6KR 5F7YC 4X4YA 2P8LA 3U9UB 1E28B 3ZSTA 1YUHA 2VLRB 1RAMA 4ZO8A 4LFHG 3ZE1F 3JWDC 1T1YB 3ARVA 3LKRB 3BUTA 4PRPE 5T1LB 4NO0D 5CBEB 1MCLA 1Z9SA 1YYLL 2EDTA 4JE4B 4Z6AT 1DANU 5EB9A 1QNZH 3WIHL 5GIRA 15C8H 5MHSD 4N8VB 3O0RH 3O2WH 4JG0H 4WUKH 3TYFB 5I0ZA 5FHBH 4EIGB 4NYLB 1PG7H 3NFPA 1QPXA 3RWDB 1A21A 1ZA6A 5JR1L 4NPYA 3RIAK 4G5ZH 5B4MC 3GSNH 1PSKL 4IS6B 4OGAC 2AJVH 4HFUH 1JPSH 4Z7QF 4NGHL 1JZ8A 2OTUA 2ZG2A 3BPOC 1MCQA 3B2UC 5DR5L 1VA9A 4C56D 4LVHB 4ZODA 3BH8A 1U3YA 2NY0C 2NX5E 2YUZA 2XOTA 3EDKA 2MQ3A 5IB3B 4KK8D 4IEFB 3U0WH 3V7AE 2ATKB 4KZEL 5F70A 1S3KH 3KHQA 1A9BA 5DA0B 4QTHA 3HCVB 1JGUL 5AG9A 1MHEB 4HH9B 1U2CA 3SDDA 1CK0L 1FDLL 3Q5TA 4YR6A 3JWOH 1I3UA 3LEYL 4Q97A 4LEXL 3QG7H 1XMWA 1Q0YL 5C3TA 4PJ8C 3W9DB 3CLFL 4HKJB 4P46B 1A1OB 1FVCB 3F6IA 1ZT4A 3OKYA 1VHPA 4FNLH 1HI6A 2JJVA 3KLAA 5B8CC 3FB7B 4Q9QH 5C0DA 1BOYA 1MCEA 2P1YA 5F89B 4GKZA 4WJ5B 3BT2H 5FXCH 4D8PA 1XCTA 4WI9A 1NEZA 2BFVH 4WFEE 5C8JB 1G9MC 4XMPL 4X6FA 4P4RB 1NKRA 3EJZD 1JJUA 1MFDL 2V9QA 3GSQA 1F6FB 4NQCE 3UJJL 1R5IA 2FH6A 2IH1B 1U3JA 2CUMA 2WBJD 1RZJC 4TVPL 5D2LA 3HC4H 1ZHLB 5DJCB 2QV2A 2F5BH 4OZFB 4K3EL 4GG8B 3WJLC 1Y18A 4N1EA 2VH5L 1XF4A 1KJ2B 1K8IA 3RFZC 1AHWA 4D0DA 5DMIH 1RZ8A 5EUKA 4PJCB 2DJSA 4J3WA 3W81A 3LN4B 4S10A 4YPGB 1D6VL 5FGBC 4E0RB 3G6AA 3WFBH 4PRPA 1MCDA 4ODSL 4B5EA 4UNTA 5I66A 1EGJH 4NN6C 5DJZA 3ZYIA 4KTDH 4HJGA 3U7YH 1FZJA 1XGUA 1YMMD 5IBTH 2NY1B 4HCRA 5CEYB 1MCWW 3C09C 4ZOCA 1F2QA 4NN5B 3DHJA 3FO2A 5E9DD 4HKBA 5HHNA 1CD8A 1CXIA 5DMYA 1OAQH 2X7LB 1ORSB 1IBGH 1WBXB 4F9LC 3BO8B 4GMTH 1QR4A 1MJUL 1RUMH 3BPCA 4LSDA 4MX7A 3JV5A 4OD3H 5F96H 3V4PH 3CDYA 3FAXA 2QSCH 2NY4C 2RGSA 1HE7A 1H3GA 4L8DB 1NCCL 4C83B 3QUXC 3X14A 4LKXA 3ZLQC 2Y07L 4OD1L 1QP1A 5FYJL 2ICWA 4G7VH 3HTLX 4KV5E 4PGDA 4UB0H 3QDJB 4Y16B 3TCLB 2E6JA 3WLBA 4BKLA 2Q20A 2XZAL 2DTML 3FFCB 4JFXB 1M7DB 3GJFH 3T0VA 5CGMA 1NPUA 5EFIB 3RNKB 5CWSB 3N85H 3PP4H 1MRFL 1N0LA 2VYRE 3HNTL 2ZUSA 5DZLA 3BZ4B 2CLRA 4JKWA 3LVEA 4X8JB 3FB8A 4HS6B 4JANB 4XAWL 2HFTA 4UOW1 5HYSG 4LASH 3Q6GH 4MLIA 2ZSWB 3O6FA 4DVRL 4MCYA 4OIAA 4BUGA 2VXSL 1U8OB 2O61A 5L2KD 5HYEA 1EAPB 3VGAB 1W0VB 2JB5H 5C0RL 1A3LL 3IDXL 4YFLF 3Q0HA 4LF3A 1MH5A 2VO5A 3MA7A 1J1XL 4NQCA 4LSQL 2L4OA 4XVTL 4YIQA 3QUYB 5FCUH 1JF1A 4CNIA 2E27H 4OCXH 2YZ8A 4I18A 1H3PH 2XG5A 4PUBH 1OVZA 1HDMB 4UBDD 4ELKB 3BWAA 4QYOA 4JZJC 3P77B 3TWCH 4HS8H 5DXWA 3SDCC 1T5WB 4FXKA 2HVKA 3HE7D 3S5LA 1J7VR 1D5BA 4HJJL 2GTWA 4HUUB 4MNHA 4QXUH 1NANH 2EC8A 3SKOB 3G6DH 4APQD 4PP1D 5CJXA 4M62H 1NLDH 1NBYA 3D39B 4CMHC 5C0FB 4RFOH 3G6JF 4LU5L 3E6HB 5ELIA 5IHZA 3CCHA 5IIEA 2P4AB 1BQHA 3TN0B 3PABA 4X4ME 3BIKB 1R3IH 5MEND 5JOPD 1IC7H 1F3RB 4C55A 5CKAA 3FRPG 2ICWI 4MNGB 3OB0H 3L3HA 1JHKL 3V0WH 2VUOA 1V7NH 3H9YA 3LMJL 1A7PH 2HG5A 2APFA