4C56E

X-ray structure of the complex between staphylococcal enterotoxin b, t cell receptor and major histocompatibility complex class ii
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
189
structure length
184
Chain Sequence
DTRPRFLWQLKFECHFFNGTERVRLLERCIYNQEESVRFDSDVGEYRAVTELGRPDAEYWNSQKDLLEQRRAAVDTYCRHNYGVGESFTVQRRVEPKVTVYPSKHHNLLVCSVSGFYPGSIEVRWFRNGQEEKAGVVSTGLIQNGDWTFQTLVMLETVPRSGEVYTCQVEHPSVTSPLTVEWRA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Immune system/toxin
molecule keywords T CELL RECEPTOR ALPHA CHAIN
publication title Structure of the Superantigen Staphylococcal Enterotoxin B in Complex with Tcr and Peptide-Mhc Demonstrates Absence of Tcr-Peptide Contacts.
pubmed doi rcsb
source organism Homo sapiens
total genus 33
structure length 184
sequence length 189
chains with identical sequence K
ec nomenclature
pdb deposition date 2013-09-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
E PF00969 MHC_II_beta Class II histocompatibility antigen, beta domain
E PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4c56E02
3.10.320.10 Alpha Beta Roll Class II Histocompatibility Antigen, M Beta Chain; Chain B, domain 1 Class II Histocompatibility Antigen, M Beta Chain; Chain B, domain 1 4c56E01
2WMPA 1MF2H 4NJ9H 1C5BH 1YA5A 5I74B 1I1CA 4N0FB 2W92A 1H3UA 4FP8L 5ISZE 2R0LH 3MRNA 4YHKL 1H15B 5D2NC 2NLJB 4YDKL 5MEPA 2E7MA 2YKLH 5FKAA 1J1PH 4JRYD 1MAMH 1U8LA 3TEUA 4RAVA 3PHOA 1KPVB 1S7QA 3PQYD 2EIEA 1RMFH 3TCLB 3O2WL 3GHEH 4JN1H 4OM0L 1S78C 1P4LB 4NSKB 1KJ2B 3ZYOA 3QQ3A 4JGJA 3WKNA 4WWKD 3I2CL 1IGFL 5C09E 3H9HA 3WS3B 5DD5L 2XKUA 5T3XL 3ELAT 1QNZL 2HJKB 1TQCC 5DEFB 3X14B 5KSAC 2NTFA 5DYOB 1AR1C 3MCKA 3JZ7A 3GMLA 2G2RB 2NY0D 3KLDA 4EEEA 4WUUA 2R2HA 3RKPA 3EDEA 1NBVH 2WP3O 4ODHL 3QDGB 5A40E 1DBKL 3W39A 3K2UL 1I1RA 2I60L 1C5DA 3CK0L 2R56H 2V2TA 3ME0A 3MRPA 3QHZL 4ERSH 2VYRE 2EIZB 2EDOA 2BY0A 3JTTB 5FAAA 4KKCC 3A6OA 1U8OA 3MNZA 5DMIL 4AT6B 3C60C 5E6IA 1QACA 4JFEE 3S8WA 2O93L 1H5BA 3DVNA 3VI3E 4UTAL 4QHUB 4NFDA 3MOAH 4JKKA 1F8TH 2VSCA 2UUDK 2XZZA 1N64L 3IDIB 1L0XA 3Q3GA 4HWEL 1WEJL 1B0GA 4WFGD 3VDAA 3RU8H 2R2CA 3BZ4A 4KPHL 3CXDH 4FTVD 4HS6A 1UXWB 3CX2A 3OZ9H 2XKNB 4JREB 2QQKH 1GZQA 1FZOA 1G7HA 3BT2H 1SMOA 3QDJA 1BLNB 1FORL 1UQSA 4EVNB 5I1EL 4LP5A 4M7LL 5KSUB 5KSVA 1BZ7A 3BIAX 2X7LA 4JQIL 5IGXH 4PUBH 2A1WH 4U0QB 4RZCA 4S2SB 2EYSA 3TA3C 4O58H 3W5MA 1IZKA 4ZPTB 1FO0H 3ES6A 1F3JA 4XXCC 2NZ9D 4Z95L 3WJJC 2YUXA 4WVRA 1IC1A 1UZ8A 5C0CA 1ZVSA 2ENSA 4XPAH 4N0UA 2NPLX 5EBLA 1VKXA 3GO1L 4LVEA 1J05A 1YPZF 5K33A 2VQ1A 1HEZA 4JRYB 4NIKB 5DJ6B 3ULSA 2NQCA 1OTTC 1MVUA 3PP4L 3MLZH 3BJLA 1BJ1J 5B39B 4ISVB 3WS6C 2EZ0D 5TH2A 5E8OA 3O6KH 4GG6A 4XNZB 4WWKB 1HILB 3L7FB 2OR9L 1F90L 4YDVB 5B8CC 1V5JA 1VGKB 3DYOA 4AH2A 1T6VN 3QQ9C 4NO3B 2GK0A 4C56A 1L7TH 4X4YA 2GSGA 2BVPB 5DMKA 5H94A 5I30H 4K23L 4H1LG 3DROA 1BX2B 5D96B 3HC4H 5C0RH 4OLVH 4ZD3L 1MWAL 3H7BB 2X44D 1JWMB 2VDLH 5HHOB 1JPST 1LMKA 1A1NA 2FJFB 3CMOL 4LSUL 2IG2L 1G0XA 4P23A 2FHCA 5DRNA 1U36A 1WZLA 3IFLL 1D5MB 4XNMA 3L95B 3QUML 4CL7A 1JYNA 4LCYA 5IR1A 5GGSY 2VLKE 3CGTA 1DLHA 2VLMD 3D85D 5FYJL 5IG7B 2MCPL 1G1CA 2FJHB 5E99H 5C0EA 1I7UB 5F7EH 1FJ1B 1HNGA 2APWA 3G5VA 1IKNA 5F7WC 4X6CA 4BH7A 4BSWB 3JWDC 4S11A 4JCMA 1JHTA 5ENWB 3KJ6H 4C4KT 5C6WH 4KK5D 4DTGL 5DD3L 3W0WD 1QSFB 1QR1A 1IRAY 4R3SA 5GS1A 5CP7A 1SBSL 1KJVB 2CIKB 4S1RL 1DL7L 2EKSA 1MNUL 4JRWA 1B2WL 3RQ3A 3S4SG 3D25B 3IJYB 4XAKE 1IGCH 5I1IL 2YEZB 3LKNA 5FUCC 4PGEB 4ODVH 4K3EL 2BHYA 3QEQE 4P9ML 4MD4A 5E7BA 1BQHB 1ZTXH 1RQ5A 4YBLC 4PJCF 5TDPA 2EECA 4IMLB 2VXUH 4M62H 4MA7L 3S34L 1R3IH 2IAMA 4U2ZA 4P46B 1RHHA 2VRAA 4G42B 1N3NB 3S35X 3MXVH 3S88L 5IUSA 3UTZA 3AXLA 1R24B 5F7DA 4ZQKA 4KDVA 4NHCL 5IMLA 2P8PB 4BQBA 5ESQB 4RMTA 3LD8B 3HAEB 1DANT 4R7NA 1T22A 3KPSE 3ROLA 5AZ2L 3U7YL 2OL3B 5B3JE 3ARPA 4BZYA 3EJZC 1HNFA 4ZFZB 4PGCA 3BP4A 2QHRL 3DBXB 1G1YA 1DQQA 3QFJA 1BFVH 3ARFD 4PR5A 1VFBA 4TUKH 4LDOB 1YEJH 5B22A 1QTYT 3B9KC 1CLZL 3P9MB 3V5HA 1YYLH 4XI5C 5CWSB 3SDCA 1G0DA 1A7OL 4LFHD 1MCJA 1OB1B 2QTEA 1GOGA 4P2OC 4R96B 4ZTPH 3WUZA 4YDIL 4R8WL 5D1QB 4TUOB 3ZKND 1A7BA 4F9LC 1L9MA 3QHFL 5ANMA 1AY1H 5KW9L 4LKXA 2C1OA 2NX5E 1FG2A 3JWOH 2W60A 2NY3C 5JR1L 3K4DA 4PJAA 2XRAH 1MHCB 3QB7C 5E9DD 1CVRA 4QHLA 3QH3A 4OM1L 4QF1B 4JJ5B 4RRPG 1OF2A 2XTJD 5AD0B 1S7TA 3D85B 4WW1B 1IAIH 4IDJH 2H32A 5GGSB 2AW2A 1XZ0B 4ENED 4XC1L 1AFVL 5IMMA 4MXWL 4Y16C 3BGAA 1UVQB 4J23A 4OF7A 4XXDB 3OPZL 3OX8A 1FCCA 4MAYD 2VQUA 2EEDA 3I6GB 3P4NA 1XMWA 4WJ5B 4DZ8B 3EO0B 1A4JB 2DI8A 2OTPA 4NKIL 1NMCC 4TPRH 3WHE0 2EO1A 1LO4L 4J4PA 5L6YH 1RUQL 2BOCA 4W70A 3TZVC 3WFDH 1EA9C 5KOVC 3Q5OA 3W0WB 4P0DA 4JZNA 3MRDA 5D72L 1CXFA 1ZHKA 4POZD 2CMRL 2P48B 4I18B 3GSUA 2VLLA 3FB6B 1N6QH 3DI2B 3V8CA 1WJ3A 4N90E 1F2XK 1IEAB 2AQ1A 5DHVB 2C5DC 3G04A 5GS2D 2EDTA 1OTSD 3H42L 1I3GL 4I4WA 5F3HA 4NQDD 1S9XB 2VDPH 3SY0A 2VLRA 1PD6A 1WAAF 5EOQH 1KSRA 1A8JH 1MRCH 3NFSH 4P5KB 3L5XH 4OKDA 5E2UH 4LIQH 1KFAH 4B7IA 3H9SD 1S7WB 5E2TL 3AU1A 4P5MB 1OPGH 3BKCL 5IBTH 1NCNA 5IMKA 2R0WH 3OKYA 3TBTB 3H3KA 4LHUG 5HYEA 2BNQA 2C4FU 5FF6A 1A0QH 1K5NB 1I7ZB 1RK0A 3GJFB 4LOUD 3NA9L 5FHBH 3N0PB 4RBPK 1WV7T 4N9OB 2P24A 5EZJA 4S1DC 3C2AH 1ACYL 4WHYH 3FO0L 5IB5B 1CK0L 4D0BA 4WHTA 4KRNA 3ARFB 2OR7A 2Y72A 3DX7B 2JCCA 4KC3B 2XG4A 3MPCA 4PJBB 4X0KB 4HFWB 3VE0A 3QUZD 5FYKL 1MJ7L 1CE1H 3IJHB 5IBLD 2YR3A 3QCUL 1NLBH 4PBXA 1P2CA 2NXYD 4XCYA 3L3JB 3BO8A 4R4FL 1HSBB 4JFFD 3OAYK 3DVGB 3U79A 1EZVX 3H8NA 3ZYJA 4XP5H 1S9YA 3MBEC 1AHWA 4WTXA 1MWAA 3MJ8A 3QDME 1W8OA 1EGJA 3F6IA 4LDLB 1IQWH 2HFGH 1BFTA 1YC8A 4EQ2A 4FZEH 5JOPE 3FO9A 5E9DB 3ULVH 2VE6B 1BVLA 3UC0H 3TV3H 5E94B 2XTJB 3QUMA 2W91A 4JDZA 1AGCA 4Z7NE 2V9QA 1E4WH 5D71H 1R3LA 1OQXA 1CLCA 5T1LA 4S10A 5D2LE 5HHQA 5B21A 1G9ML 2HT2D 3GBMH 3O9WC 4MD0A 4ZSOA 4MAYB 4MXQC 1KULA 1D9KA 1IBGH 5IJKC 2G60L 1I7TA 2WLYA 3OL2A 3MA9H 4QRPB 1S7RB 1I9RH 2A6IB 3GJEB 1M7XA 4JR9H 1ZGLM 4NNXB 1NMAL 5IHBA 2QHLA 3HC3L 1DUZA 1UYWH 4LDEB 2WNGA 2DTMH 3PWUB 3MV11 1YNTA 4G9DA 3SDXB 3VXUA 4UV4H 4KI1A 35C8H 3WL9A 2VDRL 4NQDB 3TO2B 4TRPH 2Y07L 4XP4L 3L5JA 2FYYA 3ZE2F 1FNEA 3G5ZA 2SEBA 3DGGA 3JV6A 4OZIE 3QPQC 4LLDA 2Z4QA 1IC5L 2GJ6E 4X7TB 4J2XA 1GC1L 5HPMB 4X7CC 3U4EB 1TXKA 2R0ZH 1GGIH 1KB5L 4YO0A 5BZDA 4JFZL 5HDOA 3BPNB 3TN0A 4M7KL 1MIEL 1HXMA 5J6HA 4OLWL 3DECA 5IEHA 3S5LG 1AD0A 3VD9A 1T6WA 1Z6JT 2HVKB 3DRQA 5IB3A 1NGPH 2W0PA 1NGQL 4RISH 2CDGA 2MTPA 4XBEL 4PB0H 3RNQB 1T7XA 1W0VA 1EO5A 3QEHB 2QADD 1RUMH 5ESVB 4Y4KA 3DXAE 4HXAL 4WUUD 3NPSC 4AG4H 5EPMA 3QUZB 3O8XD 3PNWA 4J3WA 4DN3L 2QV2A 4XPTL 1UCBH 3GSQA 5F8RC 1X5XA 3F65A 2NXYB 1NUNB 5HVWA 1WF5A 2FGZA 4JFFB 3SPVA 2W9DH 4HKBB 1NC2D 3ZT6A 3FAXA 2AJSH 5EZOL 3C8KB 3T4YB 5IHZB 4O4YH 3S36H 1P7QA 3O45A 3D0LA 5T1KA 3C09C 3GMOA 1FDLH 2IADA 3CUPB 5I75C 2X41A 5E6ID 5E5UB 2YOCA 4ZO7A 4OQTL 3CVHL 4Z0XA 3LH2H 3H3PL 4GLRI 4NQVA 3OGCB 4Z0BH 5CEZL 2YA1A 4HWZB 3PDDA 1N5YH 5E08H 3LPWA 4OZ4B 3HLAA 2FATH 5LKNA 4JHZA 3RPIB 3V4UH 4GBXA 4FS0A 1Z9SA 1TVHA 4P57B 1G7PA 2ICWJ 3K8LA 4BA8A 1BFSA 3FT3A 4UU9B 4Z7UF 1P7KA 1XF3A 2VISB 1QLFB 1BVKA 2FZ3A 3SE9L 3GI9L 4V1DA 5D7JC 3RIAK 4BUHA 1IM3B 3HN3A 3AS3A 3JSSA 4GAFB 4X4ME 3LIZH 4KJYA 1JZ3A 3QG7L 1NL0L 3DV4A 2XWBB 3BH8A 2CSPA 5JHDD 3UPRA 4CN1A 3RKDC 4R0LA 1MJUL 4J3XA 4LCCC 4KVNH 3FMGH 1JPFB 6FABL 3X13A 3LZFH 4HH9B 3BOVA 1EHLL 4MJ2A 3QUYA 4ZOCA 2GTZA 4PJHB 2Z91A 1R3KB 2AS5M 1A7QH 3TYFB 2R0KL 4PP1C 5EU6E 3HNTL 1FVCB 1J11A 3GMMA 3FRPA 1K4CB 3TH2T 2OJEA 4FQIH 1JRHH 3G6JF 1EAPA 5FB8B 1FZKA 5DUBB 4BJLA 2WV3A 4RGMC 3FT4B 5HHPB 3ZE1E 2J7LA 4P3DA 5BJTA 1QFHA 3BP5A 2QADB 5DJ2A 5CJ5A 5SX5K 1DQML 4J8RB 3OR6A 3DSFL 4WUUB 3MRHB 1BM3L 2HFEA 4OCMC 3RL1B 3O8XB 5GGVL 1JPSL 2RFXB 1AIFA 3GI8H 2R1XB 1Z9OA 5I15H 1AR1D 2B8OT 3ARWA 4LARH 3S37X 4PRAA 1V7ML 5FKPB 4PJDE 5GRVL 4XAWH 1NC2B 1AGFA 5I8CB 3BGMA 5ICYB 3VFGL 5EWIH 3I3EA 4XVUC 3TJEL 1DBAH 1KLGA 4K3JH 5JZ7D 3D2UA 4QRQB 3LN4A 3THMH 3QULB 1UEMA 12E8L 3WN5A 3MLPA 2FCBA 1B6DA 4HCRH 2V2WA 3KS0H 4RMVA 4XX1G 3VWKA 1CFTB 1EEQA 1FFNA 4HIIB 2PW2A 4KKCD 4LIQE 2DWEA 4ONGL 1C8PA 2BOBA 4Y5VB 4F7TB 3SQOL 3BZ4B 1EEZB 1WITA 2X10A 1GIGH 5T3ZH 5KBNC 3GSWB 3CH1B 4NM4H 4ELMA 2ZCHH 1UH4A 1LP9A 1KJ2H 5TQ2H 4AQOA 2BNUA 5FHAH 2CIIB 1G7HB 2HRLA 3NABL 2BNRE 2D7NA 5HY9A 2I27N 3LS4L 4MB5A 4H5SA 4G6ML 5D70H 4P9HC 3HNVH 2IAMD 2YMXH 3SO5A 4UOW0 1VGEH 2DKUA 4LEOB 4GRWE 4JFHE 3FO2B 1I9JH 2VXQH 3NIGE 4CUCA 3P0GB 4MQ7B 5JHDB 2AJUL 3ES6B 1A7RL 3VFNB 4XB7A 1B3JA 1YEGH 2APVA 4GMTH 2AJYL 4JLRA 1WWAX 3H9YA 3NACH 1J05B 3VXNB 3WUWA 2GTWA 4UQ2A 1IVLA 1Y6NR 4FQCH 4H26A 4GQPH 1MVUB 4O2EA 3HTLX 4WUKH 4G8EA 5HHVH 1XGUA 4ZS6C 2JJTA 2JELL 2J88H 5D2NB 4WFHD 1KB5A 3GSRA 1MHEA 2D3VA 5CZVH 5E8OB 5F1IB 4HX1B 1S3KH 2RR3A 3SDCD 1ZLSL 4G6FD 2BFVL 4KK9C 1HHHA 4X4YB 5H35A 4E41E 3GSVB 1FLTX 1QSEA 3B9DA 3CCHA 1J8HE 3BN9C 5HI4D 3QEGL 4JAMA 2MKLC 2HLFD 1Q0YH 2ZSWA 1NUDA 3FT2B 3D0VB 4BK4A 2XFXB 1AR2A 5IV2A 5A2LH 4OFYA 3TBWA 3P77B 1MFDL 5A16B 1A1NB 2YXFA 3WXVH 2FEDC 1TQCB 1X5AA 2IGFL 4BFGA 1XGQA 1T7WA 4DEPC 1RU9H 32C2B 3EUUA 4NKMA 2HVJB 1PY9A 5TDOA 5TE4L 1RZIA 3Q1SL 5I1GH 4IMKC 5HI3D 3QIWA 3FL7A 2XIDA 3TBSB 4NZRH 4MD5B 1MCRA 5INDA 5IVXF 1FP5A 3C8DA 3TVMC 4QO1A 4TUJA 1YEEL 5D5ME 5I16A 3CVHA 4GRMB 1ZLUH 3W81A 1RIHL 3ZSTA 1YY9C 4I3RH 4RGNE 5CSZB 3LDBC 2DQJH 4DGIH 5IM7A 3T0EC 1FNGA 3VD5A 2GAZA 4D9QE 4X98A 1KG0A 3T4AA 4MA8L 1J7VR 3PHQB 3TIDA 4FQXA 1LK2A 2EKSB 5ALCL 4P5TA 1GGYA 1MCEA 2E5EA 1JK8B 3MA7A 4YXLL 5KTEH 5MEQB 1EUUA 2J8UA 4PRDB 5E0QA 3K1DA 1ORQB 1FE8H 5FM8A 1L7IH 3QUXD 4Q2ZA 5EC1A 3S35L 4K94C 4Z77A 1J5OL 1LO0H 2QJDA 1GHFH 2IAMB 4JO2H 4PJ7F 3GZKA 4Y5XC 1U8PB 4P4RA 4XCCH 4N0RA 3O6LH 4KRPC 3VFWA 3X11B 4JZOB 1WK0A 3MV8D 2BMKA 4P99A 4EDXB 3L3HB 3O2VH 1LO5A 3D48R 4GMSH 5EZLA 3PJSA 3G5YA 4POYA 1BD2E 4Y5YA 1U95A 5D7IE 4J1UA 3MOBL 3N9GH 3TT3L 5GGQH 5I8EB 1S7XA 3STZA 1BOYA 4C4KO 1CR9L 1JGEB 3EFDL 4H25B 2KZ1B 2PYEE 4KUCF 5IEKA 5GS0D 5JNYA 4U1JB 2A74A 3I84A 4PJXB 1QRNA 2ZOLB 1CGSH 3V5HB 5KSBA 2A9NH 2ITDA 1FFOB 3EJZD 3GSNL 1U8JB 4G6FB 5HYQA 4YK4C 4CVZB 3DUUA 4JFXB 3SJVE 3IU3B 1HSAB 3P30L 4DCQA 3ZL4L 5F9JB 4LQ1A 2AJXL 2PW1B 5B8CB 1X4YA 4WIQA 4UT6L 2R69H 4WO4A 1QLRB 2E3VA 3BVNB 3L3KB 4OAWA 2XWJA 4N5EC 1JWSA 3HZMA 1T1ZA 2BSED 1MFCL 1KCKA 2AK1H 3GDBA 4R4ND 1NGZA 5F7FA 3MLWH 1UA6L 3NFPB 4LAQL 5IB4B 1WZ1L 4C55A 4O5LH 3VH8B 3NCJL 3IFPB 5DJDB 2AERT 5IFAH 5FYJD 4Y2DA 1SJEB 4W6XB 4EDWH 4OZGE 1V8HA 1UJ3A 3QNYB 3BP7B 3RWHA 2ZSVB 1KTDB 2E9JA 2MKWA 3E3QE 2CJUL 4YC2C 3EDDA 4H20L 1D9KD 3KVQA 3V9FA 3HAEH 3VU2A 5F3BB 1T1WB 3PWJB 4Z7VF 4L8DB 1FL5B 2OL3H 5IW6A 2DS4A 1JCKA 4F9PC 1FNSH 4NT6A 3HRZA 4MGXA 2W0LA 4B7LA 1NDMA 1A22B 3UTOA 3O4LE 3BKML 3UJJL 1SJXA 4KK6D 4XPBH 2E6JA 5I76B 3HZVA 3NIFF 2HTLD 5IW1B 3VFPB 3BDYH 1QQDB 4XB8A 5ESAB 4G43A 4D0CA 3MLSL 1ZLWK 3QUXB 5ITBH 4I4WB 3TC9A 1EXUB 4LHQB 4YFLF 4H1LA 3CFKA 3DRTA 4I48A 4QRUA 5C0IB 4EN3D 4HEME 4OTXH 5FCUH 3T2QA 2EXYC 4PJEF 3ARRA 4JG1L 5FFLA 5ABDE 5FA4A 4OCWH 5TPWH 2NY2C 3VRIA 4X6DE 3O41B 4MSWB 2QQLL 3QXWA 3MV8B 1OWWA 3IFOB 3TN0D 3MODL 4NN6B 5EU4A 2FIKA 1RK0B 1JN6B 1YEFL 1S9VB 3HZKB 2ILLA 3DJ9A 4PGDA 5IBUB 3ECBA 4GAGH 3ZKSD 3DX8A 1K85A 4KI5D 1MHHA 4RA0C 5EZJB 1X44A 3MLRL 5E8NA 1TPXB 5KJRH 4PS4L 1ZANL 1F11B 1RFDH 1KB9K 2QLVB 4D0BB 4AMKL 1Y6KR 3BAEH 4POUB 1S7VB 2B39A 2X1XR 1KCUL 2FBJH 3OAUH 3FAWA 4K55A 4FQ2L 4F15B 1HHJB 4M6OL 1FGVL 5E6YA 4YE4L 4RMUA 5FA3B 5MEOB 5T3ZE 1X9QA 3VRLF 5E8PA 2IH3B 3A6CH 5DJ0A 4Y4FD 1JZ8A 3ESVF 1S9YB 4JKPL 1AHWB 3S4SA 2FB4H 1W0WB 4IRJA 4ETQB 3VMPA 3RJDA 2ZG2A 3KDMA 4GUPA 5T1KD 4ZUTB 3KG5A 3TFKC 3T3PE 5DHVH 2BY2A 1PVHA 4M6NL 3PV7A 2X42A 5TF1L 3S36X 4ZG1A 5BOZG 1Z5LB 4X6FA 2MMXA 3QUKA 1PW3A 4L8BB 3P0VL 2QSQA 3DI3B 1CLYL 4H88H 4GQ9L 3V8OA 2YS4A 3RDTA 2KZWA 3WIIL 3QDGE 2MQCA 2R39A 4GBXD 4ZS7L 3RA7L 1PZ5A 4JANA 2XWTA 2IQ9H 3QXAB 5FO8A 4RFEA 2Y06L 1KCSL 3MV7D 4G6JL 2DQFA 3O2DH 5GHWL 3IDJA 1S5IH 4X4ZA 1DUYB 4XCNB 4U1SA 4AY0A 2CKBB 3EOBB 4U6XA 4P23C 1NMCB 5CP3H 3L3GA 4LEXL 4HIXH 4OF0A 3G6DL 1JF6A 4YLQT 4HUVA 3P40A 1U8KB 4PJIA 5I1CH 3TO4A 1UM6L 3U9UB 1C5BL 4L9LA 2D2OA 2DQGH 3BXNB 4U33A 4JG0L 2OP4H 2FYYB 3MBXL 2F5BL 2Q6WB 1CS6A 4EN3B 3G5ZB 1UH2A 4KQ3H 3RY5A 1TNMA 1U6AL 2Z4QB 2ARWA 2X1QA 3SE3C 2A6KA 5GJSH 2H6PA 2VXVH 1DVFC 2F74B 4LPXA 4YO0B 5HVGB 4P9HH 4RRPA 1RMFL 4N68A 3FQTA 4N8VG 1HXMB 4L1HA 5IHUH 1HH6A 4Y0GA 1UWEL 5IEHB 1T5WB 3QA3A 3DO3A 1XIWA 4RSVA 5HYSB 5HGBA 1EJ6A 2G9HA 1JNHA 2VXSH 3C9NB 4HKZA 1G6VK 3GHBH 2P47B 3EDJA 1PG7W 4NOBA 4LRNH 1TCRA 2ADIA 1J12A 1JGDA 4JKLA 4WGWB 3ZHDA 4EOWH 3UZEA 3S3PA 4JPKH 5C0JB 3K1KC 5EH1A 3HA0A 2GUOA 1UM5H 2F19H 5C0AB 4JRYE 1FLRL 4LHJB 4YJZL 3PQYE 2C7UB 3QI9A 3EO1B 4Y4FB 3ZKMD 3Q6FA 4HF5H 2EH7L 4NC0B 1C08A 1D6VH 4ERSL 2UWEA 3RL2B 3WKML 2BSRA 1ZS8A 3OXSA 3RUGB 1TJGH 5T1KB 2IADB 3D2UD 4NO5B 2DM4A 5LGHL 4JFYB 5K59E 5GS2H 5HYJD 4YBHA 3VWKD 1F8TL 1OGTB 1SEBA 4RAHA 5TQ0L 4WEBH 5JMOC 5LWYH 4S1QH 2CR6A 1X5YA 2IQAB 5DJAB 5SWQB 5A2KH 3JBG7 4JFQA 2EO9A 1HHKA 3JV0A 5J89A 1EERB 2CDFA 3RZCC 3S9DB 3HI5H 4LHUA 1A6AB 1LO2L 3OZ9L 4N1EA 4CN4A 2YPLD 5FM5O 5ICXB 5GZOD 3DX6A 1VPOL 3MV7B 3BISA 1NFDA 1XF3B 2FZ3B 5D1XA 3SGKA 3WE6A 3IJSB 3ZT7A 2W65A 4JB9H 5IGXL 1E28B 1Q9KA 4PUBL 2A1WL 4O51B 1F6AA 1MCLA 4ZTOH 3HE7C 5F89B 2VLKA 4HQQL 3MGTB 1FO0L 4WFGE 5I1AA 3LQAH 1JZ7A 1ADQH 4G5ZL 1N59A 1UZ6F 4FTVE 2XYCA 4XPAL 4PLJC 4MB3A 4FQHA 2GTZB 5E03A 3Q6GH 5HGDB 2H45A 4MNQA 4OKVA 1RJZA 2CRYA 4J4PC 1VACB 4HKJB 5T5FH 1CICC 1M1SA 1A4KA 3R06B 5BV7L 1RUKH 4NWUH 3X3FH 2OJEB 1BZ9A 5B4MC 2HN7A 1TETH 1Y6MR 3O6KL 3MOQA 5B3JF 2RQ8A 3VGGA 4JM4H 3V79C 5ADPH 5JA8B 1L7TL 1KACB 3VGAC 3BP5B 5DJ2B 5I30L 2HMIC 4KTEL 3QEQA 5HGAA 2WINA 1ULVA 4OLVL 4XPGH 4ZDHB 4M00A 1X4XA 4MXVE 3MNVA 5TE6H 5DA0B 4LLYA 2MSPA 3BZFB 1WBZA 1U2HA 1INDH 4BZ2L 3NPSB 2X9WA 3BGMB 1K8DA 3L3OB 5ERWA 4XVSL 2DQUH 3D87B 3OGOE 4OGYH 3KPSA 3O3BA 3FQRB 2A83B 1P6AB 1CYGA 3D2UB 4JPVL 5E99L 5F7EL 3EHBC 2H8PB 2DQEL 5FO7A 3OKKA 3WN5B 2AEIT 5DWUL 4DZBA 5HYJB 3CSBA 5EO9A 3VWKB 1W72B 3G9AB 3K8MA 1BJMA 2CLVB 5DD1L 1YJDC 5CEZD 4NJAH 3RY6A 2AKRA 2D31A 5I75B 4M1DL 2BOBB 4Z7WA 1EBPA 5C0BD 5JIKA 2CLZA 4HDIA 4DAGH 4E5XA 4ZYKA 2LABA 4M5ZH 4ODUB 3SCMA 5J12C 1D5XB 3IAQA 2YPLB 1RIUH 1YN6A 3S5LA 2VLME 2YPVH 4HS3A 4NP4H 4H5SB 4XMLL 3WMSA 1J10A 3ZHLA 5INCA 5CBEB 3WSQH 1F58H 4R97C 2R4SH 4EIZC 4M62L 4I9WD 3CD4A 1NJ9A 3TF7C 1P53A 1TMCB 5BVPL 2D4DA 3MXVL 3IDMA 1GGCH 3MR9A 2OM5A 4RAUB 5GS3A 3U9PH 2MFNA 1NCDH 2F53D 5D7JB 3VJ6B 2XXCB 4URTB 4ODWB 3W0WE 3I3BA 1H0DA 2F5AL 4FXGB 5ETUB 1W2KT 4NN5B 4Q6IA 4X5WA 1MCNA 4PJ9D 1RJLB 3BH9A 4KTDL 4YHIA 3GMPB 4JPIA 4ONHA 2GTWB 4MYWB 1CT8A 1YEKL 1I1FB 2FECI 3KLSA 3W2DL 1NPUA 4H8WL 1CCZA 2BY1A 2E27L 1MAJA 3GSRB 4F7PA 1UC6A 1NDGA 1MH5B 3LQZB 1EEYA 1T5XA 5BXFA 3MO1A 1YYLL 5B39G 1KT2B 4HSQA 4XMKL 4RNRA 2WBJD 5LXGH 1BREA 3CFCL 5H8DA 4DKFH 5SWSA 2P5WD 1QVOA 2XG5A 4ZTPL 1CBVH 4MDJA 4XWOC 1NCAH 1T3FA 4D3CH 4JM2A 3IDNA 1LE9B 2YC1B 3RTQD 3D6GA 3TBWB 1A6ZA 1X6NA 4X7FC 1OP5K 2DL2A 4E9LA 3J8F7 2HT3C 4RIRA 2XRAL 1ZT1B 3PDGA 3BHBB 2CLRB 4BZ1L 3OG6B 3VCLA 1ZA3A 1KIQA 5DQDH 3SKMA 1TZHA 4RDQF 1ZXQA 4PJBE 2H2SC 1A21A 2CK0H 1RUAL 4IDJL 1MRFH 5FGBC 4PG9B 1BJ8A 1M6OB 1PJ9A 1KV3A 2FSEA 5IROC 4AEIH 4XC3H 3MQIA 2JJVA 3FQNA 1MOEA 4UQ3B 2VN7A 1S9WB 3ARBD 3ZT5A 4Y4KC 1YMMD 4NZUH 4NZTL 3CFBB 4WW2F 2O5XH 1XCQA 3V0WL 5L6YL 5C3TA 2DKSA 2IALA 3WNPA 5C0BB 5D1ZA 4C58B 5E9DE 4KUZH 3MLTB 2XTJE 3M17B 2UZIH 4PLKC 3ARGD 1N6QL 1XGRB 1KN4H 3U36B 3IAPA 2GJJA 4GW5A 1CLOH 3CDGB 2OQJB 4X4XA 4UT7H 4Y4HD 5C0DB 4ZPVB 3OKMB 3BD4A 4KFZC 1N0LA 3RWIA 2FNBA 5EOQL 1BQHG 3NFSL 4OB5L 5E2UL 4LIQL 5CEXB 1KFAL 2WQRA 2F53B 2ZPKL 4Z7QE 1OPGL 1FO0A 1WICA 5D2LA 3WEXB 5EZLB 3DUSB 4PJ9B 3B5HA 4OLUL 3HI1A 4HZLA 3T2OA 3INUH 4ZO8A 4OZIF 3IU4H 3HAEG 5FHBL 1S7XB 3BSZL 3P4OB 1WBYB 4NQDE 4OI9A 1DSFH 3F7YB 1C12A 1Q1JH 1SYVA 1EFQA 3RRQA 5JXEA 4MCYA 4R2GC 3DMMD 1CE1L 2WBJB 1P1ZA 5KS9B 1IILE 4PRID 1NLBL 2CO6B 1YC7A 3CFJB 3H9SE 3C08H 4PY8I 4R0LC 4RMQA 1XT5A 3U0WH 2P5WB 3S3SA 1GGBH 4X99A 1I8KB 1BBDL 5F9WC 3MRBB 4BKLA 3VXRD 1T03H 1N4XH 3NCYP 1TIUA 4P3WA 4XP5L 3RTQB 1MQKH 1JWSB 3QUYC 3HZMB 4LASH 1VEPA 1DZBA 2X4TA 4XNXL 1IQWL 2GJ6A 1T1YA 5DUMH 1A6VH 1VEMA 1SEQH 1CE6B 5ALBH 3TV3L 3IAGC 2EKJA 1I85A 4HWBH 3RGVD 4APQD 4UBDD 2VDMH 1NANH 2EDFA 5EU5B 5D71L 4UINL 4FFZH 2Y23A 3IGAB 4LKCA 3W5NA 1LWRA 1CZ8H 3V95A 3PIQA 4JFFE 4XWGL 3ARBB 3D3VD 4L8SC 4EXKA 3WHXA 4FP8H 4GKZA 5J6GA 3WXWL 1YMMB 4TVSa 3SKNA 4OD1L 3IVKB 3DXAA 3MA9L 1FZJB 3NIDF 4YDKH 4UDUA 1TVBA 4NNPL 1E4XH 3C5ZD 3TVMB 4JR9L 1JPGA 2CRZA 5D7SL 4L29B 3GMQA 4HXBL 3GRWL 4LPUA 4XBPA 4XVJL 3LDBB 1R5VA 4HT1H 1JMZA 4LBEA 3DVIA 5A2JH 3ARGB 3B2VH 3I2CH 4FXKB 1IGFH 4D0CB 2EYRA 1GZPB 4PV8A 5DD5H 35C8L 2QR0B 4I48B 1YZZA 4QRUB 5FV2A 4Y4HB 3WCYA 5F9OL 3QJFA 3OHXA 1C16B 1NC4A 1OCWH 1OD7A 4U7SA 3PWNA 4Z7OE 5FA4B 1HDMA 1SJHB 4X9IA 1FL6A 3REWB 5ACMA 1AD9B 2XQBL 2EDLA 2VXTL 5F7YC 3PDOA 4PTTB 4ODHH 2HJFB 2JB5L 1GGIL 4JHWH 3LPGA 1QO3A 5I6XC 4J3SA 5HYFA 3RWFB 3OR7B 2I60H 1Y18A 4OZHE 4Z78B 3CK0H 3WFZA 3R8BB 8CGTA 4JFDD 3QHZH 2H32H 4RWHA 5AZEL 2FEEI 1NGPL 1A7NL 5J3HC 1XF1A 2FGWL 3A6BH 3HI6H 4XZUA 2B7DT 4NQED 5AYQA 3KJ4C 4CMMB 3OKDA 4W4OC 4PJHE 4AG4L 1OSPH 4X4MA 2HG5A 2ZUQC 1N64H 3DMMB 2OCFD 1S7SB 4PRIB 1UCBL 4HWEH 4WRLA 2YN3A 4GRLD 4DWHA 5I73B 4KAQH 3I6KB 2Y1VA 4LFHG 2BRQA 1KTLA 2W9DL 3L5IA 2ADGB 2AJSL 3VXRB 3DARA 2E7LA 4GUPB 3S36L 1E6OH 3BJ91 1FDLL 4LQFH 2BCKB 1GC1C 3LN9A 2BVYA 4MZ2A 4PJDF 1FORH 5EU6A 2BSSA 4X6FB 4M7LH 5ACZB 4JZJA 2FHBA 1H3PH 2GK2A 4JQIH 4WUUE 4RGOH 1VADA 1Q9LB 3RGVB 4APQB 1N5YL 3GKZA 3RVUD 3KPLB 4GW1A 5BRZD 1F3RB 4LHUD 3V4UL 1KCRH 4Z95H 2XWTB 3HC0A 3D3VB 3DNKA 3KGRA 4XHJD 5D7KD 3TESA 4XPFL 5JW5B 2YK1L 3IT8D 3C5ZB 2BSTB 2WUCH 1U8MA 5SWZA 2ICCA 4U2YA 5DO2C 3JUYA 2W1NA 1EVTC 3PP4H 3F5WA 2DAVA 5GS0H 2Z93A 4YH6A 5FK9A 3BEWB 5A2FA 3LIZL 1PY4A 4PJIB 5DD6B 5KG9A 3RVVC 1MCKA 3CDCA 1I9IH 1IGJB 2W38A 2UVEA 2P5EA 3LKSA 2W0FB 1ZHLB 4MNQD 4LLWB 4OIBA 1OAQL 1MWAH 2A6KB 1FH5L 2DLHA 1A7QL 1EGJH 5DTFB 3CMOH 2VDOH 1OGAA 4ALAL 2IG2H 4X7EC 1JWUB 3FQTB 5HJ3A 5M7QA 5D93C 3IFLH 1M7IB 1EO7A 3VDBA 2P8MB 3KLAA 3QUMH 2F9BT 1JNLL 4FQXC 4OD2A 2RAMA 4FQIL 1A2YB 4P5TC 4JFDB 1DVFD 3JV5A 5FYJH 2ZUWA 2MCPH 5JHDE 1FFRA 1MLCB 3ULVF 2V5SA 3RAJL 1KJMB 5DK2B 5FOJA 1JGDB 2BNRA 1VESA 4N0UE 1EBAA 4NQEB 1DDHA 5M95B 1IQDB 2JJUA 1P4BL 5TDNA 4HIJB 1EZVY 1CDJA 2EEAA 2EIBA 2EDYA 5FDWB 1WBXB 5HHMD 3CNKA 3VFSA 3C8HA 1A1MA 5DQ9B 3U0PA 1B4RA 2ZNWA 4GRLB 2CKBH 4QTHA 5JUEL 5D2NE 3TPUA 4F8TA 5CGYD 1CD0A 1EX0A 4LLUB 5DC4B 1UT9A 4XAWL 4R7DA 3KXFD 1PKQB 5ACLA 1KB9J 1SBSH 4K8RC 4Y5YC 5EWIL 1RAMA 1EDQA 4S1RH 1DL7H 4BH8B 3SN6N 1DBAL 3OKOB 4K3JL 2VKWA 43CAB 3HB3D 1OY3B 3MJ7B 5CD3A 4G80A 3T04D 4LSRL 3QP3A 4LVHB 3U46A 5SX4I 4LVNC 4P9MH 4LU5H 3LHPH 3R8QA 4M6AA 3WYRA 2BERA 2YPKB 3LB6D 3S34H 2YN5A 1IT9L 3MRMA 1XEDA 2O61B 5IB1A 3S88H 5BRZB 3RFZC 4NHCH 3E6FB 4E41A 5D5MF 4I2XA 4J12A 4U1GC 5T3ZL 3SCMD 3CSYA 4MJ4A 2GT9A 4YXHL 1J8HA 2ZCHL 4G7VL 4V2CB 2E9IA 4DW2L 4WO4C 1KJ2L 2XPGA 2PXYD 5AZ2H 5TQ2L 4WV1C 5DR5L 3L7EB 4UUJB 4ZOEA 5E5MA 5CMAB 4ONFH 4L4TB 4LLMA 2QHRH 5JDSA 5D70L 3SDDC 4YBQD 4X6BA 1AE6L 3GRWA 3AGVA 1CLZH 2FD6L 2R4RL 1ZK9A 2VXQL 4G9FD 1XH3A 2IFGA 3MRJB 2HJLB 1YPZB 1A7OH 3BEVA 2Q20A 4R90H 1U92A 2VSDA 1T1XA 4HWUA 5GGRY 1YEGL 5FM5M 2R23A 4NHUB 2GSIB 4M1CC 2DLIA 3HE7D 3DV6B 4MNQB 5EU3A 3BPOB 5KW9H 3ULUD 2ICWB 4L3EA 3O4OB 2D9CA 3HUJF 5DVMA 5JR1H 5EOTB 1A3QA 5HHVL 2J88L 4OF6A 5DK0A 3UBXI 5CZVL 3KPNA 5C70A 4JVWA 4KHXL 1DVFB 3HZYA 3I75B 5SWSD 4XC1H 3V6OE 1ACZA 2BRRL 1I8MB 5DJ8A 3BKJH 3OPZH 5HGAB 3O3EB 4JM2D 3GB7B 2V9RA 3T3ME 4NKIH 1FSKC 3IKCA 2NXZC 2EIDA 3MNVB 1LO4H 5HHMB 5I66A 2ATKA 3QWOB 1RPQA 1RU9L 4WFHE 1K8DB 5D72H 2GITA 2CMRH 5DQJB 3KXFB 5DI8B 1BD2A 5ADOL 5KAQF 5D7IA 1IJ9A 3QAZB 1U93A 4HKXA 4I1NB 3SQBA 2VIRA 1PG7X 3H42H 3H9ZA 1I3GH 3AREA 3F12A 5ANME 3RI5K 1KJ3L 2D31B 3M8OL 4PY8J 1I1AC 2DQJL 5DMGD 4G7YH 4U1MB 5D1ZD 1FG9C 5K93A 5E2TH 1KLFA 5DHYA 1U8IB 3SJVA 3BKCH 4N8VA 1J1XL 3RBGA 3FRUB 4JFPB 3SCMB 5C0NC 1TJIL 5EORL 1SM3L 4TVPL 4PJCB 1XCTB 2CDEB 2PXYB 2P8LA 4IRJC 5J1SC 3EFFA 3IDYC 3MUZ1 2ITCA 5J11B 3RZCB 1FE8L 43C9B 3IDGB 3U4BH 2MQ3A 3GGWB 5DRWA 3BW9B 3HPLB 2G5RA 1KPRA 5C0GB 1CQYA 1RY7B 1ACYH 1M71A 3KYOB 1CK0H 1MEXL 1GHFL 1S7UA 1U2CA 1LEIB 4LRIA 1OAKL 4NPYA 2HLAB 1J9CT 5BQ7B 4BYHA 4G9FB 5FYKH 1MJ7H 3OJDA 5EO0B 5J1TC 3RDTC 1WC7A 4OZGA 2DYPD 1OLZA 4YNYA 2DIBA 4YHIB 1YMHB 3KYKH 1G7JA 3LKQB 5GGRB 1NCUA 3HE7B 1ZE3C 3FQWB 4QHNB 4X6DF 5GGQL 1X7QB 3VGEA 3WFHB 4AIZA 3OXRA 3WHE1 4AEHL 5TFSH 4QHKJ 3FOMA 3SE4A 4G8FB 2BP3A 2R1YB 1I9EA 3AUVA 1SY6L 3MO1B 3EYOB 3H2WA 4LVOC 1W72H 1YUHA 4HH8A 4L9DA 2PO6C 3KPTA 1Q9OB 1CICB 1K2DB 3BPCB 4TSBH 2XA8L 3MV8E 1U58B 1WTGT 4PYHA 3BZEA 4L9LC 1G9MH 2FWOA 4YAQB 2FRGP 3MLVL 1CFNA 1LE5A 2GCYA 4YHOH 3HCVA 4HJ0D 2IJ0C 4WI4A 5ECJE 1HH9B 1FNLA 3VGAB 4OV5B 1RZGA 3JVGC 4PJGF 4ZUWA 2VZ3A 1CFQA 3F7PC 1KIQB 1ZHBB 2JCCE 5E70A 1NCCH 4LLVA 3NCMA 4MVBC 4WTZG 3ZDZE 5MENB 5L9DL 1MCDA 1NMAH 3QIBA 2IPUG 3CXHK 4EDWL 3P73B 1DQDH 5E1AA 2YSSB 1QLEH 1JUFB 2FX8H 4N5UA 5EO1B 2OS7A 4CW1B 4N0FA 1J0JA 1QHOA 4XP4H 1ODAA 5A43C 5DVNA 1ERNA 2OJZH 4HWNA 4OT1H 3FONB 2NLJA 2OL3L 4LSPH 1FNSL 1MJ8L 4R4BB 2GIYA 2VB5A 4HS8L 1KPVA 3QI9C 1KCVL 1MIMH 4M7KH 4XPBL 3TCLA 1MIEH 4ZOBA 1TTFA 3BDYL 4OLWH 1P4LA 3PGDA 1UGNA 1KJ2A 4NSKA 1FYTD 2AI0H 5FYJE 3L5WB 5F7LB 4GW5B 1J0HA 1NCWH 1P9MA 1NC4D 2JLLA 1RVFL 2HJKA 3QIUC 3T1WA 5DEFA 3X14A 2PTVA 5ELIA 3HG1D 5DYOA 4HBQA 5FCUL 3MLYL 4HXAH 2G2RA 5BMFL 4TSCH 5TPWL 4NCC1 3EJYC 3BWUC 5DVOA 1FHGA 4XPTH 2VH5H 1QHPA 1CGYA 2DYPB 5IFHL 1MCWM 4JDVB 2J5LB 2E9BA 3QDGA 1KCLA 2ZKHH 3P4LA 3MLXH 4XP1L 5EZOH 1BJ1H 2I07B 2LQRA 4QXWA 1KGCD 3GMRB 1A7PL 5KJRL 2EIZA 3JTTA 1RFDL 4OIIL 5D1XC 5HVHC 2EH8H 2D9QB 4AT6A 1F4YL 3BAEL 1SYVB 3CVHH 3STLB 4MCYB 2EDJA 4QHUA 3H3PH 2AXFA 3MJ9L 5HDBE 1WGOA 5CEZH 3DPBA 4NUGH 5JW4Q 4FZ8L 2M8XA 3S96B 1TFHA 3A6CL 3AB0B 3GIVB 2KQNA 4YX2L 5KVEL 3CFIC 1UXWA 4GW4A 2XKNA 4KI5E 2UVFA 5HD8C 4HUWB 3F7VA 3PUCA 1UCTA 3FHQA 1F13A 3OKLB 2XNAB 4JN2B 1CD9B 3GI9H 5EC2B 3EGSB 1BLNA 1X5KA 4NCC2 4EVNA 2GJZB 4R26L 5CSGA 5KSUA 3TYGL 1NL0H 3VH8G 1AGEB 3JTSA 4S2SA 3WLWC 4NRZB 3BQUC 1MJUH 3RVXD 5FIEA 1XGPB 2CXKA 4ZPTA 1GJIA 1OT1A 3PWVB 4L3AA 3UTTD 1EHLH 2ESVD 1B0RB 2YD1A 4UDUB 3ZZ1A 4YUEL 1C1EH 2LU7A 4K7PY 3LKOA 2AXJA 3QQNA 2FECL 1G9NL 1S5IL 5SWZD 1E0OB 2VKXA 3SBWA 2Q3AA 3GMQB 4JRYA 5LG1A 3U7AA 3ARVA 3MRIB 3HNTH 3ZSSA 3LEXB 2W9EL 2KH2B 5B39A 3QBTB 5KZCB 3F7RA 5F6IB 4ISVA 2NY7L 1A3RL 4PJ8D 1A14L 4OV6F 3VFOB 1QOKA 1FYTB 5I1CL 3PE9A 4QCIB 4WWKA 4YR6B 1HILA 4IHOB 4YDVA 4CKVX 3E2HB 1RUPL 4NO3A 4NFBA 1OTUC 2P5ED 5JOFB 3QJFB 1KIPB 2AK4D 2OP4L 2BVPA 3HG1B 4KQ3L 1BX2A 2K9UA 3WIFB 3DSFH 4BSJA 3MV7E 2WUBH 4XTRD 2B4CL 3H7BA 1CG9B 1JWMA 4NBXB 5GJSL 1JPSH 5EB9A 1OGAD 5HHOA 3OAZH 2GYSA 3ARQA 1NFIB 2FJFA 2XA3A 4TULL 4PV9B 1GGTA 2NW3B 4KH2A 5I9QB 1V7MH 2NR6C 1D5MA 3L95A 2BK8A 2C3GA 1G7QB 5MI0B 5IBUG 5IG7A 2G5BB 3OSKA 5CJQL 2FH8A 3GHBL 3TNMB 3RWDB 1I7UA 4CGTA 1FJ1A 4XZUB 1JYWA 1A6TA 1Z3GL 3NFNB 1SY6A 5DGQA 1HHIB 4MS8D 3LRHA 4BSWA 2EXWD 1DQLH 5I17B 4L8CB 2VZSA 5ENWA 1DE4B 2UZXB 3K46A 2F15A 3SQOH 1IFHH 5GRUL 3I6LD 5AG9A 1QSFA 4BK5A 2PYFB 2AABL 4HF5L 1JIBA 4QRRD 1D6VL 1KJVA 1MCHA 2CIKA 3TH3T 1LO3H 1TJGL 3NVQA 1F6LL 3D25A 3IJYA 1J8KA 3O0RL 4DK3A 4OCNC 5F9WB 2YEZA 3NABH 3QNZA 4PGEA 2UY7A 3MJGX 5J8OA 4H1LH 4NKOB 1BQHA 3W82A 5HBBA 1AXSB 2Y25A 4WEBL 5LWYL 4P46A 1HKLL 1ZMYA 4G42A 1DLFL 3BIKB 2GHWB 4OUOA 2AJUH 1A7RH 4Z7UB 3FHAA 2WBWB 4UV7L 2P8PA 4GJTB 4KJPC 5ESQA 5GGUB 2AJYH 3HAEA 3UTTB 4OGZA 4A2MA 4WU5A 2ESVB 2YD7A 4O2FB 4QWWD 3VXSD 2VL5B 1B6UA 2OL3A 2YD2A 1EHNA 1CDHA 3PWLB 5SWZB 3T0BA 3DHMA 3IB4A 3B4NA 3F5WB 3SDAC 2F8OA 4ZFZA 1IAMA 5HYJE 1SBBA 2JELH 3DBXA 2Q8BL 4JB9L 2MCG1 1LQSR 1NUGA 2C1PB 4PJ8B 1DBMH 3P9MA 3T08A 5CJOH 1FZMB 4ZTOL 3RX5A 1FN4A 2BFVH 5CWSA 1CXKA 3I9GL 3LQAL 1A6UL 2P5EB 5FOBB 1SVCP 1IEBA 3DHJA 2AK4B 4R96A 2OI9B 1WISA 3N1QC 4U6HA 2YPLE 4LNRB 5D1QA 4OGXL 3Q6GL 4TUOA 3T2NH 3LSOB 5DD0L 3BD5A 4L3ED 1OAUL 1HOCB 3G6JB 1MFDH 1AI1L 3D9AL 4Y7MA 2IGFH 4JFOB 1MHCA 1D6EB 4NWUL 1N2RB 3X3FL 4DN4L 5CKAA 4BELD 5TE4H 3Q1SH 4QF1A 4JJ5A 3QJHA 4X83A 4GG8A 3T0DA 4KVCH 2Q1EA 5AD0A 4KROC 4M9OA 5I71C 3D85A 4WW1A 5GGSA 4MA1C 5HYSG 2F8VA 4ZOAA 1ZEAH 1TJHH 1S5HA 1UVQA 1YEEH 3I6GA 4PYGA 5F7MC 4WJ5A 4DZ8A 1QFPA 3EO0A 4XPGL 1A4JA 1N0XL 2ZJSL 3MJ9A 4ODSH 1A1MB 2EDHA 1Q8MA 4GS7C 4WW2C 4LNVA 4BFEA 4L5FL 5IOPB 3W0WA 4AQ1B 1T0NB 2P1YA 4PRHD 2DQUL 3HMXL 4QRRB 5ALCH 1AC6A 4I18A 4YXLH 4M93B 5ICZB 5CINL 3B2UC 3FB6A 3IF1B 4KK8D 1IEAA 3RVTD 1J1OH 3VXOA 5F21B 4IS6B 3S35H 4K8RD 5BV7C 3G08B 4JY6A 4Q0XL 4PJBF 5DFWH 1OQOA 1SQ2N 5HDQH 4OUUA 1J0IA 2EE9A 4J6RL 3NZHL 4PJFB 3SGDI 1HIML 3L5HA 2ZG1A 5JXEC 4YXKL 2OXHA 4P5KA 1RZ8B 2R8SL 4WHDA 4IIQB 1FAKT 1MLBB 1YYMH 4I2XB 4K3HA 1T89C 1S7WA 3AY4A 4P5MA 1F3DH 2ENYA 1JGLL 2VUYA 2ID5A 4HBCL 3TBTA 1EO8L 1Z2KA 1RIUL 1HCVA 3ZLQC 2P42B 1K5NA 1I7ZA 3GJFA 4U0RC 3VXSB 2YPVL 3EFDH 2FEEL 3CMGA 3KS0J 3ZTNL 2AJVH 3PGCA 3WSQL 2COQA 5IB5A 1KNOB 4KU1A 2ZCLL 3ARFA 3DX7A 5CEZE 1I85C 1GGCL 4X0KA 4HFWA 3U9PL 3BRDA 5C0BE 2I5YL 1G7MB 1T1XB 4KUCD 5C08D 5KVDH 3O6FC 3L3JA 2X70B 1HSBA 1QKZL 3IKKA 2AJXH 2VABA 3RX8A 4UT6H 2J8UE 2X4RA 3DYPA 1MFCH 3TIEB 5DF0A 5DK0B 5E9DA 4LAQH 5EDXA 4I9WE 1WZ1H 2DBLL 2VE6A 4U05A 3NCJH 4EJ1C 5E94A 2YA2A 3QT2A 3HZYB 1UXSB 2WWMC 5LXGL 5KN5B 2F53E 3TLRA 4OD3H 2ADJB 3PGFL 2CJUH 3GM0A 5J13C 3KWWB 1CBVL 4H20H 1NCAL 2OBGA 5EIVA 4U7MA 1T04B 4MAYA 3U4AA 4PTUB 3IKCB 5DS8B 1EAJA 1FNHA 2IBBA 2V17L 4ZO6A 4QRPA 1S7RA 1CGTA 1CFSB 4P48A 2A6IA 3GJEA 2DQCL 5IVXB 2GITB 1EUTA 3O3UN 4CMHC 1AXTL 4WNQB 3UJJH 1NKOA 1NAMB 4PRHB 4NNXA 1B90A 2CK0L 3HFMH 1MRFL 3SGEI 5KS9E 4ODXB 4AEIL 4HKXB 4NQCD 2VIRB 4HK3N 3PWUA 2P5WE 3MLSH 4H8WC 4Y8AA 3SDXA 1F4WL 3K74B 1HQRB 4OFVA 2IBZY 3CZJA 4OLXH 4U1KB 4YDLB 3ROOB 4JG1H 1EHAA 3MMEB 4LVNB 4NQSB 4X7TA 5HPMA 2QQLH 3CSGA 4TQEH 3U4EA 5I1HL 4N1HB 2YD8A 3MODH 5J1AB 1YEFH 5D8JL 2H26B 2HT4D 3MGOB 3LEYL 4PJ7B 2E7LC 3VFTB 3MLRH 2XY2A 3C6LD 1CF8H 3JWOC 2HVKA 3ARYA 1MCSA 3ARSA 4ZFOB 3RNQA 1WWBX 5ISZD 4TTDD 4AMKH 3MLUL 3QEHA 1MRDL 4HGMA 1AQKL 1YMME 5ESVA 1GPOL 4JZJC 4OLYL 4M6OH 1FGVH 5JIPA 4YNYB 3SDDB 1VFUA 3IXTB 5C08B 1G7JB 3UP1A 4GH7B 1KENL 5IWLA 4IOFD 1T66C 3TT1H 4QXTB 4JFFA 1R5WA 4HKBA 3IU4L 4JKPH 1WCBB 4PREB 5GRJH 1V3MA 3C8KA 4WFED 3T4YA 2QKIB 3FOMB 4X9GA 5IHZA 5C7XL 3ZYIA 3BGFC 4MJID 3V6BR 4M6NH 1FYHB 3CU1A 5TF1H 4OZHF 1SJVA 1BFOA 1H3GA 1Q1JL 3P0VH 5DSCB 1BOGA 2Q7YB 3CPLB 4FFWC 1P84K 2AV7B 5IK3B 3MRGB 4HWZA 2B1AH 3U0WL 4OZ4A 1IC4H 4AK1A 3RPIA 4ZS7H 4LMQI 2PO6D 4LGPB 1MQKL 1BIIB 1KCSH 2Z31C 4P57A 5EN2A 3UDWC 4G6JH 1RZGB 3N06B 4AYFA 4UU9A 5DUML 5H2BB 4KHTL 1A6VL 1MSPA 1QLFA 3QO1A 3TJHD 1FSKB 4LEXH 2I9TB 1IM3A 4HWBL 1OAXL 3HMXA 1N8ZA 4PRIE 4Z7VB 2DN7A 2XWBA 4NQCB 15C8L 1CZ8L 3AROA 3EDFA 4LMQE 1YNLL 4Q9CA 2LTQB 4JG0H 3OG4B 3MBXH 1AQDA 2F5BH 4X8XA 1JPFA 3NGBB 2GW5A 3VXRE 5FXCH 5DRXA 2ICEA 4HH9A 4ZAKC 1U6AH 4PJHA 1R3KA 5I18L 1E4XL 3ULUH 2EYTB 3FFCA 5DZOA 3TYFA 3KPPB 1EJOH 3B6SB 3MUGA 5DVLA 3EYFB 1FVCA 3LAFA 4TVPD 4HT1L 3PGDB 1K4CA 2EDBA 1UWEH 3B2VL 1UB6A 4I0PC 4LCWD 4PJEB 3C6LB 3WJLA 3EIFA 3CFEB 3Q5TA 5FB8A 2JB6A 25C8L 4NKDB 3H0TB 5DUBA 5EBWB 3AFLA 3GUTB 4ZXBD 3D3VE 3PL6C 1NKRA 3FT4A 3RWGB 1RULH 5ISZB 3ULVC 5HHPA 4PRPA 4NUJB 1OCWL 2GFBB 4DKDC 4J8RA 5DA4A 1HQ4B 4YIQB 3MRHA 5HHOD 1KIUA 2NNAB 4KKBD 3RL1A 2CR3A 3O8XA 5CUSH 5K9KB 2Q7NA 4F33B 3QIUD 3NTCL 1FLRH 2RFXA 2F54A 4JHWL 2R1XA 1V3KA 5FKPA 2YUZA 1NC2A 3DTXB 4PJIE 5I8CA 2LE9A 2EH7H 3I3DA 4OIAA 5ICYA 5C09B 3WKMH 4GKNB 2VNCA 4NDMB 3MC0A 4MJIB 4QRQA 3A6BL 5LGHH 3U1SH 3HI6L 3QULA 4HK3J 2J12B 5J56B 3QWRD 3FZUC 1RSFA 4BM7A 2AXFB 1OSPL 4W4NA 5TQ0H 1OW0C 1CFTA 4HIIA 4P2YA 2APBA 2HP4A 4KAQL 4Y5VA 4F7TA 2AXGB 1QSFD 4D8PB 1EEZA 3C87A 1LO2H 3PWPD 3MYJB 2PO6B 3FB5B 2ZNXA 4GW4B 4DQOH 3GSWA 3CH1A 1NCBL 5D9SA 4JFDE 1VPOH 3F7VB 1E6OL 3L9RB 5E4EB 4LQFL 2CIIA 4RGNC 1QPPA 5F1OB 3WFCH 4F57L 1MPAL 3VXPA 3L3IB 3EOAB 4GG6F 4JFEB 1YQVH 4KMLB 2A0LC 4NQEE 1KOAA 1H3PL 2I9LA 5GRXG 4RGOL 4P46D 3JTSB 2RB8A 4HC1L 4LEOA 3UTPD 3FO2A 3ABZA 5T1DL 4PGZA 5EOCL 3WFBH 1RZ7L 4HQQH 4MQ7A 5JHDA 1KCRL 1D5IH 2X4SB 2OSLB 3RHWF 3VFNA 4G5ZH 1CGXA 5EIIB 1DCLA 1PKQE 4MJ5A 2UWEE 2HTKD 1I3VA 3LKOB 4EUPB 2DTSA 3VXNA 2X1PA 2WUCL 2K3TA 5GS0L 3CXHJ 5BV7H 5I1JL 3MTRA 5D2NA 2UUDH 3ARDC 5CD5C 3QYCA 1D5BA 5CZXC 3VFMB 3X12A 2X4OB 5F1IA 5CFHA 4HX1A 4LCWB 5HI5D 4P4KD 5BRZE 3E6HB 3O3DB 1I9IL 4X6CF 3GSVA 3WIHL 3ARXA 4ZXBB 1K8IA 2OZ4H 1Q0XH 3AREC 1ZHNA 5D1QD 4KTEH 5C71A 4B5EA 1NFDE 3FT2A 4F8QA 5D7KE 3D0VA 4GAYB 3S37H 4PRNB 1XR9B 2XFXA 1EGJL 2LAAA 3P77A 2ICWI 5A16A 1PKOA 2VDOL 3QIUB 4PG2A 2X1WL 5IF0B 1OSZB 2NZIA 4WTZA 32C2A 3TNNB 2HVJA 3I02B 4BZ2H 1QD0A 3C5JB 1VERA 3AM8A 4U1HB 4XVSH 3GIZL 4P2CG 1CU4L 3T77B 1GCFA 3TBSA 4V2BA 5T5NG 1YPZE 4MD5A 4JPVH 1OP3H 2DQEH 1UM4L 3FJTA 4DUXA 5DWUH 1A6TB 4RFNB 2Y6SC 1G7IB 4YZFE 1R0AL 1WFTA 4MNQE 4LRIC 3VI4F 4GRMA 2V5MA 5DD1H 2VR4A 4PPTA 5HVHB 5CSZA 4M1DH 4H0HB 3B5TA 3NCYS 4H0IA 3U2SB 2AXHA 2NY6C 2CKBL 4GAJL 3BPLC 3E3QC 4X5XB 1KIRB 3PWPB 2EE3A 3LKPB 1RZFL 1NCTA 4M48L 3UPAA 3PHQA 3W11D 3G6AB 2BC4B 2A38A 3VG9C 1NQBA 2CUHA 4MAUH 5DFVC 3T8XB 1JK8A 5MEQA 4LSVL 4PRDA 3EO9L 1ORQA 1U8NA 3QNZB 2RGSA 4XMLH 4NNYB 2C3XA 3V5DB 4LU5L 4NM8L 3KPRD 3LHPL 4MMZC 4HWBA 5BVPH 1R3JB 3GSOB 1U8PA 3K8KA 5HHME 4K9EL 3TGXA 4MCZB 4HLJA 3X11A 2JKXA 4JZOA 3T1FB 2F5AH 3V6OA 4EDXA 2X05A 4YPGA 3L3HA 3R1GH 4KTDH 3KXFE 4QXGH 4WU5B 1A47A 1DTUA 4PJAF 3TA3A 3BQUB 3LV3B 4FQLL 4YGVB 3OB8A 5I8EA 1YEKH 3CVIL 3W2DH 4ONFL 1JGEA 2MPAL 1KTKE 4H25A 4H8WH 2E27H 1OVZA 5MP6L 4U1JA 3SOBL 1S8DB 1A3LL 4PJXA 1U3HC 2ZOLA 4WCYL 2WW8A 1KYOK 4KTYA 5C6TH 4GLRH 3QIBC 1FN4B 4Z7WE 1AJ7H 1FFOA 1T4KA 1T2XA 2J8OA 3C6SB 4XMKH 5CJXA 4P4KB 4OI8A 1U8JA 3G5XB 4CVZA 3CFCH 4JFXA 2XZAH 3RZWA 1JF1B 1IEBB 4R90L 1BAFL 5D6CB 3IU3A 2AJ3B 2VJXA 1HSAA 4FFVC 4HGWB 4U6HB 1WFNA 5CJ8A 3WS6A 4LSDA 1FV1B 5F9JA 1P5UA 3QRGL 3KHOA 4PJCE 2PW1A 5B8CA 3GBNH 1QLRA 3RWJB 3BVNA 3L3KA 4MA3A 4MNHB 1V05A 4M02A 2Q76B 4HJGB 2DWDB 5GIRA 4BZ1H 2IAND 3QJHB 4GG8B 3NFPA 4KKLD 4DK6A 1HYRC 1BQLH 5IB4A 3VH8A 3U7WL 3IFPA 5DJDA 4G9FE 5A3IC 2H1PH 1RUAH 1SJEA 3KYMB 4GKSA 2NY5H 1QA9B 3QNYA 3BP7A 1S5HB 4ZFGH 2ZSVA 1KTDA 2ZP0T 3BKJL 1RHFA 4IRSC 2JK5B 1EH9A 4QLRA 3T09A 4M43L 5LAXB 5F3BA 1T1WA 5ID1B 4NZTH 1A5FH 2VLJD 4QRPD 3ULUE 5CSBA 1IM9D 3V0WH 3PWJA 1VFMA 2X4UB 4L8DA 1FL5A 1INEH 2C3WA 4LCUB 1DN0B 4NKQB 1I1YB 1X5JA 2A77H 4ELKB 5I76A 3QG6B 5IW1A 3VFPA 5SWSE 1QQDA 2WK2A 5JIIA 2Y4SA 5ESAA 3VXOB 5JORB 2JCCF 3QUXA 4JY6B 4UIMB 3KPRB 4HHAB 1EXUA 1MY5A 4NN7B 5C0IA 4NC1C 4OUUB 3JV4B 1XR8B 1O7SA 4X8JB 5L88H 2Y5TA 4M4PA 4I3GA 4OB5H 4HC1A 1TZGL 4G7YL 1I3RB 1NGWB 2ZPKH 3ILQD 2AQ2A 3H3BC 3O41A 1QBLL 2ERJB 4MSWA 3MV8A 1UWXK 3IFOA 1UG9A 2J4WL 2NY1D 4OLUH 4XBGB 1QR4A 1JN6A 2L0DA 3QFDB 3QNXB 4JO3L 1S9VA 1BMGA 3HZKA 4JREC 3BSZH 5C1MB 1JNJA 3U4BL 2XZCL 1G0YR 3PGCB 1UKSA 4WEUD 1F11A 4D94A 4FG6C 1Y0LB 1S7VA 3SGJA 4K71B 3HE6C 2A6JB 3SDAB 4GRWH 4XNYL 1PZUB 2V7NB 3VWJD 1HHJA 3T65B 5FA3A 3WIHA 2GI7A 3NN8B 5L0QB 5MEOA 2VABB 3KYKL 1BBDH 2IH3A 2WIIB 1C5CH 4HV8A 2X4RB 4TNWK 4CVXB 1W0WA 5TFSL 4ETQA 2GKIA 3NCCB 2YHGA 3O6FD 4L4VD 4RMSA 4XNXH 4Z5RB 4ZUTA 2ED7A 3SBWC 1L9NA 4NO2B 3SKOA 2W07A 4LCIH 4IM8A 4F9LA 5CBAB 4JRXD 2IANB 4FABL 3VD4A 3BMVA 1Z5LA 1W72L 4HUMB 2QSVA 5MHSD 1W8NA 4JCLA 4L8BA 2C4FT 2DQHL 3MFFB 4HMEA 5SV4A 4TSBL 2NY4D 4DGVL 4WWKC 4UINH 3V7AE 3P4MB 3FOLB 3UZVB 4XWGH 4RBPH 2E6PA 3WXWH 3QXAA 4YHOL 2I26N 5E00B 5E5RB 4OD1H 5HDBF 5D96C 2PNDA 2VLJB 2NY0C 4MA1B 3B8SA 3QDMB 1J0YA 1IM9B 2FL5B 4NNPH 4DVBB 3QQ4B 3TH4T 3QWQB 1DUYA 4WWID 4XCNA 2CKBA 3EOBA 4XX1E 5D7SH 1DEEB 4HXBH 1NCCL 2ZOKB 2V5RA 3GRWH 2BHUA 5LGJB 4KI5F 3VXTB 1G6RB 4XVJH 3BWAB 3HPJB 4WW2B 1U8KA 1DQDL 3MUY1 1QLEL 3OF6D 2FX8L 2F58L 5BOPA 3DLQR 3OAYH 3U9UA 1WTLA 5GZNC 5F9OH 3BXNA 4HUXB 3UJIH 4LPCA 2Q6WA 4EN3A 1IAOB 1MI5D 2AEPL 4OT1L 2OJZL 2FLRT 1QFWI 1OL0A 1UB5B 4KKAD 4LSPL 3FFCD 3ZO0A 4KJQD 2XQBH 5BVJB 1YNKL 2VXTH 2JB5H 4XMPH 2F74A 2V5TA 2NY1B 1MIML 5CLWA 2FO4B 1IL1B 2YZ8A 1NSNL 1MJJB 2AI0L 1KELL 3P9LB 1T5WA 1QEWB 1NCWL 4JQVA 5HYSA 5AZEH 1A7NH 3C9NA 5D6DA 2FGWH 5HHXH 1T2JA 4PRPD 5IVZB 4U0RB 5JHLH 5E4IA 1JI1A 2PUQT 3Q5YA 5C0JA 4TSCL 5JPMB 3VWJB 2F54D 2VH5L 2IF7A 3DETD 5C0AA 4IRZL 5EZIH 2X2YA 1IC7L 3OAZK 2ZKHL 3NBNA 2C7UA 2NZ9C 1R5WB 3MLXL 3EYQD 4K3DL 1BPVA 2CRIA 4OSUL 3EO1A 4Y4FA 3ZE2E 3N1PC 5GRVK 1NAMH 5I0DA 3MACL 1FYTE 3RL2A 3O6FB 4L4VB 1CGWA 3RUGA 2DIJA 1NH6A 4JY4B 1ZVYA 4NO5A 2EH8L 1BFOB 4JFYA 4JRXB 1RURH 3HG1E 4AIOA 4GXUM 3MBEA 1BOGB 4ZUSB 2NCMA 4Q9QH 4YGAB 1OGTA 1VHPA 4NUGL 2NY4B 3U0TB 2HRPH 2IQAA 5DJAA 5SWQA 4Y88A 1X5IA 1VB9A 1A64A 1A6AA 5EN2B 1L4IA 4TOYH 1CL7I 5F96H 5ICXA 1KGCE 3MV7A 4XPFH 5J13B 2YK1H 3QO1B 2Z31D 1UENA 3IJSA 3BUYB 4HK0A 3DURA 5FYLD 4HIEB 2D7QA 1E28A 4QOKD 1N8ZB 4O51A 1CFVH 5DEZA 3BIBX 3B3IB 5F89A 4HPOL 3MGTA 1VFAB 4E0RB 5JW3L 4G6AD 1AQDB 5M94B 5DRXB 2ICEB 4GSDL 3CLEH 1MI5B 4UDTB 2Z35B 3F62A 4OGAD 1OAQH 1C1EL 3HMWH 5HGDA 3FFCB 1FH5H 1UWGH 1YDPB 3ZHKA 2ZZUT 1BGXH 1LK3H 1QP1A 1VACA 4HKJA 4ALAH 3MUGB 5KVFH 3R06A 4ZAKD 3VXMD 1PBYA 4B0MM 1JNLH 1UB6B 4I18C 5EUOA 2JB6B 4WFFD 1RZKH 5J7CC 3LEVH 4Z7UE 3RAJH 1CDGA 1ND0B 1S78D 1R5IA 2LVEA 4PRPB 3UTTE 4X9HA 2ESVE 4YHZH 1JYXA 4CVWA 2WUBL 1P4BH 4ZDHA 5SWZE 5IESL 1LILA 2F54B 3HR5B 1YECL 5KSAD 4ELMF 3ULVD 3BZFA 5KVGL 5JUEH 1NEZB 2P7TB 1LP9F 3V7AG 1FIEA 1D3CA 2R29L 3OQ3B 4HFUH 3C5SA 1G9EA 3L3OA 5DXWA 3KLHC 3N85L 4QGYA 4YQXL 3JWNC 1YEIL 2A83A 3FQRA 2WANA 1G9NC 1OP9A 4BSVB 2P5EE 2VC2L 4LSRH 4BQ9A 2H8PA 1AGBB 2AK4E 1BQSA 4RMWA 4YEFA 3CJJA 5HYJA 2K7QA 5FYJU 3ARFC 1W72A 5IMOB 3EYSH 4JO4H 1IT9H 1KLUB 2CLVA 4M61B 3G6JE 1DQLL 4C83B 1ORSB 1OGAE 3C60D 2YD3A 1YN7A 3PXJA 1IFHL 2PCPB 1F00I 1CD1B 3LY6A 4PJDB 4LSQL 4YXHH 4ODUA 3SO3C 3MRQA 4EI5C 5D9SB 4G7VH 1D5XA 4DW2H 3K4AA 2YPLA 3ZKNC 4XCFH 1LO3L 4XNQA 3MUJA 5DR5H 2B4CC 3FB8B 4PP2B 3VXPB 1T2QH 2D7TL 1P84J 2Z31B 2IWGA 5CBEA 4LPVA 2I9LB 1E4JA 1AE6H 2IPKB 3N1GC 2XTJC 2FD6H 2R4RH 4QOKB 4B50A 5IP4A 3MRKB 4D9RD 6CGTA 4G3YH 4RAUA 4ENEC 5D7JA 3VJ6A 2B5IB 3I6LE 1ZT7B 4ODWA 4ZFFB 5EBMB 5ETUA 4FXGA 4UAOB 4MJ5B 4MAYC 1RJLA 1PLGL 5EIQA 3TA3D 3GMPA 4QRRE 2BJMH 3PP3H 5IQ9B 1PFCA 1B4JH 4QRSB 1KF9B 2VZ1A 4LCCA 1I1FA 1P5VA 4GOSA 3KPOB 4FQ1L 4TNWF 2R2EB 3V2AR 5TGBB 1P4IH 4ZAKB 1D5BB 3VXMB 4I77L 3X12B 3N1FC 4PJFE 4POZC 5HVFB 1MH5A 3LQZA 5I2IB 1DBML 4J3TA 1CDBA 5CJOL 2HH0L 2LVCA 4KHXH 3MRLB 1OTTD 1KT2A 2XXMB 4HGKC 4CNIB 4I2XE 1GSMA 1K8IB 1LD9B 1ZHNB 2BRRH 4MX7A 4WY7L 1AGDB 4Y19D 1OTSC 4P59H 4I0PB 2ZUUA 3T2NL 3QQ9D 1LE9A 1JI2A 2YC1A 3VXSE 1JE6A 2ZG3A 3IYLW 3D39D 1JMXA 4RQQB 4OFPA 1B9ZA 3PL6B 5KSAB 4LSSL 2HYMA 1ZT1A 2VTFA 3E8UL 3TWCL 1RZJH 5DJXB 3BHBA 2CLRA 2H3NA 4F2MB 3VMNA 2J8UF 4IBLT 4TNVK 3BPNC 4KVCL 1WWWX 5ADOH 1IAKB 1U3YA 1H3WM 2WLZA 4PG9A 1M6OA 4KZDL 1ZEAL 4RFOH 1H8NA 1TJHL 4N8PA 5J57B 5C07D 4UQ3A 2Y9RT 1S9WA 1KJ3H 1FCGA 3OKEA 4ODSL 3M8OH 4L3EE 3CFBA 5F1NA 5JOEA 5JQ6L 4EUPH 3QUZC 1DBBL 3C60B 3MRCB 1TNNA 5IBLC 5C0BA 5FECA 5F71A 3RWCB 2NXYC 1ETZB 3LQAC 1J1XH 2VDNH 3VGFA 5ID0B 3UCRA 4U1IB 1TJIH 5EORH 3BMWA 3MLTA 5C8JB 1SM3H 4TVPH 3M17A 5F7NC 4K7PX 3DO7B 4Q9RL 3BDXA 2UV3A 1U8NB 3VD7A 1XGRA 3U36A 1ED3B 3RIFK 4NYLB 5KSBF 3CDGA 1J1OL 2OQJA 3WDIA 5C0DA 4ZPVA 1MEXH 3OKMA 4YDJB 5HDQL 2VO5A 1OAKH 4UNVA 5F93C 4RGNB 2CO7B 5CEXA 5C92A 1YYML 3W9DA 2F53A 5IVXE 4LLQB 3VGHA 4HG4K 4YPGB 5IVOA 2FJGA 3WEXA 2X4PA 1SHMA 3AAZB 3DUSA 5DT1H 1BF8A 2FIRT 1CQKA 4PJ9A 4PRHE 1L6ZA 3TA3B 2A6DB 4J3VA 4G6KH 4RWYH 4AEHH 4U6YA 3P4OA 4MZ3A 3ALWA 4P2QD 5BW7A 2AJVL 1WBYA 5JPNB 4JHAL 3TBVB 3UBXB 4JKWA 3S7GA 1SY6H 3BI9X 3F7YA 3V5KB 2KBGA 2O5YL 1T4KB 5FUOH 3SKJH 2KPNA 3U82B 2XI9A 3UTQB 5DRZB 2WBJA 5KS9A 2XA8H 3HUJB 3CFJA 5D7LD 3ARDB 5KVDL 1U3HD 3B9KD 1LDSA 2P5WA 4M6MH 4XI5D 3MLVH 4Y19B 1I8KA 5FYKU 3MRBA 4N1CA 2X5PA 4PJ7E 4MA3B 3RTQA 4E42B 3TM6A 1HN1A 1GOHA 1AO7D 2PYEB 3D39B 4P2OD 2RIKA 1EFXB 1D7FA 5GIRB 4HUUB 2A73A 4N9GB 1CE6A 5DZNA 5L9DH 4ODTH 1CXHA 1MCWW 2NY3D 1RK1A 1N26A 5AUMB 4GKSB 4O2CA 1O5DT 5CHNB 5EU5A 1FNFA 1PEZA 4OD3L 5C08E 1FC1A 2Y36H 5C07B 3IGAA 4PY7B 3ARBA 3U48A 2QADC 5LJYH 1YMMA 3IVKA 1MFAL 1FZJA 1MFEL 4Y16D 3V4VL 4QT5B 4XP9L 1MJ8H 1JJUA 1U3ZA 3O8XC 2Y7QB 1FFPB 1FVEB 3TVMA 4HS8H 4L29A 4WEMB 1HZHH 1NBZB 1KCVH 1X5HA 3WD5L 2QBWA 4HMCA 4EBQL 3HFML 3TZVD 4ACPA 5GJTL 3ARGA 1JF5A 3UYRH 4M8VA 3BPLB 4FXKA 3VW3H 1GZPA 1U8QB 4MJ6B 3RPKA 4KZEL 2QR0A 5J9PA 2DIAA 4Y4HA 4IEFB 4IOSD 1RVFH 5E6IC 4YHYC 5JLZB 2Y5TB 1H5BC 1C16A 4OLXL 3D5OF 3MLYH 4UTBH 5BMFH 2ATPB 1SJHA 3REWA 4QXUL 5DDHA 1AD9A 1RJYA 2HAZA 2OTWB 4OCYH 5BS0D 3LMJH 4YBLB 4PTTA 5IFHH 3X3GL 4TQEL 2B1HL 4Y5VC 4FOMA 2HJFA 3O4LB 3FQXB 4HJJL 4YFLI 2A9ML 3FB7B 4W6YB 3RWFA 3OR7A 4XP1H 2VR9A 4Z78A 4PJ5A 5IT2H 3SE8L 1BVZA 1NBYA 1CF8L 3MROB 1A7PH 4NQCE 1ES0A 4OIIH 4P2QB 2UYLB 4A6YB 4LF3B 3JUZA 3G9VA 1F4YH 3EKCA 4S1DD 3NIFE 3MJ9H 4CMMA 4KGJA 3I85A 4X6DB 5C0AD 3DMMA 3S6CA 5GRYA 3QXDB 4FZ8H 2ZCKL 3NOIA 1S7SA 4PRIA 5D7LB 5HPOA 3UAJC 1ITCA 1U3HB 3B9KB 3QHTC 3I6KA 5F6HI 3TT1L 4HV8B 4YX2H 5KVEH 2ADGA 5GRJL 2FX9L 5ILTL 3VXRA 1BWWA 4PJEE 4QEGA 4FFYH 4OQ1A 1ZLWH 1AO7B 1G7LB 2JIXD 4P2OB 4WHCA 1KYOJ 1N7ML 3SKOB 2BCKA 1AKJA 2UY6A 3L3DB 3MBED 4PJIF 4R26H 1JZ6A 5E2WH 5ACZA 1NAKL 3TYGH 2NY3B 1YEHL 3RGVA 1Q9LA 2J8HA 4APQA 4KXZI 2B1AL 1BIHA 2D03H 4L3CB 2YD4A 3KPLA 3L6FA 1IC4L 2NW2B 4PJGB 3VI3F 1T20A 3K2MC 4HEPG 1JFQL 1KC5L 3DIFB 4CADB 3D3VA 4F7CB 1HINH 1TITA 3GJFH 4X6EB 4WFEE 4LSTL 4YUEH 4KV5E 4Y16B 5E2JA 3O9WD 1G9NH 4IRSB 2NTSP 3CC5B 4MXQD 4Q58C 5D4QA 5JW5A 4S1SH 3C5ZA 2BSTA 4MJIE 5J4MA 3SEPA 2FX7L 4PG2C 2YXMA 3VRLE 2W9EH 3BEWA 4BQ6A 2CQVA 2NY7H 1A3RH 1UH3A 3AM8C 4F9PA 1A14H 3TZVB 5GISH 5DD6A 3WLBB 3V0VB 1RUPH 1HCFX 5JZ7C 1LNUA 2HWZL 1IGJA 1EVUA 4XVTH 1IKNC 2W0FA 3B43A 2PETA 4L1DA 1ZHLA 3DWTA 2V5YA 4LLWA 3ULUL 2B4CH 4X80H 5GZND 1YY8B 3PABB 3J7HA 4AL8H 5DTFA 5BS0B 4Y1AD 1C7TA 4TULH 1EJOL 5C86A 4QHMB 5IKCB 1JWUA 2UWEF 5JW4N 1Q94A 1M7IA 3QPQD 2V7HB 2P8MA 5GS1C 1JTPA 2KDGA 1A2YA 4JFDA 5CJQH 4TNVF 1MLCA 1KJMA 1JGUH 1RULL 4JPWL 5DK2A 2X6MA 2APTA 1I8LA 1Z3GH 2IFFH 1IZJA 4NQEA 4NQUA 4GKOA 2IAMC 3VD3A 2YBRB 1IQDA 2V2XB 4HIJA 5CGTA 5FDWA 1WBXA 1MREH 5CUSL 1QSVA 5MERB 1A1OA 4NRYB 5DQ9A 5GRUH 4GRLA 4OLZH 3V6OC 2XZQL 3HE6B 1NFDF 4TVPE 4LLUA 1QPXA 3MGAA 2MHAB 2AABH 1G6RH 1PKQA 1MCOL 3BZDA 4LCWE 4BH8A 2JIXB 3OKOA 3MRFB 3B9EA 3IS0X 2B2XL 3O0RH 43CAA 3MJ7A 5E56A 3RNKB 3RY4A 3OKNB 5F9DC 3U1SL 1OP3K 4NZDA 3M1BA 3MBEB 4QRTB 1T21B 4OCRH 5EU7E 2X89D 1FBIL 2YPKA 2VZTA 3RIFF 5CCKL 4PRBB 3ALXA 5HHOE 1HKLH 3SDCC 1DLFH 2O61A 5CJXC 1FL3A 5DJCB 4J7RA 5BRZA 3PQYB 3WO4C 4WENB 4YZFF 4M3KB 2VERN 4UV7H 4F7MA 3E6FA 3N50A 4NQXB 2IBZX 3V6ZB 1YJDL 3U30C 2X4QA 4DQOL 5HI4C 4DGYL 2HLFC 4FMKA 4WTWA 3REVA 5TJWK 3AC0A 3O9WB 5ITFB 3L7EA 3ORJA 4UUJA 1XF5B 4F3FB 2DQTH 3WFCL 3O11B 5CMAA 4OCXL 1X3DA 1OAYL 3U6RB 4F7EB 1YQVL 4L4TA 2Q8BH 4HK0B 4TSAL 4WU7B 2NY0B 1M7DB 3DURB 4JO1L 4ZNEA 3LN5A 3ZTJG 5HI3C 3MSPA 4KKNA 4MDIB 3WFBL 2AV1B 5D7JD 3MRJA 4H0GA 3I9GH 2HJLA 1D5IL 1YPZA 2ADFH 1A6UH 1QSFE 2DD8H 2YZ1A 3PWPE 3FFDA 5GRZA 1OAZL 4NHUA 2GSIA 3EYVB 4OGXH 3V6FA 3DV6A 3RKDD 5DD0H 1OAUH 3CZFB 1AI1H 1X5LA 3D9AH 2ICWA 1PYWA 4JE4B 1DANU 4Y1AB 3LPFA 5EOTA 1ONQB 1INQB 3BYTA 5F88B 4DN4H 5JMRA 2ZUVA 5IB2A 3SE3A 4U1LB 5EUOB 1PQZB 2ORBL 3UO1H 3UTPE 4PP1D 2GEEA 1DVFA 1QG3A 3WNOA 2YD9A 5I1LA 3I75A 1R5IB 3CFDB 4HUNB 2OZ4L 1Q0XL 3QUXC 4FTVB 3O6MH 1I8MA 2IH1B 1Q9WB 5FV1L 3O3EA 3GB7A 3D18A 4Z7WF 4D0DB 1MCCA 1FIGL 1N0XH 1K4DA 3S37L 2ZJSH 4I5BB 3MV9D 5I1KL 1ZT4B 1YEDB 2X9XA 3QWOA 3NH7H 4LPWA 5BCAA 2R2BB 4L5FH 3C5SB 1UZ6E 4YWGL 4NN6C 2DICA 5CILH 5DQJA 3KXFA 1ZLVH 3HMXH 3GMNB 1XF4B 5DI8A 3B83A 3VGBA 1IGIL 5CINH 1X5ZA 1TPXC 3S97C 3BKYL 3E1F1 1LEGB 3ZYZA 5GS0C 3KLHD 4Q0XH 2OLDA 3VXQB 1J88A 1U3JA 4XVUD 3B5GA 4J6RH 3NZHH 3DX9B 3SGJC 1QFWL 1HIMH 1QSZA 5DEGB 3C09B 4YXKH 1E27B 3NCEB 2R8SH 1T0MA 1YN7B 4F15C 1T83A 3QCVL 5FDYA 4U1MA 3IXAA 5FM4A 1MUJB 3WNLA 1U8IA 2HFTA 3MRQB 1JGLH 3HNSH 5L2KD 2EDWA 1CIUA 3FRUA 4JFPA 4HBCH 3MRRB 1EO8H 1LEKB 3A67L 3ULUF 5HGHB 5JDJA 4MAUL 4PJCA 4DOHB 4XNQB 1XCTA 1AHWC 3KPQB 2CDEA 2PXYA 3GFUA 3MCLL 3QO0B 3F6LA 3RZCA 43C9A 1FAIL 3IDGA 4G8GD 1FC2D 4EXPX 3ZTNH 3GGWA 2RHEA 2QQNH 1EMTH 3BW9A 3FN3A 3HPLA 1U41A 4MNGA 4R4NC 5DJYB 5C0GA 4EI5D 1ZWIA 3KYOA 5HDLA 2ARJA 2Z92A 2ZCLH 4CU6A 1LEIA 2HLAA 3PG2A 5BQ7A 2APXA 4G9FA 1PSKH 2ED8A 2I5YH 5EO0A 2JTDA 4JM2F 1R3HB 1ZA6B 2LV4A 2OYPA 4MQXC 3R1GL 4NC2B 1YMHA 4QXGL 1QKZH 1I8IB 1D9KC 4HULB 3LKQA 3LRSB 5GGRA 3HE7A 3ZKXC 3AVEA 3FQWA 4LCCB 4QHNA 3WFHA 1X7QA 2PR4L 3QR2A 1JNNL 4P2RD 1KEMH 4EUPG 2C3VB 4G8FA 4N0YH 1XF2A 2R1YA 1OARH 3KPRE 1PEWA 5HYIA 2DF3A 4XGZB 1UFUA 2DBLH 3EYOA 5C6TL 4KK6C 4WI8A 5IFJB 1AJ7L 3DYMA 2HTLC 4HAGA 4ZS6D 1Q9OA 1CICA 1K2DA 3BPCA 2XZAL 1SMAA 1QBML 3PGFH 4MX7B 1U58A 1DBJH 5IIEB 4YAQA 3MXWL 4EN3C 5L7XL 4TTGA 1CL7L 1EPFA 4KK9D 4MB4A 2H9GB 3GBNL 5GPRA 2V17H 3MV9B 4RGMB 5F44A 3BN9D 1HH9A 4K9EC 3UYPA 1E6JL 3BDBA 4OV5A 3BP6B 2UZYB 2X4NB 3FCTB 2DQCH 3KNBB 2H3NB 2VITB 1AXTH 3TN0C 1ZHBA 4RX4A 1BQLL 2FEDD 5MENA 1U8HB 1PG7H 4WGVB 5FYLH 4ZNCD 4UOJA 2H1PL 4KI5C 1UACL 3F58H 3P73A 2NY5L 4JQVC 2MJWA 2YSSA 3CU7A 1JUFA 2VUOA 4ZFGL 5EO1A 5D6DC 1F4WH 2VR5A 4CW1A 4BFIB 1VCAA 4Z7NF 3OKEB 3GNMH 1XGTB 4HLZG 1A5FL 5F1NB 3UTSD 4YHML 5D2LF 3FONA 3BE1L 4I3SH 1MY7A 4W6WB 3TVMD 1INEL 5FECB 4QYOB 5F6HJ 5K9OB 4UNUA 4K7PL 2L4OA 1FVDB 2B0SH 4GFTB 3IETB 4OZFG 5I1HH 4R4BA 2IANE 5L2KB 5A1AA 1CIDA 1YY9D 5D8JH 4Y4FC 5I8OL 2A77L 2RBLA 3LEYH 1HK6A 4B53A 1HHGA 1ZKAA 3T0ED 1WAAA 3L5WA 4HUKB 1NGXB 5DLML 4G8GB 3HS0B 2D7OA 3SO3B 4EI5B 4S0TD 3MUHL 2AGJH 3T0VA 3MLUH 1MRDH 5F1KC 1AQKH 4GT7A 1OP5H 4XH2B 5L88L 1GPOH 4OLYH 2XQYK 2VLJE 4QRPE 2DBJA 4ORGB 3W9DB 4K07A 3AMK