4D8PA

Structural and functional studies of the trans-encoded hla-dq2.3 (dqa1*03:01/dqb1*02:01) molecule
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
184
structure length
184
Chain Sequence
DIVADHVASYGVNLYQSYGPSGQYSHEFDGDEEFYVDLERKETVWQLPLFRRFRRFDPQFALTNIAVLKHNLNIVIKRSNSTAATNEVPEVTVFSKSPVTLGQPNTLICLVDNIFPPVVNITWLSNGHSVTEGVSETSFLSKSDHSFFKISYLTFLPSADEIYDCKVEHWGLDEPLLKHWEPEI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Immune system
molecule keywords HLA-DQA1 protein
publication title Structural and functional studies of trans-encoded HLA-DQ2.3 (DQA1*03:01/DQB1*02:01) protein molecule
pubmed doi rcsb
source organism Homo sapiens
total genus 35
structure length 184
sequence length 184
chains with identical sequence C
ec nomenclature
pdb deposition date 2012-01-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00993 MHC_II_alpha Class II histocompatibility antigen, alpha domain
A PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4d8pA02
3.10.320.10 Alpha Beta Roll Class II Histocompatibility Antigen, M Beta Chain; Chain B, domain 1 Class II Histocompatibility Antigen, M Beta Chain; Chain B, domain 1 4d8pA01
4U1KA 5HYFA 3IDGA 5IJKA 3MBEB 1CQKA 4HKJB 4KUZL 2IF7A 3OG6B 3SDXA 3G6AB 3WFCH 3IFOB 4HKBB 5ITBH 35C8L 1NC4A 5DD1L 4FOMA 5D1ZC 1KG0B 3CDGA 1YNTB 2DF3A 5ESQB 1CLZL 2YPVH 1EERB 4D9RD 2IQAA 3GSVB 3MRMA 1NPUA 4X7TB 2NQCA 1CFTA 1I8KB 3SOBH 5L88H 1NJ9B 4R2GC 4ZODA 1JK8B 3QXVA 4ZTOL 1KJ2L 3SDXF 1NAKL 3ZDXF 1G7MB 3WXVH 3SDCA 5F7EH 3L3DA 3CPLB 2AQ3A 3VXSA 1ORQA 1L9NA 5IHUH 1XMWA 2AJSH 4R97C 5ISZA 3S96B 2ESVB 3IVKA 1QSFD 1P4LA 4Z76B 1AJ7L 2Q86A 4YDVA 5DT1H 1HCFX 3GMMA 3S3SA 1T1WB 3I3DA 2G9HA 2ZNWA 1B0GB 3EOBB 4KDTC 1WFUA 1LVEA 2IBZY 3PWPE 4RAVA 1U3HB 2HLAA 3CVHH 2CMRL 1JGEA 3NVQA 3ARFA 2VDQL 2GIYA 5DMIL 4QRUA 4JZNB 3O3UN 1WCBB 4JO1L 5C0AD 5IESL 5C2BL 5I1HL 1FVDA 3KWWA 2NTFB 5LCVH 3F7PC 1D6VL 5T5NF 3W9EB 1T7YA 2R2HA 2A9NH 2DIJA 2UUDH 3A67H 2DQIL 4XVUD 1FL5B 2VN4A 1CG9A 2W91A 5CBEB 3SKOB 3BWUC 5F1NB 4HC1L 2BFVH 3TO4D 3OXSA 4Z0XB 5I73C 3FAWA 4KROD 3WIIL 5FXCH 3GKWH 4ZUWB 5GRJH 3SDDC 5I74B 1N5AA 2EO1A 4ALAL 5C0NC 4GKZB 5B38A 1FJ1A 4CL7A 2XWBB 5IKCA 1P9MA 3BW9B 1UB5B 4LCIL 3EYOA 1MFEH 1I1FB 1KPRA 3FOMB 2WNGA 5IJKC 4KRLB 3RIFF 1S9VB 3G04A 4HWZA 5CGTA 4P46D 4LKXA 3X14B 4ELMF 1F4YH 5A2JH 3EO1A 4HUMB 2X4NA 1UXSB 3D85A 5D9SA 4EI5D 1IMHC 1W8NA 3V8OA 1RUAL 4PRIE 1UM5H 4ZXBB 3LIZL 5DEZA 2C9AA 1M71B 3MNWA 1K5NA 2XWTA 5EORH 4X6BB 2EDOA 1S7SA 5EN2B 4M93B 1IC7H 1INDH 1QRNB 3C08L 2IAMB 1SHMA 2CRZA 1Z0NA 3OKEA 5A16B 1UZ8A 1EJOL 2WWMD 1DL7L 3CCHA 1QVOA 5IVOA 1TCRB 2ARJQ 2Q8AH 1E4WH 3SDCC 3DVNA 1NGPH 3L6FA 4V2BA 1YMMB 3ISWA 1OSZA 4XPGL 3BPLB 3MRHA 4C54A 4MJID 3GNML 3B8SA 2YK1H 4QOKE 4MYWB 5SV4A 1UM4L 1MHPH 2VDKH 5EIIA 4KJPD 2VMFA 2P46B 4YUEL 2BCKA 1OM3H 4WY7L 4J8RB 5JXEA 3B2UD 4U7KA 3CK0L 3S6CA 4R26H 2W0FA 2ADIB 3DMMB 3HMXL 4LIQL 1QA9B 5AUMA 5K93A 4PRIA 5DJ2B 4BQCA 2DQGH 5IEHB 1QKZL 3DGGA 3IRPX 5I1CL 3TFKC 1EVTC 3BP6B 1F97A 4MCYA 1A9EA 4TSAL 3LN5B 1JGUL 4YHLH 4D9LL 4MA3B 3C09B 3MZTA 1KIQA 2F54B 4HFUL 1TTUA 1EH9A 3RVWC 2VDMH 3KYNB 3FRUA 1T1XA 3QUMH 3BZ4A 2QSCL 2X1QA 5EO1A 4MJ2A 2X4TA 1VERA 3VFSA 4M6AA 1A4JA 4U1IA 4AMKH 3LOWA 5TE6L 1FNGB 4N5ED 3FN0L 1H5BA 4NO3B 4ZSOE 3QEGH 1T22B 4HZLA 2OM5A 2AK4D 4QOKA 2GQHA 1AO7D 1IM9B 2FATH 3KPQA 4KMTL 1BMGA 3X13B 1C16B 2CDGB 1JPSH 3RZCA 4YXKL 2FH6A 1QLRB 2KH2B 5AWNH 2R9HC 4J3WA 1N0XL 3CFBA 4I3RH 4NQSB 3S5LG 4HWBA 1HNGA 5HJ3A 2WK2A 3ARDA 4XHJC 3P4NB 5I30L 1A47A 4U3HA 2ZSVB 4DK3A 3CLEH 3T65B 4OT1L 2KUTA 4ZUSB 3U1SL 1BBJB 1VFBB 2A1WH 2Y36L 2I9LA 2Z91A 5FOBB 2VLLB 4U6HB 1NC2A 5I71C 1CGVA 3TWCL 5FA3B 3BT2H 4O9HH 2AJ3A 2GFBA 3DVFA 5BXFA 2FL5A 1BFVL 1EHNA 4G6AD 4JM2F 4ONHB 5C9JA 1T83C 1VACB 1AQKL 2PF6A 1HHIB 4ZSOA 5F9OL 4XP1H 5I1DA 2XZAL 4JHAH 1RIHL 2FBOJ 4KY1H 4JN2B 4IJ3B 1A7QL 3G5ZB 4XAWH 1FRGH 4PJEF 4MA8L 2NCMA 4WI3A 1OARH 4GLRI 3IAPA 4MSWB 1IGYA 3MFFB 5HGAB 5D6DC 1ACYL 2X4OB 3VH8B 3KHQA 2NXZD 3BIKB 4WNQB 3MOAL 5E5UB 5MERA 2RHEA 1N8ZA 4I77H 4POZC 2QKIB 4Y2DC 2VXTL 1RZJH 3D2UD 4G8GB 3ELAT 5LGHH 1R3LB 2Z9TA 2VDLL 5MP6L 5CEZL 1F2QA 1HHGA 1HXYA 4FQQB 3RWGB 1AHWC 1FPTH 3R0MA 5CILL 2NZIA 5HDBE 5SX5K 4OLVL 5D71L 1V7ML 3ZKNC 5IHZB 5JMOC 3CFCH 4R2GB 2HRPH 1I9IL 2XIDA 4LU5L 2J7LA 4M7KL 2A0LC 1RZKH 3WUWA 1U3JA 3QIUB 2PUQT 3PF2A 4AENA 2X7LB 3T1FB 1LP9A 2ICWA 2X6MA 1T03H 1GCFA 2E7CA 2IH3B 3W39A 4YGAB 3EZ8A 3RZCC 3H3PH 2EDLA 1DQJB 2VIRA 1DANT 2YUZA 3E6HA 1Y18B 3N9GH 4R4FH 3HE6A 4KH2A 1SYSB 3MZGB 5I19L 3BHBB 4Q9QH 1LEKB 5L0QC 5M95B 5J0BA 2P8MA 2BSTB 3PP4H 2CJUL 2QL1A 4XTRD 4X6EA 1UG9A 2FGWL 2UZIL 2JJSC 4JM2C 4X7FC 4QY8A 3F5WB 5JHLH 3WIHA 4LLDB 1ITBB 2Q76A 3A6BH 3DV6B 3MRGB 1LO4H 2D03H 3OJ2C 4L29B 3S4SA 3MRFA 2DQTH 3TT3H 4D9RE 5J6GA 4GAJL 3CH1B 1MH5A 1I8IA 2CPCA 1PAMA 1T3FB 1KPUB 4YIQA 1ULVA 4EN3A 1LEIA 3P3YA 1EDQA 1TJIL 4GRMB 4JKWA 5JW3L 1QP1A 1WF5A 3DUUA 3LKQA 4G43B 2AJXH 1T66C 3EBAA 3EDEA 5F9WB 5IG7A 4RIRB 3WNKA 5J8OA 4XBGA 2AI0H 1J1XL 5DR5L 4PJAE 1XIWC 4IRJA 4C55A 3CNKA 3I6GA 3G5XA 2R56L 3VWKB 1PSKL 5HDBF 2VDPH 5ICXA 3ARXA 4H8WC 2EZ0D 4K3JH 3WLWC 3CDFA 4GRLD 3GBNH 3FRPA 4MA7L 4MDIA 5IWLA 5E00B 7CGTA 1VCAA 1KLUB 5TFSL 4NN6B 3REVB 5IFJB 1B4RA 1XGYL 2OR7A 4HIXL 5HI5D 2N7AA 2P4AB 3DHMA 5I1IH 1LO5B 1VGKA 5CIPB 4ZYKB 1AP2B 5H35B 5C0AE 3QG7H 2Z31D 5T5FL 1AR1C 1I4FB 3BEVB 5FYKD 2Q7YB 3NAAH 4HUUB 2B39A 1UB6A 1JBJA 5D7LB 4U0QB 4FQXC 4L4VB 4OZIF 3ULVF 3MLXH 4UB0L 1D5MB 5C09D 4U1HA 4YDIH 4JJ5B 3TN0B 4JO2L 4KHXL 1ADQH 3B3IA 3IS1X 5T33H 2PYFA 1QSFA 4D3CL 3RKDC 3LQAC 3MRPB 3TPUB 4J3TA 3QDGD 1FLRL 1Q38A 2X4SB 1HSAA 3G9VA 4YQXL 5I8CA 4OZFH 5T3XD 3QCUH 5E6IB 4GAFB 4Y4HD 5A2IH 4BK4A 1OAQH 3FONA 2F19L 3T2NL 5D7SL 1YJDH 1Z5LB 1II4E 3B9DA 4Y16B 4JRYB 32C2B 4PJAF 1FZMB 2BOCB 1LO2L 1XF1A 5FGRA 5C0AA 1JWSB 4YXHH 1SMAA 5DJZB 2WINA 1ZLWK 1V3LA 3FT2A 4TNWK 3OAUL 2APFA 3DROB 1U92A 2OR9H 4QXTB 1S7WB 4HX1A 3WN5A 2RCSH 3ZDZE 1L7TL 4XC3L 1BGXH 3TO4A 3QEQB 4MDJB 1EMTL 4G6JH 3P73B 4XCYB 1XGPB 2FIKA 2ORBL 2Y5EA 3MGTB 3GMRB 4HG4K 5I17B 3V0WH 3I02B 1ZHNA 4LCYA 1QD0A 1JNNH 4TOYH 1A7PL 3PDDA 4OFPA 1L0XA 1RZIB 4UT6H 1KEMH 2J88L 5EWIH 4TVPD 1XR8A 4X9HA 3BD5A 4H20L 2AXGA 1N4XH 2N7BA 3GMLA 5FGCE 3GUTA 1A2YB 4FQ1H 4NRXA 3ULVC 4P46A 1JNHB 4D0CB 1TVBA 2B1HH 2X4UA 1AQDB 5ID1A 4RRPG 4EI5A 1P7HL 1GGYA 5SWQA 1QZ1A 5DJ8B 5E2WH 2ZUXA 1I1AB 3HFML 3L1OH 1YMHB 1W0VA 2VLKB 2ADGB 3PABB 5E7BA 5F96L 2KBGA 2IADA 3VXQB 4RBPH 1DQQA 2HKFH 4UAOB 1PD6A 5F7UA 4X5XB 2XN9B 4KDWA 3DIFA 4K7FA 1IGFH 2L4OA 5D2NA 2NW2B 2R2CA 5ICZA 1GIGL 5EO0B 4LVEA 2VUYA 1FV1B 1DBKH 1AC6A 3BI9X 3JV0A 4MJIA 4Z77A 5JTWA 3DUSA 1EUTA 4YBQD 5IBLD 5ANME 3OMZA 2X41A 1IEAA 3IB4A 4CN1A 1AO7E 3I85A 3T8XA 4CN6A 1F6AA 1I85C 1WQVT 3SQOL 1OB1B 4HJGA 4YK4B 3OKNA 4JFED 1U36A 3NGBC 3PDGA 3ZDZF 4J1UB 4MJ6B 3HC3L 3STZA 1J5OH 4WFHD 4LLWB 3WCYA 4M5ZL 4S1RH 4KKAD 3W0WB 3U2SB 4KZDL 3TO2B 4OCYH 1D6EB 1KXQE 1EFXD 4PREA 4S0TD 1RV6X 5CSZA 3HPJB 3G6JE 1CGUA 1UWGL 1T1ZB 1A6AA 5DRXA 4ZFZA 5E24E 3CVHA 3S97C 4RWYL 3BWAA 1HE7A 5IQ7H 1JTTA 4P9HL 3GO1H 4Y2DB 3BGMA 3WHE0 3BOVA 4KRNA 1N5YH 1UH2A 2XQYG 3B2VL 2VL5B 3WN5C 2YHGA 5DK2A 2VXUH 3S5LA 1B9ZA 3TIDA 2J6EL 1MFCL 4NQED 4OLYH 2N1KA 4P59L 5DSCA 1IKNC 3VFPA 1A02N 2IPUK 1A7NL 1I7ZB 1HXMB 3BSZH 4IDLA 2EDBA 3VGGA 4P2RB 5IW6A 3B9AA 4S1DD 5ANMA 2AK4A 4IIQA 4BZYA 5FUOH 4DUXA 3MGOB 1AO7A 4GKOA 1YPZE 3T0ED 4O58H 4S1QL 2XZZA 3MRNB 1AH1A 3WNNA 3QO0B 2DQUH 3M1BA 1N0LA 4ZFOL 4DW2H 5DS8B 3UAJC 4O02H 1CICD 4YWGH 4LRNL 3SE9L 1S7XA 5B8CB 3EDKA 4X8JB 4EEEA 1FIEA 3HI1A 3SJVD 4HEPG 4YHZL 3HRZA 1R3KA 2JJUA 2G5RA 1UA6L 1ZHLA 3QEUB 1TZHA 3O3AB 3PQYB 2J1KA 1FORL 3WL9B 1JN6A 3MACH 3I6LD 2QSVA 2BNRB 3MCG1 3UZQA 5F1SA 5BV7B 3K80A 3BRFA 3BKJL 4I4WA 2B20A 3TZVD 4LLMB 2YRPA 3EFDH 3G6JF 2CO7B 4EDWH 2EYTA 4FQLL 3TPKA 2WUBL 1J1PL 2H9GB 3LQMA 4CMHB 5HD8D 3O4OB 4ZD3L 4APQD 2NY2D 1T5XA 3OAZK 4MVBC 1JZ3A 4X4ZA 4XNQA 1KTLB 3B2UC 3LQZA 2RFXA 3IU3A 4N9GB 4QHUA 1LGVA 4IOIA 1OQXA 4ZUUA 1FFNA 3QQ4B 4PTUB 5TQ0L 4Z7NE 2ICES 4PJ5B 1FNSL 4HG4J 4RA3A 3M17A 5JIPA 1QFHA 1L0YA 2A6KA 1WTGT 1UWXK 3PWNA 3CVIL 3GRWH 3FN9A 4KVCH 4DVBB 4GG8A 3D2UA 1AGEA 1F4WH 2P48B 2DQHH 1YPZF 1BF2A 4OB5H 3HC4L 2Z8RA 1RJCA 2JELL 3QNXB 1ZGLP 3RZWA 4WTZA 3B83A 3HNVH 3IFPB 1XH3B 2BHUA 3DRTB 3SGDI 2AGJH 3HLAA 5I8KL 2BVOA 2D0FA 5E99H 5KVMC 2CUHA 4RZCB 1U8OB 4FQXB 5TE7L 1DBMH 1IGTA 1G7LA 4YHML 2NPLX 1CCZA 3HNTH 5GRWA 3VI4F 3HZYA 3SE4C 1QLFB 2MNUA 1BQHB 5JHDD 2R1YA 3QUMA 3VDBA 4Q58C 5J1TC 4GMTL 4HH8A 4KI5D 4M8VA 2GITA 3SE8L 3UYRH 4LOUC 5FGBC 5F21B 5E8EB 5TPWL 1XGTA 2FHBA 5T3ZL 1PEZA 5GS0D 1MJ7H 3TA3B 3LEXB 1QG3A 2F53B 2KKQA 3C6SB 5T1LB 2Z93A 3O6MH 4FXGB 4H1LB 1VFUA 1ZGLB 2OS7A 4ZO9A 4V1DE 1JFQL 1BOGA 3GB7B 4AIXA 3BXNA 2HRLA 5DRWB 4FTVD 2VB5A 1KENH 2HVKA 4MMZC 3ZKQD 5FYKE 4DGIH 5IBUG 4ZS7H 5BV7L 4Z7NF 3V4UH 3H0TB 5FAAA 5CHNB 3TBSB 2CDEB 3VMOA 4KXZI 5EU5B 4G6AC 2HWZH 1T2QH 2JB6A 3ABZA 4N0FB 4XRCB 4IRSC 1VPOH 4ODTH 2AJZA 4PJ9B 1KC5H 1PG7X 5FKAA 1K8DB 3QDGE 5F88A 2NW3B 4WFFD 5LAXA 3QIBD 5KOMC 3RWDA 4GG6E 1HILB 2PW1A 2QR0A 3CZFA 2BY2A 4YR6A 3S35X 5JUEH 2JJTC 3QUKA 1BJ1H 2F58L 4GRLA 4MX7A 5I15L 3B5HA 3IETA 5K59E 3RI5F 3S36L 5KW9L 1OAYH 4CW1A 1P84K 1X5JA 3KJ4C 3BJ91 4LLYA 3WS6A 1J0HA 3QRFM 3UTSB 3MNZB 1H3XA 4RA0C 4YDKH 1KIRB 3NCBB 4JFXB 1I3UA 2Z31A 4U49A 2GJJA 4A2LA 2WWKO 4PRNB 1V05A 2YRZA 5EA0L 1UYWL 3ZTJG 1DVFD 1BAFH 2PTTB 3FB5B 3Q5OA 3UDWA 5HHVL 1EEUA 1U2HA 4U1LB 5C09A 3K7UA 5FECA 1BFOB 3BKYH 5DHVA 8FABB 1S7VB 5JPMA 5GIRA 1DBBL 3O8XC 2BVQB 4RISH 5TDNB 5GSVB 5EBMA 2E8ZA 4O4YL 2YUWA 1EEZA 2A6IB 2ATKA 2VDNL 1ETZA 5HGHA 3QDGA 4YC2B 5EBLA 2BNQB 1KCSL 2CO6B 1UCTA 3X12B 3OXRB 4G8FB 5K9JH 4GUPB 5K9OB 4HCRL 3O3BA 4TVPE 4GG6A 1F11A 3CXHK 1A3LH 2BMKB 2QHRH 2QQQA 3VXNA 4Y4HA 1QR1A 4NHUB 2NY1B 4XTRC 5FCUH 1FVCB 3LS4L 3BX7C 4Y5XC 1JGLH 1CDBA 2FR4A 2EDQA 4Y1AE 3ZSTA 4YX2H 3C6LB 4HPOL 3O2WH 5DO2C 3OKKA 2EXYD 1E0OB 4I0KA 4LNVA 3U7YL 4MB5A 4RGOL 1H8OA 2W92A 1G7IB 1P53A 3TESA 3PWVB 5F8QC 3LH2L 4FZ8L 3UBXG 4ACPA 5K59F 3FQWB 3NPZB 4DVRH 4XPTH 5DJ0A 3QA3A 3RDTC 1X5ZA 3RL2A 4PRHD 3RNKB 2OP4H 3TBYB 5DJXA 1Q9LB 4LSDA 2X4QB 3L5XL 5TJWK 1SEQH 5ERWB 2YPLE 4M43L 3H3BC 1F8TH 3GMPA 5GZNC 1TVHB 4WFHE 5GS3A 3MV9D 2ZSWA 3QG6A 3GMQA 5KVEL 1KFAL 2ENSA 5H2BB 2DD8L 2M8XA 1MELA 3WS6C 1UT9A 1WLHA 4PGDA 4PJXE 3TBTB 3ULUH 4HIEA 1D5ZA 5TE4H 2AABH 4FQIL 4LQ1A 4ZUTA 1R3JA 1OSPL 1GC1H 1RZJC 3BN9D 1ZK9A 3KPRB 1E28A 4HK0B 4JPIB 2NY0D 1IT9L 5DURB 1DUZB 5DQDH 3C5JA 4WV1A 3GDBA 1QOKA 4GW4B 1IAKA 1PY4A 4O5LH 1EV2E 4TQEL 2HFFB 2DL9A 4NQEE 2P5EB 5GRZA 3FTGA 4R0LB 3QFJE 3LDBC 4TTDD 1FSKC 3NCMA 3GBMH 3R1GH 3FB8A 4JG0H 1KLGB 3HI5H 5J56B 2ADFL 4TUOA 2FWOA 1RZKC 4QXGL 5D7IB 1J0YA 3T0EE 5ID0B 5ELIA 5GSRA 4JFEA 2Z8SA 5M94B 1PJ9A 2V2XB 3MREA 5DUML 5I75B 4XCNA 1HHKB 2V2TA 1U8PA 4NZRH 2Y5TB 4OZFA 1EFXA 1XCTA 1OCWH 3HE7D 4HS3A 4MJ4A 1INQB 5F71A 2EDHA 5C0JB 4KMQA 3B8YA 2GK0A 1NBVH 4AK1A 3E6FA 4U1SB 1FVEA 4PJXA 4C83A 4HF5L 4JN1H 5IMLB 3ZO0A 5C71A 2OQJA 3U9UA 2YZ8A 4RDQF 5EOQH 1NKOA 1DDHB 3VCLA 4XNYL 1NGYB 1G7QB 1NFDB 1YUHB 1Z2KA 1RUKL 4N68A 5FEBA 4OIBA 5F6IC 1JF1A 3IXTA 4L4TB 1LK2A 3QDMB 3W81A 1UVQB 4G5ZL 1R5IB 2CKBH 3HS0A 1JF5A 2NY4B 4NQEA 1RZFH 5HHOB 3DI2B 3PUCA 1AGCB 4YXLL 3BN3B 1SY6L 3T4YB 2VR9A 4PJXF 4CJ0A 1SQ2N 5GZOD 3AB0C 5DJYA 1T0NA 1KIPB 1XR9A 4LSTL 3LN4B 5D1QD 3T0EA 3IGAA 5D6CA 5B39B 4XPFL 4YDJA 3JWOL 3H9SD 1TXKA 4KK8C 1CICA 2OK0H 1A14L 2Y06H 3LV3A 1A6UH 3RPIB 4OI8A 3QBTB 2R1XB 4HWEL 2Q6WA 3P40A 2R0LL 3SJVA 5H8DA 3KXFE 1CFSB 2MQ0A 3WKNA 1IEBA 4PGJA 4D8PA 4LSPH 5J11B 5HGBA 5IGXH 5IJVA 4JEGB 1A1MB 4HH9A 3IFLL 5AG8A 4NZTH 1UACL 3L3JB 3TVMB 4OV5B 2DWEA 5FM4A 3MRRA 2F15A 5CJOH 3ULUD 1X7QB 5L2KD 3KNBB 3TZVA 2APVA 2DM2A 1G9NL 4OQTL 4MHHG 4EUPB 1Y6KR 3H3KA 2V17L 2GJ6B 4OD1L 1IGCH 3VXPA 5IBLC 3QHFH 1RZ7H 5GGQL 2C3VA 1X9QA 4F7EB 4APQA 4KI5E 1FYTB 1DCLA 4OJFH 3RRQA 4LSQL 1CLOH 1KB5H 2ERJC 1KN2L 2VLMD 1BOYA 2Z92B 4XPBL 2NY7L 5HBBA 3JV6A 4LPUA 4UNVA 1T2XA 2DBLH 1AGFA 5F3BB 5GPRA 4QHLA 4KKAC 5SWSB 4PGCA 5HYJD 2LE9A 3O3EA 4QNPE 1CLCA 5JZ7D 3V6ZA 2HT4D 1UXWA 5CD3B 4R8WL 2XG4A 3AAZA 1GPOL 1YJDC 3WDHA 3OB8A 3LKOA 2P8PB 3KJ4B 2ZCLH 5GJTL 1C7SA 3WIFB 5KS9E 3DHJA 1FZJA 1RU9L 2Z8VC 5F7MC 1A3RL 5HHMB 4OCMC 5ETUA 4RCAA 1CD8A 2PO6B 1CLYL 1JHKH 3MJGX 1H3UA 1NMCC 2NTSP 5HYSG 2QADD 4H5SB 5H94B 4JO3H 1IAOB 3NZ8A 3LRHA 2O61B 1U8NA 3JV5A 4F9LC 4MCZA 5ECJE 4Z7UB 4XMKH 5CGMA 5JHDA 1M7DB 1X5KA 4G9DA 2Y72A 1FZKA 4LSRL 2VUOA 5JQHC 3JTSA 3T0EC 1KTDA 4IMLA 4BZ1H 4Y4FB 3RWIB 3TNNB 4DOHE 3DETD 4WFFE 4LVOC 1JCKA 3OF6D 4XXCA 4QT5A 1J88A 2FX8L 4LMQI 2VTFA 4HXAH 4MB3A 1P2CA 4F57L 5IMOA 1E6OL 3K1DA 2B5IC 3HAEB 4DCQB 4EKXA 3RWJB 2E27H 1U8MA 4P9ML 2IALB 4JZJB 5M7QA 5E5MA 3WSQL 4KI5F 4LAQL 4FTVA 2R29L 5HHNB 2DMBA 3IDXL 4JG1H 1Z3GH 4OIIH 4X98A 3ZTNL 1TCMA 3LB6D 3A6OA 4M48L 3SY0A 3VH8G 1DTUA 1ODAA 3MRQB 4HD9A 3MGAA 5ABDE 3QJHB 4ZNEA 2ZOLA 3F65A 3EZJB 2K3TA 4QNPF 5DFTA 4JY6A 3BGFC 4IM8A 3OSKA 5E2VL 3MLUH 3U36B 4UDUA 1N6QH 2A9ML 1Q1JH 4HGMA 1RZGA 1E4JA 1TNMA 4P2QE 5F93C 4PB9H 1CIDA 1J0JA 3DVGA 2BP3A 5KS9F 4XP6L 2FBJH 3ARVA 1BD2D 1MREL 2P8LB 4I48A 5ESAA 3O6FC 5AD0A 1KPVB 3R8BB 3W82A 3QIBA 3G08B 2VLJD 4ODUB 1JGDB 2JB5L 1DJSA 3JTTA 1A7RH 1EX0A 5BVPH 3ARGB 4KRPD 4DN4L 3K1KC 1HSBA 5IIEB 3WFEH 1MEXH 4LHUG 2YKLL 4PRAB 3P11H 3FMGL 2EIEA 5EO9A 1ZA6B 4X7SL 2FX7H 4JLRA 3LD8C 5HGGS 2YMXH 4MD0A 3GRWA 3PGDB 4K23H 5CCKH 1QFUH 5EULV 1DVFA 1KULA 4PGEA 2VN7A 5FYJH 3BP5A 1MRFH 4UV7L 4FQJL 5F3HB 3A6CH 1V5JA 3GHEL 5JW4R 3ES6B 2XWJA 2LU7A 4PRHE 5ESVB 2J2ZA 4MJ5A 2QJDA 1FO0B 2BSRA 1CD1B 2HT2D 1DANU 3C2AH 3UBXA 2XTJE 4PG2A 1EGJA 4DUWA 4OF6A 3BQUB 3QUYB 4R4BA 3L7FA 5KN5A 3OKDB 3VFNA 1CF8H 3VI3F 2PR4H 4MNGB 2M26A 1EO8L 1U8QB 4NRZB 5FHAL 4Z5RA 3AUVA 5IMMA 2A73A 1S9YA 1U91B 5KVFL 3L5WA 2DMCA 1BBDH 5TDPB 1NDGB 4P23D 3O2VL 4O2FB 2FEEL 3N1MC 4CVXB 3JUYA 2XFXB 1WTLA 1GH7A 1FP5A 1Q0YH 3FB6A 3QXWA 4BQ9A 4Z78A 4S2SB 3FCTB 3QNYB 4HBCH 5C07E 4N0CD 5EOTB 15C8L 1OL0A 1MAML 1D9KD 4AEHH 3TC9A 2DQFA 1T21B 4PRHA 1QPXA 5HHXL 1YDPA 1HH9A 3KLHC 2QQKH 3ZHLA 4FQ2H 1S5IL 3TEUA 4P0DA 3QIBC 3STLB 3V7AE 1PG7H 3SDAB 3JSSA 3G5YA 3I50L 2GAZB 2NXYB 4JR9L 4B7IA 3GGWB 4ZS6D 1FH5H 2HA1A 5D2LB 4PR5A 3MV9A 1R0AL 4P4RA 4K8RD 5JORB 4HS8H 3ECBB 3ARBC 2YXFA 5TH2A 3BD4A 4PV9B 5BCAA 4M1CC 3UTTB 2R0WL 1CBVH 4F80A 3MCLL 3LZFL 3RIFK 4F7MA 5EFIB 2W9DL 3UJTH 3SDYL 3VW3L 1LNUB 5I66A 2EDTA 4YBHA 3LRSA 5IT2L 1FO0L 2AAVA 4C56D 1EXUB 1ZANH 3ALWA 1DQMH 5IB5A 2CDFA 3RWCA 2VDOL 5FYJD 1A1NA 3KLAA 4JPKH 4WW2A 1GGCH 1A7OL 2B2XH 3ZL4H 5F89A 3V4VL 1GSMA 2FECL 3MUGB 4PRBB 4RNRB 5EZIL 1KNOA 2VH5H 25C8L 3F8UB 3H9SE 3TCLB 1CFNB 5FO9B 2YC1A 1H15A 3B9KC 3IFNL 1ZT4A 3HE7A 3UTPE 4G6KL 5E6ZA 1QFOA 3CSYB 5CINL 2ZCHL 2ZUQC 3RP1A 4DN3L 1NSNH 2GEEA 5C2UB 4WW2F 2EXYC 4J3XA 2H3NB 2ZUSA 4OZGA 1TPXC 3V5DA 2F74A 1RZ8B 3MCKB 3O45B 3P4OB 4Z0BH 1FN4A 3KPMA 1NCBH 3CH8A 3ULUE 2XA8H 1LD9A 4XP4L 5EU6E 4M1DH 3VXTB 1TTFA 2EH8H 4G8EB 3AY4C 1JJUA 3HZKA 4RFNC 2BHYA 1MY7A 4JKLA 5KSAB 5FUZL 2HAZA 3PL6C 3MRCB 5AZEL 5DMGD 4R96A 1QO3B 2EDRA 2KL6A 3SKMB 2AKRB 1KT2B 2WMPA 1YN7A 5D1QA 3DX7A 2R69H 3GSNL 2XTJC 4HUVA 5EZOL 1EEYA 2VLME 4CN4A 5FKPB 3VFUA 3GMNB 3H9SA 4CDHA 2X9YA 3HG1B 5GGTL 2MQCA 5HYJE 2FNBA 1MWAL 1UH3A 4MA1B 4X99B 2X1PA 3ESUF 5FYLL 3QQ3B 4U6VL 1Y6MR 4PLJD 4X6DE 4YPGA 5CZXD 4MNQB 4UINH 4BKLA 3P77B 2HG5A 2EYSB 4LEOB 2YD9A 4JCLA 5F1IA 3NFNA 4AIOA 5LQBH 2E9WA 3VG9C 4KKCC 5E6YA 3O3DA 5GGVL 4WDIB 4GLRH 5L2KA 1NCAH 3QEHA 5J57B 5JLZA 4NQCD 4MQSB 4TTDC 5JQ6H 1PKQE 1PVHA 4D0BA 5SWZB 2HH0L 8CGTA 1P4IL 2W65B 3Q6GH 4OFVA 4WW2C 3BGFB 3VXOA 4D0DB 5JOFA 4KAQL 1HKLH 4RGMC 4ZPTA 1WZ1L 3DTXA 2EXWC 3ULUF 1LO0H 1NC4B 1YNKH 3O6FB 3RU8L 4DZ8A 5HYJA 1WZKA 5D7KD 1BVKB 4G80B 2EH7L 3UC0H 4NKQB 4Z7VA 3MRMB 2GCYA 3FOLB 4X6DA 2BERA 5L9DL 1I3VA 4D2NA 4JHBA 3QAZB 3FQUA 3BUTA 5C1MB 5E5RB 4ODBD 1BJ8A 1XF3A 3VXSB 5FO8A 5C0BB 1M6OA 4NJAL 5DJAA 5ISZB 3IVKB 2XQBH 1QFWL 3O6KL 1HCVA 3VFGL 2Q87A 4OGYL 1CU4L 4GW1A 4X6DF 5EIVA 1W8OA 1U95B 3PJSA 4KMLB 4PS4L 1BFTA 3LVEA 5F7DA 3IXAA 5D1QC 2G2RB 4YJZL 1T89C 5IV2A 1J0IA 1MFAH 1TETH 3U0TB 2HLAB 4L8SC 4WUUD 4JY4A 1JGEB 1Q9OA 3ARFB 3HZMA 3OF6A 1DUYA 3D48R 4Q6IC 1E4KC 1MCRA 4ZO8A 4NKOA 4QRUB 1CFQB 1MQ8A 4S1SL 5E4EB 2OL3H 3MJ9H 2XRAH 4OCWH 2RAMA 2Z0BA 3KWWB 1VKXA 4U1JB 4LL9A 2R2HB 3N85L 1Q72H 4RAHA 3UTQA 1B6UA 1CZ8L 1CG9B 4OLUH 4U6XA 4X4ME 3E8UL 2ITDB 3V0AC 4ETQA 5D72L 3AREC 4NQVA 3DNKA 4N8CH 5T1DH 3IJHA 4OCSL 3ULUC 3TP4A 2I25N 1WIUA 5INDB 4P4KD 2E3VA 4UILL 1A6WL 2PXYD 1S3KL 3L3IA 1GC1C 1N5AB 5IB1A 4URTB 2B1AH 2EDEA 2UYLA 4NCC2 3U4BL 4D9QE 2PW2A 5IKCB 4JPWL 4PV8A 3WNMA 2Z35A 2XNAA 3DYPA 2GSGA 3HZVB 4XMLL 5TDOB 4QEGA 1JV5B 2B0SL 5LWYH 3G04B 1BD2A 1OTSD 5IB4A 1JGVH 1LO3L 1ZT7A 2WLZA 3FQNB 2JTDA 2VLJA 2D31A 2EEAA 3MMEB 3U30B 5JIIA 5D9SB 5DWUH 1RUPL 4BUGA 2OXHA 5H37G 5D7JD 5JPNB 5TGBA 1U8JA 1I3GL 4LSUH 5JZ7C 2I5YL 1B4JL 4NKDA 2W59A 1S7SB 3PV7A 1FL3B 3QDHA 3VRIA 3I3EA 3C2SA 1UZ8B 1N7MH 4Z7WA 3CCHB 1H0DB 4Y5YB 2X70A 2H26A 5HXMA 1SMOA 3DVNB 4LCCC 1PEWA 3ZYIA 3MPCA 3L6FB 4GBXD 3WFDL 1OSZB 4ENEC 2YD6A 4X80L 4PJDE 3G6DH 4JRXD 1EHXA 5DD5H 3D3VD 5K33A 5EIIB 1AXSA 4OM1L 1VESA 3D0LA 4ZAKB 3AVEA 1Z9MA 2C1OA 3IU4H 1JUFB 1KCVH 3WUZA 2R0ZL 5FO7B 4PTTA 4NKIH 3MYJA 3BP4B 1CGTA 1BLNA 2NX5D 3DETC 4KZEL 1BZ9A 1YEGL 4HT1H 5J1AA 4LASH 5AUMB 1MCDA 2XZCL 2ZJSL 3O0RL 4PRIB 1UJ3B 4Z9KB 2V2WA 5CWSA 2NY6D 4DAGH 4HGWA 3CLFL 3UYOD 1NFIB 2IPTH 3QO1B 3BUYA 4P5MB 4MCYB 1A9EB 2VDRH 4NDMB 1G7HB 4OKVA 1FNHA 4E41B 3MLYL 1D7FA 4P23A 2QEJA 4J6RL 4BZ2L 4PJGA 4QCIB 2F8OA 3MRLB 4RFOL 3FRUB 3NPSB 4KUZH 1T1XB 4WI2A 4L9LA 5F6HJ 5CBAA 5CUSH 4NM8H 3PGFL 2HFGH 3VFSB 4CGTA 5DD1H 5FDWA 1D9KA 1H5BB 4PJDA 2HFEB 4TSCL 2EIDA 4DKFL 4LPTA 2UY7A 5FYJE 3X11A 3GJFH 4IHOA 3ZLQC 3DX6B 2IAND 4RFNB 3C9NA 4QTHA 4ZTOH 1XGQB 4EIGB 3BP7A 5E2TL 3GM8A 3HA0A 2R1WA 4L4JA 4QRPD 1S8DA 4OM0L 4QRRD 5E1AA 5T1MA 1VDGA 2IPUG 5HJ3B 3ARDB 4PJDF 5D1XD 3QCVH 3MRJB 1YEKL 3VDAA 4X5WA 1AJ7H 1ITCA 4MAYB 4OF3A 3QPXL 1JNLL 3CFEA 3K2UL 5ACZA 4XGZA 1XAUA 5GGSY 3MV11 4TNVF 4RQQA 1T2JA 3JXAA 2I9LB 1I7RB 2Z91B 2A83B 3IDMA 3EJYD 1T0PB 2UWEB 2AJ3B 5BXFB 4QXWA 3EYQD 4ZG1A 2WAHA 5DMIH 12E8L 4ZSOB 1KJMA 3LAFA 3EKCA 5I1DB 4H26A 4C56A 3VA2C 1K85A 1GZQB 4JO1H 5IESH 5C2BH 1DEEB 3ARWA 4G9FD 1RHFA 5GJSL 2HT2C 1D6VH 1SJEA 1WJ3A 3LKSB 5BVJA 1MCOL 2DQIH 3H9ZA 4OGXL 4PGBA 3VDCA 2BDNL 3WIIH 1U8HA 1N8ZB 2ICWJ 3BE1H 5GGRY 4AH2A 4UUJA 1U93B 4CJ1A 1D5XA 4Q0XL 1FIGH 1QSEE 1MLBA 2FEEI 4AL8H 4OAWB 3K8KA 1F58H 1J7VR 4JQVA 3PV6A 4P2OD 3ALPA 5J12B 4I18B 1XF5A 4AG4L 2F9BT 2H2PD 1IBGL 4FXKA 4FXLA 3TCXA 5C0FA 3EOAB 3WEXB 4NFCA 5C0CE 3RWHA 5I8OL 3VJ6A 1FZOB 2FB4L 4AENB 4NQCE 3LIZH 3ARYA 1LP9B 4L8DB 2ED9A 5BRZD 2E8YA 5IR1A 3W39B 4YH6A 1WWAX 2BVUA 1SJHB 3C08H 2VIRB 2D7MA 3HE6B 2VSCA 1EJOH 1DL7H 3THML 4HZAA 1KN4L 5JOPE 4JY5H 4HWBL 4LRIA 4Y89A 4X6EB 1NEZA 5JIKA 3HB3D 1MF2L 1ERNA 5D93B 4RWHA 2GJZA 4KK9D 3GNMH 2Q76B 4OLWL 3JBG7 3BKML 5D7KE 3V5HA 3MRFB 1SBSH 1H3PL 5D5MA 1MH5B 1NMBH 4G42B 4YIQB 4WY7H 3V4PL 3CK0H 4HV8A 4F2MA 4ZFGH 3NZHL 3DUUB 3LKQB 1TQCB 2F5BH 2IBGA 2UUDK 3HMXH 4LIQH 4WHCA 4U1NA 3AREB 5IG7B 3OGCA 4XBGB 4NQCA 1QKZH 4NPYB 1E27B 3RWFA 3VG0L 2FECI 5E9DD 1MRCL 3MRKA 1IAMA 4IRJB 3QUXC 3G5XB 1CT8B 4D9LH 4HJJL 3N50A 3AM8A 4HFUH 1X5AA 4I5BA 4OD2A 5GGSA 2CLRB 1FFPB 1UADC 1G6RA 2FLBT 5MENB 4Q2ZA 4WUUE 2QSCH 1LEGA 5TE6H 3FN0H 3P30L 2CIIA 3WHXA 1SEBA 2V6HA 1P7QD 4JQVC 5EU4A 1UB6B 3HR5B 6FABL 2DTSA 4WUKL 4YXKH 4JFFD 2JK5B 1MCIA 1I9RL 4XPAH 4YFEA 5GS2H 4JPVL 1OLLA 1KCKA 3BJLA 4JM4L 3L3KB 4U1HB 5LKNA 2DOCA 3MBED 5BZDB 3TH2T 4NP4H 5BO1H 3HN3A 2HJFA 3B3IB 5J6HA 1GJIA 3DYMA 1BP3B 1QSFB 2XA3A 5GGRA 3MJ8B 3S37L 5I30H 1WV7T 3PDOA 1TQBC 4HKXA 3VD7A 5I8CB 4OT1H 3U1SH 4UZGA 2AXHA 2ZUYA 2CKBB 3Q5YA 1U0QA 2XPGA 4LRIC 5CZVH 1ZHBA 4HIIB 3FONB 1HHHB 3MBXH 4WUUA 3TWCH 4Z7QE 5HVGB 1IQWL 2R4SL 3WIHL 1JWUB 5KSUA 1AQKH 1OTTC 4DGVL 5FB8A 3V9FA 5F9OH 4GKSA 1RIHH 2C3XA 1P7KB 3EYVA 4KXZH 5IB3B 5HVFB 2WINB 1A7QH 4MA8H 5CZXC 1UCBL 1ES0B 1U92B 4HAFA 4HX1B 1KEGH 5JDSA 5LBSL 3EGSA 1PQZB 3PWLA 3TT1L 4KROB 2CLVA 4TN9A 4P4KA 3MOAH 2FIKB 3LKNA 2PXYA 5KANG 3U9PL 1NCNA 1RUML 2I60L 3VRLE 1MHCA 1NL0L 3H9YA 2P43B 1ZHNB 1L6ZA 5GS1A 1U8LB 3ARSA 1OP5K 2VDLH 5MP6H 5DD0H 5CEZH 2CLZA 4OI9A 4HIHA 4UOJA 1NCWH 4QRTA 4WO4C 4MB4A 5IHBA 3GUTB 4R90H 2NX5E 1FHGA 4NRXB 1BQLL 3EW3B 3IJSA 1TVBB 2FGZA 3ARTA 4W4NA 1I9IH 2AJUL 4LU5H 1BM3L 4M7KH 4EI5B 1VFOA 1X5FA 5D7JA 2WUCL 2J5LC 5SWQB 1RFDH 3ZT7A 4K7PL 2EDFA 5EUOA 3WHE1 5C08D 1W0VB 4PP2B 2N56A 4LAJH 3KLSA 5F1KC 1IRAY 5ENWB 2IADB 4FQCL 3SKUD 4NKMA 5I1JL 4RAUA 3TNMB 2VAAA 2CJUH 1QFWI 5D2NB 1FGNL 4GBXA 3RI5K 2FGWH 4YHYB 2UZIH 4LCWD 2ATPA 5GS2D 2ILLA 4MJIB 4BUHA 4JRXA 3D3VA 4ZXBD 1F6AB 4Y5VB 5EOCL 1MCNA 4OFDA 2LTQB 4M4PA 4HJGB 1A9BB 3DJ9A 3OR7A 2IANE 3OKNB 1EAJA 4O00A 3QI9B 4PJIE 4LPCA 3MOBL 4M7LL 4K9EL 2JLLA 1TJIH 3HC0A 1YEJL 5JW3H 2NX5A 2HT3C 4PREB 5MEQB 4QRRE 3B4NA 5CSZB 4BFEA 4X4YA 4JHWH 5J3HC 3VRLF 4F7PA 3BEWA 1DBAL 1J1XH 4U0RC 3BWAB 1F4XL 1QUNA 2BSSB 1MNUL 3HPLA 4LFHG 1NKRA 1FC2D 1G1CA 1MCHA 4M7LT 2MSPA 4OGZA 4PJBE 3BGMB 3GJEA 2OL3A 3OJMB 4OFYD 3SKJH 5E08L 3VGAB 1FL6A 4HXBL 5E8NA 3S5LB 1A6VL 1VADA 2EKSB 4MA7H 2UVFA 1C5DB 4Z7OE 4M62H 3IDYC 4P4KC 2ZKHH 5CEXA 4JGMA 3ZE0E 5I1LA 5EIQA 3WS3A 1JZ6A 1XGYH 4J4PC 1I1YA 3DMMD 3PNWB 3DX9A 4XP9L 4W81A 2AK4B 1ZEAL 1RK1A 5BMFH 4G9FE 2J4WL 3T0WA 3MRIA 2NR6D 5T5FH 2DQDL 1Q9KA 2IANA 3EO9L 3V52L 1ZWIB 3M1BB 3IDJA 3MLZL 4YAQB 1OTSC 2C26A 2KQMA 1AXIB 2F54D 1A22B 2FJFA 5EZLA 1S7XB 4QRPA 3WBDA 4N0YL 3RY5A 2C4FU 4QRRA 3OKOA 3MYZA 3CFDA 3WFCL 2PTVA 4KHXH 3L3OA 3HRZB 5D1XA 3DI3B 1CIUA 1TZHB 5F72S 4Z95H 4D3CH 2B7DT 1FLRH 1MPAH 1BREA 4PJIF 4LEXL 4YQXH 1JN6B 1MHEA 4N90D 2AJYL 5KG9B 2ED7A 5L88L 3Q3GA 2OX5A 1JPTH 3VFRA 3VD3A 1J8HD 2GUOB 3T2NH 2OTPA 4LBEA 5D7SH 2EYTB 5FK9A 2FO4B 3UJIH 4NYLB 5IVXF 1N3NB 1I8LA 1WWBX 1LO2H 3C5SA 5IHUL 3LS5H 1T5XB 4G9FA 2DLGA 4JJHA 5BRZE 2YBRA 4PJBF 5IOPA 1T04A 1SM3H 1QRKA 4XNQB 4C59B 2C5DC 2D7QA 2RGSA 4LVNB 4Y19D 4BH7A 1JTOA 4Y4KC 1FFNB 4HWUA 3VFVA 4HPYL 1L7TH 4Z7OF 4XC3H 3A0OA 3WDJA 3ZE0F 3T3PE 4ISVA 1G9ML 3CVHL 3MX0A 2ORBH 4RMVA 5FF6A 4LLAA 2WW8A 5JDJA 1HZHL 4GG8B 1AGEB 4JFOA 2FCBA 1A7PH 5DQ9A 3KPLB 1NBYA 2P45B 3C5ZD 4OZHB 1I9EA 3GKZA 2EDNA 2Y6SD 4P2OA 2J88H 5GQBA 5LCVL 3WFHA 2BXYA 2A74B 3VRJA 2BVOB 5JR1L 2JJVA 2VZSA 3QUZD 1IGTB 3CSPA 1G7LB 1KJVA 1R5VB 1J12A 5CIPH 3FO9B 1H9VA 4M00A 2BJML 2DDQL 4ZUVA 3HFMH 3INUL 1KACB 4F33A 5J06A 2VR4A 1V8HA 2ICEA 2W60A 2XZQL 5A3IC 5BRZA 4L1HA 1NANI 2GITB 1ZS8A 4XX1E 2D7OA 3P0YH 1XGTB 1UWEL 1MFEL 3QIWC 3QWOA 4TUKL 4HHAA 2Z93B 1AC0A 4ODWA 1QHOA 4K3EL 2P24B 1A64A 3SEPA 2VWEC 3WNPA 3BPOC 1GIGH 4OGAC 1BOGB 2VABA 4OLZL 4R2GD 3BXNB 4O2EA 1NGXA 1V7NL 2X4RA 3SQBA 2VQ1B 1FCGA 3QIUD 5DA0B 3TJEH 1BPVA 5HTSA 5EORL 3SQOH 3NCCB 3WO4B 4JFFE 2UY6A 4Z18A 4MAUL 1QFPA 2K7QA 5FHBH 4HW6A 4CKVX 4M5ZH 3T3PF 4KZDH 2Q8AL 2Y23A 3V0VB 1IAII 4NRYA 2ADJB 2VQUA 4M1GL 1U8KA 1W72A 2JB6B 1UWGH 1NGPL 4YHNA 3BZEA 1I8LC 2M1KA 1EUUA 2I07A 2AJZB 5KBNC 3BKCL 3F6LA 5TQ2L 5KAQG 5E9DA 5FKAB 3D18A 4NSKA 4I0PC 1F90L 4WU5A 5LAXB 2VDKL 4ETYA 3RX7A 3RWDB 2MHAA 2O5YH 2QR0B 2YD7A 5DVOA 4YR6B 3QB7C 1N59A 4MX7B 5E94A 3W9DB 3IETB 4ZOCA 1MFCH 4G6FB 5J13B 2IQ9L 5L8JB 3V5KB 4CW1B 1HYSC 3F58H 1A7NH 4XNMA 4YHKL 4ELKA 3TH4T 4NQUA 3RIAF 2I9TA 4UT9L 4MWFA 4MS8D 2ESVE 2HJLA 2Z31B 1P7QA 4C4KT 4S1QH 4LPVA 4YHLL 4JFFA 3JV4B 5C0ND 3UROR 2H2PC 4H88L 4QWWC 4LRNH 3AXLB 5C09B 2J8UE 1KTKE 5FECB 1HDMB 3RAJL 5DHVB 4CADB 3FT4B 3MBEA 4HKJA 1IC1A 4FG6C 5JPMB 1YQVH 3G6AA 3QUML 4X9FA 4E9LA 5BS0D 1X4ZA 4HKBA 2E6PA 2QQNL 4YHZH 1B90A 1WISA 3O4LD 5FM8A 2APBA 2ATKB 4LGPB 2DLFH 4AMKL 1AGBB 1ETZB 4LIQE 5HGHB 2G5BB 4FHBD 1ZLUH 1JRHH 5DYOA 3EYSL 3SE3A 3LKPA 1YNTA 5EBLB 5ESQA 3GIZH 5SX5H 4Q9RL 3RHWF 1FORH 2KPNA 5F6HI 2YD2A 5C6PB 4GG6B 4NN5B 1F11B 3PHQA 5AG9A 1JPSL 4Y4HB 1QR1B 1TIUA 3QDJD 3QCTH 5D7LD 5BQ7A 3BKJH 4OKDA 3TIEA 2FR4B 4FQLH 5L7XL 4I3RL 4KK9C 2WUBH 2W9EL 3FB7A 5DGRA 3TN0D 4P5TB 43CAB 4ZD3H 4LDEB 3JVGA 5I76B 3MRDA 4Z76A 4U0RB 1JPST 5IB2A 3FFCD 3T0BA 2AEPL 1CFVL 1T1WA 2YWYA 5TQ0H 3NA9L 2A1WL 1B0GA 3EOBA 2J8UA 1KV3A 5DJ0B 5DZOA 2J12B 4KKBC 3KPNA 5F7NC 3BT2L 3CVIH 3IDYB 1W2KT 4GS7B 4ZFFA 2O93L 1ZLVH 4OD3L 5B3NA 5KTEL 4JZNA 4XP1L 3HC4H 4JHAL 1WCBA 2JELH 4XAWL 2NTFA 1FRGL 3MV7B 4GKNA 1QRNE 3GMPB 3W9EA 4P48A 5I8KH 1NCTA 3BVNA 1FL5A 4HSQA 2ZSWB 1WSST 3QG6B 5CBEA 5TE7H 5F1NA 4Z0XA 4KTEL 2D4DA 3UPRB 4PGDB 2D9QB 2Y07H 4HIEB 5T5NG 5C08A 5FYKL 1JPGB 3BDBA 4GMTH 5IQ9B 1RZJL 3GSQA 3RTQC 5IFHL 5LGHL 2NY5L 4MQTB 5E03A 5F44A 3BW9A 3O11A 3D39B 1UB5A 5T3ZH 2E7LC 3N06B 1I1FA 3C5JB 1FPTL 4WV1B 5I9QB 5BW7C 2ICWI 4EDXB 3FOMA 4JVWA 2NLJB 3MBEC 1HIMH 4LGSB 4F37K 1LHZA 3CFCL 5L6YL 1JFQH 4LCWA 3WNLA 3X14A 4FFWC 3FB8B 2VYRE 3V6FB 1YYML 4XXDA 4BM7A 2HMIC 3PWPD 1RZKL 4FFVD 4TUOB 4F7CB 2R9HD 4ZXBA 5F7YC 4WHYH 1I1AD 5T3XL 4GO6B 1BZQK 5GSRB 1T03L 2BNUB 5EN2A 4JFEB 4DFIA 5BV7H 3GSRA 4XHJD 4XCNB 5CEZE 4WFED 1U8PB 4EOWH 5A16A 2F54E 4Q9QL 4U3XA 1DP0A 2XN9D 3AROA 3OJVC 5B38G 2VLRB 3MLVL 4W4OA 3E6FB 4C83B 2VITA 4P2YA 2OQJB 3U9UB 3JVGC 1IC5L 4L3EB 3A6BL 1LO4L 2BVTA 3TT3L 4OFYA 5FM5O 4AJ0A 2CIKB 5CJ5A 3STBA 1OTUD 1LK2B 1F3DH 5FFLA 2F58H 4J8RA 5I15H 3MV01 3HS0B 1IKFL 1J8HE 3GSXA 3PXHA 1U3HC 2Q8BL 4OF7A 5KW9H 3CX5K 3W0WD 2VQTA 2EE6A 3BZDA 3DMMA 1FNLA 3EDJA 2WBJB 4WWKB 1MVUA 1T0NB 5F8RC 2ZUUA 1XR9B 2AI0L 4B5EA 5IEHA 2P7TA 4TVPL 3B5GA 2XY1A 1WWCA 3IGAB 1NGQL 3BP6A 5EA0H 1UYWH 2B8OT 3LN5A 5CJBA 3LN9A 1F3JB 4Y2DD 4YDJB 5HHVH 2FD6L 1GZPA 1CICB 2F54A 1W0WA 5DJDB 2KZWA 4KHTL 5H37H 3KYNA 5CJQL 3GBNL 5A43C 3SJVB 3ZKMC 4OZ4B 1OQOA 5DF0A 1WBXB 4HLZH 4NGHH 1IEBB 4O4YH 1OP9A 1QYGH 4D8PB 5C92A 4NOFA 3ZKND 3BPOB 5I74C 2VDNH 1FNGA 5IJVB 4NO3A 1T22A 1SVCP 3C8KA 3KPSB 3MRRB 4PJFA 3MA7A 4HCRH 3EO0A 5CGYC 3NAAL 3C60B 3KGRA 5DRNA 3X13A 2CDGA 5L8KB 1HHJA 4FFYL 4NWTL 3TZVB 1J8HA 4HUKB 1PLGL 2GK2A 4LQFH 4PJHA 2DLEA 4WW1B 3VXPB 4HPOH 4YDIL 1VSCA 4AEFA 3UTZA 4X6FB 1NLDL 4APQB 2NY2B 4ZXBC 2H6PB 3U7YH 3D1MC 1RK0B 3P4NA 4RGOH 4JM2D 2APTA 2ZSVA 4M93C 4Y19A 3MXVL 3JV6B 2IAMC 1NDMB 3HI6H 4ZUSA 4FZ8H 1AGFB 3SPVA 4QHLB 4PGCB 3O3EB 3SGJC 5FOBA 3ZYJA 2VLLA 1VHPA 4UBDC 4F8TA 3V6ZB 1UM6H 5FA3A 1YJDL 2AQ2A 4TYUA 2UVEA 3WFZA 1G0YR 3BPLC 4ONHA 1VACA 3P9LA 3L5XH 3LKOB 3SHSA 1XCQA 4UQ3A 2DICA 3C5ZA 1RULL 3P0VL 3RY4A 4MQXC 4M43H 4JN2A 1RJYB 1QSVA 1NFKA 5ETUB 1CXEA 4JFYB 5C7XL 1CTOA 4MSWA 4PJ7B 3QUZA 1XIWD 5HGAA 1MJ8H 2RCSL 3MV8B 4PJ5D 1BGXL 2X4OA 3NZ8B 5HI3C 1KFAH 1U8NB 2DD8H 3DMMC 4MCZB 5JHDB 4WNQA 3WLWD 5IBUB 4G9DB 2GW5A 1FZKB 2OYPA 4BSWB 1T0MA 3JTSB 1KTDB 2J3SA 4TOYL 4FQIH 2HTLC 2WIMA 1Q94A 4GSDL 1GGUA 1AY1L 3HMWH 4ZOEA 3QZWG 3C09C 2X9XA 1IT9H 2OTUB 4FQQA 4QT5B 3RWGA 4F9PA 2XKSA 1P2CB 1AR1D 1FNEA 4FQ1L 3T2PA 5IHZA 4FQXD 3BDXA 1ZLSL 5E5MB 4FTVB 2ADFH 4XWOC 1KJ2B 3QIUA 4AEIL 4QXGH 1M4KA 2X7LA 2AS5M 1G7PB 3RX8A 3MROB 2IH3A 5DUMH 2ZOLB 1DQJA 1Y18A 3O81A 3U48A 3NIDE 3GIVA 4WI7A 2F53D 4JY6B 5I8EA 1LEKA 1IGFL 2CSPA 2BSTA 1HEZB 2FZ3A 2I27N 4UDUB 4KDTA 3BESR 1MCQA 1DN0A 2XI9A 4ZOBA 2JCCB 1N2RB 3DVGB 4UQ2A 4NZDA 1GYAA 3SGEI 4LLDA 4NJ9H 2L0DA 4I48B 3MRGA 5ESAB 5AD0B 5ADOL 1IE5A 4HGKC 3CX5J 2V5TA 1KPUA 3JTTB 3WUWG 5D7LE 1OWWA 1Z9LA 3UTOA 4WEBL 1JPFB 4L4VE 2RJMA 3ZHKA 4KKLC 2JKXA 2FJHA 4YXLH 1SY6H 4LLQA 3SKNB 3OAZH 3R0NA 3K8MA 5ALCL 2OMBA 3DV4B 2ZNXA 4JDVB 4LSTH 2ZPKL 2DJSA 4PJ9D 4YHIB 2DIAA 2MTPA 2Y6SC 3CSGA 3HNSL 4IJ3C 2YSSA 1DVFB 4G6ML 3FFCE 4XPFH 1RJLB 4PGEB 3JWOH 5I2IB 4K3DL 4PIRF 1A14H 1UWXH 2XWJB 5LXGH 2Y7QA 3L3HB 3S4SG 5BS0A 1MFBL 2R0LH 3P4MA 1BQSA 3O4LA 1KLUA 4OLYL 2BSRB 3GMOA 3REVA 1NAMA 3AFLA 1JMZA 3ULVD 4KGLA 1LO5A 2Q3ZA 4JRYE 3UBXB 1BZ7A 4Y8AA 4YDLB 1J87A 3UTSD 2BVYA 5GS0L 1TMCB 2HJKA 5FCSH 2IBBA 5MHSD 2Q7YA 3BEVA 4R4BB 4HUUA 4ZO7A 5KSBB 4F9PC 3QDJA 5D7LA 3NIDF 3E0GA 1CDCA 3WKML 1G9NH 4OQTH 4OD1H 1D5MA 5IMMB 1IGJB 5INCA 1S9YB 3QEQE 3L5WB 4JJ5A 3E2HB 1BX2A 4HAGA 3TN0A 5GGQH 2ZUVA 1XGUB 3FO0L 3B9VA 3QIUC 1ONQB 6CGTA 4ELME 3QXAA 3FRPG 4S11A 3TPUA 2X1WL 1KN2H 1MCFA 4XPBH 3FFCA 3PGCA 1CR9L 2BNQD 4Z78B 2X4SA 2UZXB 2ARJB 1OPGH 4BQ6A 1BJ1J 4K71C 4Q6YA 1MI5B 3OB0H 4EXKA 4NN7B 3KYMA 4U7SA 4NO0B 4PRHB 4XCFH 1RIUH 1K6QH 4R8WH 2I24N 1Z5LA 2FJGB 4MD5B 1HH9B 4HULB 1GPOH 4HUWA 2C3GA 32C2A 1FZMA 2BOCA 2XXMB 4EQ2A 5F70A 2VLKE 4LMQE 3KG5A 5F9JB 1A3RH 3T09A 2R39A 3GI9L 3ZHDA 4WFEE 3VD9A 5C6WH 4OV6F 3QXUA 4PR5B 3MV9B 3DROA 1I75A 2XN9E 5AYUH 3CUPA 3P73A 4XCYA 1XGPA 5F9WC 4NNXA 3FFDA 4FNLL 3GRWL 2ENYA 2F5AH 4KVCL 4MS8C 3I02A 2DQJL 4ELMA 2Y25A 2DQHL 3K81A 5DQJA 2E9JA 2NY0B 2ZG1A 3VWKC 3HNVL 3ARQA 2AGJL 3LRSB 4CU7A 3BMWA 1R6VA 2MMXA 4F57H 5IB5B 1E6OH 2CDFB 1NQBA 3RWCB 5ITFB 2EE3A 3W0WE 1A1NB 4NN6C 1BEYH 3KLAB 3UAJD 4P9MH 1IZKA 3PWPA 3BPNB 3WSQH 3U83A 4LAQH 2ICCA 3T2QA 3LHPL 3PXJA 4KQ3L 3IDXH 1EGJL 1I1AA 2RB8A 3ZTNH 4PUBL 4FZEL 4OF5A 2ADGA 3PABA 3UYRL 1CTNA 2CRMA 4LLVA 4JDZA 1A6ZB 3JUZA 2C1PB 2G75B 1E6JL 5ALBH 4EUPH 3ZYZA 2XN9A 2YC1B 3HKFA 1J11A 3HE7B 4WENB 3CU7A 2E7MA 2HN7B 5E2VH 2YA2A 3EYUL 2NW2A 1V3MA 3TH3T 3DLQR 1YEFH 3TN0C 4OZGB 1FV1A 3JWDL 2F74B 3GSOA 4YHPB 2AQ1A 4BFBD 2VISB 3VXMB 4JREB 1T83A 3KPMB 3H9HB 1LD9B 1KOAA 3ETBF 4W70A 1OT2A 1QNZH 1LE5B 4XBEL 1JI2A 5E6IC 1HINL 4MVBD 5A1AA 3V95A 2SEBB 4KJWD 3W0WA 1D6EA 2MFNA 3LMJH 1XF4B 2YKLH 5D6DA 4R96B 2EEBA 4GAGL 4Y16C 2H8PA 4X7SH 1KC5L 3DX7B 4MLIA 1QTYT 1B0RB 3ZE2E 1EEYB 3VFUB 1KCLA 3JZ7A 4Y2DA 1YY9D 2V7NA 3V6BR 3ILQC 4UV7H 4RFEB 1X4YA 3QDMD 2BNRE 3RQ3A 4B41A 3UXFA 4PJEE 1AHWA 2OMNA 2NY4D 3DXAD 1U41A 5HHOD 1OAYL 1TDQA 5HHPA 4I0CC 3BDYL 4GAYA 4YPGB 1I7ZA 5B4MD 1OLZA 5F9DC 3QISA 1MCJA 3FO1B 1MFDL 5F1IB 3NFNB 3VE0B 4MD4A 3E3QC 3HCVB 4YDKL 1UZ6E 3MGOA 3LPGA 3EUUA 2WLYA 3MRNA 4LHJB 5L2KB 3QEHB 3S7GA 5JLZB 1GGTA 3HAEH 3GSWB 4ZDHA 1EO8H 4LOUD 5EG6C 4PJ5E 4D0BB 3AS3A 3T0AA 4X8JA 5KVFH 1J8KA 2P47B 3TYFA 3VXOB 4FFVC 4RISL 5EH1A 4TNVK 4ZPTB 1I1AC 3KJ6H 2ED8A 4XCEA 3DTXB 2JJSA 4JM2A 5HYSB 4NUGH 4KVNL 1QEWB 1S9WB 3WL9A 4UAOC 5D4QA 5K9JL 4DZ8B 5IFAH 3AMLA 1MAMH 2QHRL 4NZJA 4FABL 1HQ4A 4TRPH 1K8IB 4PJEA 5JW4M 3WYRA 4Z7VB 3OJDB 4LLMA 5EBWB 3J8F7 5DVLA 1RVFL 2DMKA 4XHQA 1FQ9C 3GHBL 3DSNA 3QZWA 5A2KH 2H9GA 3KYKH 1X5YA 3FQUB 3ZE2F 1S5IH 4JHZA 1FYTD 4IRSD 1ND0A 1OTUC 1QQDB 2R0KH 1KTLA 1JYNA 1XF2A 4YK4C 4JR9H 1M6OB 5CJXC 5DJAB 4ODVL 3T77A 3QQ4A 1XIWA 3DYOA 2QADB 2F53E 3K8LA 4PTUA 1R0AH 5DUBA 2B4CH 4PJ5A 1GOGA 4DVRL 5SWSD 4HS6B 4NO2A 4FQHB 1RMFL 3WXWL 5DMKA 3IDIB 4XAKD 4F15B 4DVBA 5IV2B 1UZ6F 3LZFH 5JNYB 1SEQL 1Q9OB 5C0RL 1DUYB 3QNXA 7FABL 1AKJB 4NKOB 4U1GB 3IFPA 3SDYH 3VW3H 3RL1A 3DRTA 5IT2H 5EC2A 3O2DA 1LK3L 1FO0H 3F62A 3OAYK 1M7IA 4H25A 4RZCA 2VDOH 4FQXA 4QHKJ 2VXQL 3UTQB 1HH6B 1A7OH 1C1EH 2LAGB 2BC4B 3V4VH 3ULUL 4NQVB 3O8XD 1DN2A 4L8BB 2AABL 4WI6A 4TNWF 25C8H 3VWJB 1GC1L 4Y4FD 2XYCA 3L3IB 4CVUA 4J2XA 3FQXB 4LHUB 2UYLB 2C3WA 2F53A 2VL4A 2PW2B 5DUPH 3IFNH 4G6KH 4FXGA 4O5LL 5B8CC 5CINH 4H1LA 2ZCHH 4K71B 4DN3H 5B22A 1ZGLA 1TJHL 2Z35B 1GGIH 1DQLL 4QHNA 2GSGB 1KYOK 4OZIE 3GB7A 3R1GL 4WTZG 3ULVE 2DWDA 5DRWA 2FEDD 2R8SH 1BD2B 2JF1A 3UTSE 5DO2D 2VLJB 5MHSE 4XP4H 4PY7A 2HFTA 3VMNA 4FQPA 4KRPB 5BV7C 3L95A 5CHNA 3TBSA 4NQXA 4F7TA 5EU5A 1WIOA 3VRIB 4MXVF 2H2SD 3L3GA 4Z7WB 2YD1A 4N0FA 4U6YA 4XRCA 5KVDL 4P2CG 3M8OH 4JN1L 4CMHC 3O4OC 4PJ9A 3RDTD 4UIMA 5L2JB 5ILTH 2H26B 5EOQL 5AAWA 1K8DA 1GVIA 2VC2H 2BNQE 3NFSH 1KCUL 3DBXA 5F7FA 3ZE1E 1D5IL 3CSBA 4M9PA 2A6DB 4DJMA 4XH2B 2CR3A 5GGUB 4XZUB 1J10A 1S7RA 1MWAH 4XVTL 1VB9A 1RZFL 1HNFA 4LVHB 3EDDA 4UIKL 4HUXB 4KK5C 5GZND 1KLFA 4JQXC 5FYLH 1FE8H 5C0GB 1YY8A 4OZIA 3BFOA 4PTTB 4UOW0 3F6IA 1WC7B 2XKNA 1M05B 4V1DD 1BLNB 3UTSA 3MNZA 2YOCA 4JFXA 1HK6A 5GGVH 5CD5C 3FB5A 1ZT1A 1CXLA 3EOTL 3NOIA 5CWSB 4HGWB 1A6UL 1S7QA 1C5BL 1JTPA 2HH0H 4OKVB 1JMXA 1NUGA 4FN0A 2BVQA 4P23B 1WT5A 5TDNA 5GSVA 4PJGB 4YZFE 1F6FB 4KAQH 2P1YA 2A6IA 1WZ1H 4UU9B 4A6YA 4L9LB 3FJTA 4AQ1B 5CBAB 4NZTL 2BNQA 4PJAA 2W0LA 1BECA 3OXRA 4GUPA 5FDWB 3RU8H 1D9KB 3MR9B 4KTDL 2YD4A 1H3GA 3TA3C 2BMKA 3NN8B 1I85A 4OBRA 2DI9A 5MEPA 4NHUA 1X6NA 3WE6B 3GI8L 2W0PA 2YN5A 1FVCA 2EH7H 5J89A 3X11B 2JJWA 3OPZL 3QPQC 2DLHA 4OFKA 2P42B 5L9DH 3TBVA 3QHFL 2D7PA 5BOPA 3BP7B 3CC5B 2V9RA 5E1AB 5T1MB 3I3BA 3ZE1F 2P49B 5CKGA 3KPRE 4HQQL 1G7IA 4NJAH 1YA5A 3PWVA 2IFGA 4X5WB 1QFWH 4MNHB 3V6OC 3W5NA 4OGYH 5ACZB 2P5EE 4EVNB 4PJCB 3MJ7A 3RNKA 4RQQB 4XCCL 1ZE3C 5HPMA 2H32B 4PS4H 4WTXA 4WWID 4MLSA 4PJ9C 1I9JH 1IKNA 1Q9LA 5D7IE 2ZCLL 4N0RA 5DTFA 3Q0HA 5KSVB 1BJMA 1JHLL 2ZZUT 4BFGA 1C12A 2NXYD 1TVHA 4C56B 2IC2A 4QYOB 2IH1A 4M6OH 4JO3L 1BIIB 1SJEB 1X5XA 4ZFOB 3N85H 4KK8D 1J1OL 4YZFF 4DEPC 5BVJB 1CZ8H 4X5LA 1ZV5A 3E8UH 4Y1AD 3TBTA 1DQDL 5D72H 1PKOA 2D3VA 2BRRH 4P57B 1D5BA 5D70H 4X6CB 2DTML 1NFDE 1A6WH 4AH2B 3MLTB 4UUJB 1T4KB 3F12A 5HYEA 4JQIL 1M1SA 4L4TE 1KYOJ 3QDME 1MLBB 2E7BA 5E4IA 4HXAL 3REWA 4KKNA 1F3RB 3RVXC 1VFAB 2NYYC 3DXAE 4JPWH 4QRSB 5HHOE 1FAKT 1N26A 2Z4QA 1WT5C 3PV6B 3OKMA 5MI0B 1KF9B 1XF5B 3NACL 2B0SH 1KTRL 2FYYA 2X89D 1S5HB 4YC2C 1LO3H 4OIIL 1CE1L 5C0FB 1NEUA 1RUPH 3TBWA 2V2XA 5I6XB 2YPLD 1D3CA 1I3GH 3UO1L 2I5YH 1B4JH 2NY1C 3I75A 1DZBA 3VXRB 2HLFC 3RY6C 3RNQB 1X44A 3C6LC 5C0JA 2E6QA 1N6QL 1T7WA 3U7AA 3QXTA 4JDTH 2WWKT 5IMLA 3KS0H 3MODH 5D7IF 4P3CH 3C8HA 1EHLL 4K07A 2FBJL 1G7QA 4NNPL 1NFDA 4QRQA 1YUHA 4XPHL 4U7MA 5DFVC 4K8RL 2GJZB 4X80H 3QDMA 5D8JL 1R5IA 3V5HB 4PJ8C 3DXAA 4RDQG 5D5MB 4OM1H 5C0IB 5HHOA 4F3FB 1UC6A 5B3JE 5CMAB 4U2YA 1MEXL 1YECL 3T4YA 1RQ5A 2R0ZH 4WI5A 4P49A 3P11L 4DWHA 1DLFL 2BOBB 3QFJD 1G0XA 2YPKA 4HV8B 2FX7L 4KZEH 1FYTE 4EXPX 1YEGH 5EC1A 2YMXL 3SE4A 1NFDF 5DEFA 4OZFG 1K4CA 4Q9BA 2DKSA 1QFUL 4DZBB 2ZJSH 1A5FL 3QHZL 5FYKU 3OGCB 3O0RH 3O6LL 3UBXI 5JW4N 5FYJL 1MRFL 5FGBA 4GT7A 3FZUC 3JWOC 5SWSE 2BVEA 3OR6A 3BAEL 3MLYH 3LKRA 5E95B 4XAKE 5GGSB 4I5BB 4OD2B 1OP3K 3MO1B 1J0ZA 3G6JA 3O41A 3C2AL 1ZTXL 4AT6B 3VI4E 4Q2ZB 1A1MA 1ZGLM 4KJYB 1LEGB 3PGFH 5HSFA 2BY1A 3G5VB 3VFTA 4CMMB 2PR4L 3KNBA 4DKFH 1YN6B 4JZOA 2CUMA 3WHXB 4R0LC 1NUNB 4EUPA 3NIFE 4P99A 1G9NC 2XOTA 5SWZD 4P5KA 2IFFH 1XGRB 1PY9A 3N1PC 5E2TH 1FYTA 1NANH 4IRSA 4OM0H 5KJRH 3ROOB 3MA9L 2XACC 2Z92A 3DURA 3UEZA 3ZKSD 3WLBB 3WFBL 1YPZA 5I75C 4HBCL 4KJWC 5F3BA 4HKZA 1GGBL 3O6FD 5SWSA 3PDOB 1FGVL 3QPXH 2FO1A 5E8PB 5B3JF 3K2UH 2JJTA 1JZ5A 1P5UA 2EECA 1QBAA 2QQKL 3RJQB 3DO7A 3KXFD 5DD3L 4FQ2L 4QF1A 4WUUB 2GI7A 2P8PA 2PYEB 5HYQA 5LGJB 1YY9C 2FIRT 4FFZL 2AVGA 3F7YA 1PG7L 3B6SA 5FB8B 5DFWH 3VFOB 12E8H 1JZ2A 3V2AR 1FH5L 5C0BD 3EYVB 4U31A 2NY4C 1CK0L 1IAIH 2OI9B 5H94A 5GJSH 3S35L 4LK4A 1MLCB 5B4MC 1WBZB 4LARL 1T7XA 5JDSB 4IRZH 2X44D 4OGXH 3O8XA 3OL2A 4S0SD 3SO3B 4HMEA 1CBVL 2CLVB 4Y4FA 3TNNA 2PXYB 3EDFA 1MHCB 1KBGH 1P6AB 3X3FL 3R4DA 5DI8A 4WJ5B 3UJTL 4NC2B 5IROA 2NZ9C 2CLZB 3NIFF 1MQKL 4Z7UF 4DCQA 1G6RL 1ZVYA 2IALA 4Y5XA 4JZJA 4PRPD 5J11C 4AG4H 1R3HB 4JKPH 3ZL4L 2DKUA 1IBGH 2R4RL 1OAUL 1R24A 1OGAD 2AEIT 2C3HA 4WEUD 3TVMC 2C4XA 1IC4L 5D7JB 1MIMH 5DC4B 2FB4H 5EUOB 2EIZA 5E8DL 1Q8MA 4PRDB 3U79A 1SVZA 1NSNL 3DSFL 3U36A 5HVWA 1EA9C 4RAUB 4ONFL 3THMH 4CU6A 2PKDA 3RDTA 4A2MA 1KN4H 3RUGB 1LE9A 2P8LA 4Z0BL 3KLHD 3U4EA 2ATPB 1MF2H 2ZP0T 4ODUA 1JGDA 2V5MA 1MRDL 4JRXB 3VD5A 1OAZL 4OLWH 3UX9B 3SGKC 3D3VB 4MNGE 1H8NA 2VZUA 2OTWB 4MHHI 1H3PH 1B2WH 3RIAK 5HDLA 3KDMA 2GSIA 4RX4D 5IIEA 5KVGH 3V4PH 4PRAA 4V1DA 1GRWA 2NX5B 3ARBD 4EBQL 1ZA6A 3EJZC 4RMRA 4DEPB 4M1CD 4X4YB 3PGDA 5FOJA 3X3GL 1YNLL 3BEWB 2YD3A 2OR8A 5I1GL 1DFBL 3RGVC 5CLTA 1CL7L 2PO6C 5F3HA 2D0GA 3VG0H 3SCMB 4R9HA 2GKIA 4CNIB 1IL1A 3NTCL 3GJEB 5ESVA 4HJJH 5F1OB 5IMKA 4AIZA 1CD1A 4ZAKD 5JW5B 5E8NB 4DGYH 1U9KA 1IGML 4UINL 1VEMA 3CU1A 4P3DA 4Y4FC 5CEXB 4P2QD 4L3CB 5C9KA 4R6UA 4CVZB 3DX9B 4PYHA 3OKDA 5IROC 3W2DL 2ZWLT 1RK1B 5D2LE 4MNGA 1S7TA 5L8LB 1YEIL 1U8QA 1QR4A 1CS6A 1G1YA 1Q9KB 1NBZA 2QV2A 6FABH 1IARB 3IDJB 4WUKH 4JZJC 4OCRL 3B9KD 2BSED 2FEDC 4E41D 5TDPA 4JPVH 4O2FA 2AK1L 4QRPB 1OY3B 5FYLE 4QRRB 3BPCA 4CVXA 3OKOB 3CFDB 2XFXA 2NMSA 4UV4H 1CVRA 3L3OB 5D1XB 4QKXB 4S2SA 3FCTA 5EOTA 2CGRL 2ARWA 1T21A 2KZ1B 2H2SC 4NBYB 3T0VA 4J23A 1C08B 4PJ8B 4UNTA 4EQ3A 5C8JA 3EYFA 5BZWB 4C4KO 1OAXH 3VFRB 4I3SH 1ZSDB 2JE8A 3PL6D 4LBEB 4M9OA 5FK9B 5FV1L 2R4SH 2OZ4H 3STLA 2BRQA 4L9DA 3VGEA 3T0DA 4PBXA 2GAZA 3GGWA 2XTJD 3T4AB 5D2LA 3ARGC 1A0QL 4G9FB 2WSKA 4GW5A 2YBRB 1ZHKB 5IOPB 1T04B 3DOSA 3ECBA 3ET9F 2B4CC 3L5JA 1UCBH 4L8CA 5I1KL 4X9GA 5FM5M 3D9AH 1WGOA 4Y1AA 5LBSH 3ARZA 4NBXB 3R06A 3DRQB 3TT1H 5AZ2L 1FNAA 1MFAL 2OSLB 1VEPA 3D0VB 3OKYA 1NL0H 1TJGH 1OF2B 5D2LF 4XWGL 4KKCD 3ZDYF 5DK0B 2OL3L 1WAAE 1NBYB 4LNRB 5C07D 1EXUA 3T3ME 4P2OB 3WFHB 2ITCA 1T20A 4W6WB 3VRJB 3KYOB 1U2CA 2P44B 4G8IA 2X89A 1BQLH 4E42B 4PRBA 4RNRA 5T1DL 1G7JA 1KCRL 1BM3H 2CKNA 1PBYA 3BQUC 3QUYC 2WUCH 1ADQA 4K7PH 2YPLA 4ZUVB 3U0WL 2EXWD 4YE4L 1J9CT 2ICEB 3HG1E 2WP3O 1CFNA 4LHQB 5D96B 5FO9A 4M7JH 2IMNA 2VZTA 4QTIH 3CSYA 1MHHB 2HTKC 2H1PL 3O9WB 1URLA 3QWOB 4M6MH 3BD3A 2QTEA 1ZXQA 4MNQE 3OX8B 2WM0A 2AEQH 5FV2A 5IVZB 3S88H 3MCKA 1NCCH 3O45A 3P4OA 4AZ8A 3BH8B 4O2EB 3MOQA 1NGXB 2X4RB 5DD6A 5EOCH 5I0DA 3UYPA 4JANA 1U6AL 1TZIB 5SWZE 3V7AG 4QHMB 3MOBH 5DJCB 3QFJA 3QJFB 5SX4I 4K2UL 1LDPL 5J7CC 4F9LA 2AKRA 4MQ7A 4OUUB 2FHCA 1CDGA 4NRYB 1W72B 3OTTA 3SDAC 5E2UH 5C0DA 4YHNB 2NXYC 4NQTA 4LPWA 1UEYA 5J4MA 1Q0XH 4GRWB 5E9DB 1F4XH 1WAAF 1MNUH 3D18B 1KUMA 5DD5L 4PLNC 1K4DB 3T3MF 4WU5B 5A2FA 1DLHB 1LMKA 5E08H 4Z8FL 3UTPD 1LQSR 1S9XA 1N59B 4JO4L 5EDXA 1MVFA 1KJ3L 1U3ZA 3P77A 2EYSA 1PG7W 4HT1L 1HOCA 2DB8A 4LASL 4M7ZB 1A3QA 3ARED 4XP9H 5C0BE 1ZEAH 5ISZE 1P7QB 2IPTL 1I7TA 1L7IH 2DQDH 4YBLB 5EU6D 3EO9H 5SWZA 2W38A 4FP8L 4NO5B 5EZJB 4IDJL 4NHCL 4KWUA 3T0XA 2D7TL 4N0YH 4NQDB 3P9MA 5MEND 3ME0A 5CUSL 4NM8L 2HFGL 1CDJA 3MLSH 2LQRA 1N6UA 1REIA 3O6FA 1CI5A 4M61A 5DYOB 1HN1A 1NGZA 5EBGA 3LKPB 4X83A 1YEEL 2WANA 1BVKA 4G80A 4O51A 4LEXH 2APWA 3UJJH 2G60L 1EIBA 3PHQB 1YEHH 2AV1A 4PRPE 3FOLA 2AJYH 3KXFA 5BQ7B 3HTLX 1ORSA 4GMSL 2IPKB 3TIEB 1OGAE 2W9LA 5KZCB 4PPTA 3UZEA 1CXFA 3FB7B 3VFMA 3RVVC 2W0KA 5C0BA 3MRDB 3QCVL 2GTZA 3RGVB 4ENED 5HYIA 5IB2B 5KSAC 3PE9A 1ED3A 3CFKA 1U95A 2MQ3A 2ZG2A 5EPMB 4NNYA 1IGIL 4HPYH 3SGEH 2J8UB 4XMPH 3U0PA 1Z0MA 1W72L 2G2RA 2UV3A 5E8OB 2X9WA 3KPNB 2IG2H 1AI1H 4POUB 3U0TA 1G9MH 4IOFC 5HVHB 2X5PA 4OCLC 5J9PB 1HZHH 3OG4B 4ZFFB 1ZVSB 2ZCKL 2DQEL 2OBGA 1CFQA 1FFRA 4MA1C 4G7YH 3CDCA 1GHFL 3QH3B 4U1JA 4GKNB 1XFPA 4NIKB 4PRPA 3Q2CA 3Q1SL 5JR1H 2FX9L 3BVNB 5AAMA 4KTYA 3F7VB 1OGAA 2ITDA 2YR3A 1FG2A 2HVJA 5INDA 5KS9A 2BJMH 4CRPA 2DDQH 3BE1L 3RA7L 5C08B 1MOEA 3INUH 4UTAH 1FIGL 2XZQH 4JFDB 3GSQB 2X05A 4WGWB 4XNUL 4AL8L 4CAGA 1R5WA 2EDXA 3O11B 3QNZA 3U46A 1UWEH 1UQSA 2W07A 3VI3E 1F58L 4TUKH 3BZFB 5HI4C 3NIGE 5IEKB 3HZVA 5TDOA 4K3EH 2R2BA 1JV5A 1DQTA 2GTWB 1L9MA 4LCWB 3FQNA 3IAQA 4OLZH 3KYAA 2MKWA 3MMEA 4XXDB 3BYYA 1WBYA 1V7NH 2Q20A 3KPOA 5JPNA 4XBPB 2JIXB 4BELD 4RX4A 4H0IA 1FL3A 3GSRB 4XB8A 5ADPL 4MAUH 4E41E 3ARBA 4X7CC 1PYWA 2LVEA 3MRBB 3HUJB 1H0DA 1MJUH 4L5FL 3QAZC 4Y5YA 1YZZA 4JY5L 1AFVL 4M1GH 4TULL 4GXVL 2VITB 4ONGL 3BKCH 3U6RA 5TQ2H 3AU1A 5CP7A 1CFBA 5LVEA 1AGDB 1XZ0A 1F90H 1WICA 4LLUB 1SBSL 2IGFL 4WCYL 4D9QD 4RSVA 1NMBL 4ZAKA 2CR6A 1JUFA 1RUQL 5FO7A 3QI9D 5IM7B 2IQ9H 3BP4A 3GSXB 4P2QA 4ZFGL 1ZKAA 2F5BL 3QULA 3ARFC 4YHKH 4QGTA 5J1SC 1MVUB 4X4XA 1A7BA 3FO2A 1UJ3A 3I2CH 1ZOXA 4UT9H 5E4EC 2P7TB 1NFIA 3OBAA 3QO1A 4KQ4L 4P5MA 1TZGL 1QHPA 4NDMA 1G7HA 3B9KA 4E41A 3P9WB 3NIGF 1GZPB 4H88H 2MCG1 1W0WB 1QBBA 4QCIA 2EDYA 1BWWA 3MRLA 3RAJH 4UT7H 3GK8L 1T5WA 4GQ9H 1RHHA 2UWEE 2D7NA 2QQNH 1OP5H 2IEPA 1FDLH 4KPHH 2YRLA 2HFEA 3EYSH 3MNVB 4KFZC 3C8KB 4Q9RH 1P9MC 3QFDA 5ACLA 4PJFB 1Z6JT 3MA7B 3EO0B 2EYRB 1CD9B 5DRNB 4RGNB 1AXTH 1HHJB 1IVLA 3DX6A 3AY4A 2ZOKB 3QT2A 3D69B 3LSOB 2VZ1A 1J8HB 4XPAL 4W6YB 1XGQA 3PL6A 4PJHB 3KPPB 2CUIA 2A6JA 4AYFA 2WV3A 3U30C 1QFWM 5L7XH 4NP4L 3UTZB 2W9EH 3ZYOA 2D4FA 5BO1L 1SYVA 3V8CA 5DJ6A 3GSNB 3MRJA 2Q7NA 5JXAL 5E56A 3W5MA 1EJ6A 4MAYA 4Y19B 1TFHA 4U6TA 4R3SA 1J18A 2AEPH 2DQCL 3H7BB 1CFVH 5EU3B 3SPVB 4G7VH 3NA9H 4BFIA 1OHQA 1MWAB 1NLBH 2X09A 1I7RA 4Y5YC 1CL7I 1IM3A 2A83A 5CZVL 4J3UA 4YHOL 5CEYA 2A77L 3MBXL 2UWEA 3IDNB 5DRZB 3P9LB 5K9QI 4OD3H 1XCQB 5KTEH 4K7PY 4UQ3B 3C5ZB 3H2WA 1WK0A 3FQTA 5C07A 1GZQA 4QXUH 1LP9E 2K7PA 4ERSH 2P5WD 1DEEA 3OKLA 3MLRL 4ZAKC 1ZA3B 5C3LD 4K94L 4FS0A 5I1EL 5JXEC 4YFDB 3LKSA 1KEGL 3QUZB 1JVKA 3QUXD 2UWEF 3TJHC 1NMAL 3BH9A 3UPAA 4KTEH 4TSBL 1Q9WA 1I7UA 1UJ3C 1U93A 5FYKH 4K3HA 1T0MB 3TYGH 1MCWW 4KUCF 5IFHH 5I18H 2NY5H 4OAWA 1MSPA 1Q94B 5D1ZB 5DD0L 4WHDA 4OLXH 4XC1L 1NCWL 1ZLUK 2VXSH 5DHVH 1X4XA 4N8PA 4I18A 3CAFA 3NPSC 4R90L 1FNEB 2LU3A 2OJZH 5DEGB 2BXZA 5L6YH 1YYMH 1K2DA 3EOAA 3WEXA 4N0UB 4L3AA 1RFDL 1H5BC 1FZOA 3P0GB 4XB7A 1UKTA 5T3XH 4L8DA 1SJVA 4ESKA 4R97B 2RR3A 3K3QA 4YO0A 1SJHA 4N8VG 5GHWL 4TPRL 3GIVB 4U1MA 5I8EB 5FA4B 4TTGA 3MLVH 1DE4A 2F8XC 5MENE 2FZ3B 4YGVB 5I1AA 3NCEB 1DN0B 1T89A 4RMQA 1K3ZA 3ARDC 3I6KA 4UQ2B 4L8SA 1RPQA 3RVTD 1IC5H 2OZ4A 3D25B 3KR3L 3MXWH 3IDUA 4Q6IA 1LP9F 1E4KA 2EC9T 5T1KD 1CN4A 4MAYC 1OTTD 5HHQA 5GRXG 1QSED 1N64L 3UP1A 1ZLVK 4G42A 1EAPA 2VZOA 1IKFH 3QWRD 3PP3H 2Q8BH 2FJHB 4OIAA 1FAIL 1UFUA 1EZVX 4LLQB 3WV0A 1Y0LB 4JHWL 3S34L 3AREA 2NY3C 4ODHL 5I73B 2Z8WC 4OCXH 5IK3A 1QSFE 4NPYA 1E27A 4LP4A 4TVPH 5DVMA 4MGXA 5DVNA 5C0CD 3SDDB 1NGQH 5EU6A 4HK3N 2YSSB 1AD9B 1NEZG 2H41A 1CT8A 2FD6H 4I2XE 3SKJL 3NCJL 2CLRA 4KHTH 3WO3B 5HDQH 1FFPA 1JHTB 4MXWH 1F45A 5CJQH 2Y7QB 5BS0B 5MENA 3P4MB 1RIVH 4U1KB 4M62L 4G6FD 3O4LB 3IDGB 1GAFL 1YC8A 3GMOB 2K9UA 2ZKHL 4WO4D 1CGSL 2GT9A 1NAMB 3SDXB 5JOPD 3Q48A 1BZ7B 1QBMH 3V7MA 4NBZB 4NZUH 5BMFL 3CDGB 2HJKB 4PD4K 1CDHA 2HKHL 5CLWA 3HR5A 5J12C 3QDJB 4FFYH 2IQAB 3LY6A 4I18C 2JK5A 2R23A 4NWTH 2EO9A 1CFTB 1PLGH 4NCC1