4D8PB

Structural and functional studies of the trans-encoded hla-dq2.3 (dqa1*03:01/dqb1*02:01) molecule
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
219
structure length
193
Chain Sequence
PQPEQPEQPFPQPSPEDFVYQFKGMCYFTNGTERVRLVSRSIYNREEIVRFDSDVGEFRAVTLLGLPAAEYWNSQKDILERKRAAVDRVCRHNYQLELRTTLQRRVEPTVTISPSNLLVCSVTDFYPAQIKVRWFRNDQEETAGVVSTPLIRNGDWTFQILVMLEMTPQRGDVYTCHVEHPSLQSPITVEWRA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Immune system
molecule keywords HLA-DQA1 protein
publication title Structural and functional studies of trans-encoded HLA-DQ2.3 (DQA1*03:01/DQB1*02:01) protein molecule
pubmed doi rcsb
source organism Homo sapiens
total genus 36
structure length 193
sequence length 219
chains with identical sequence D
ec nomenclature
pdb deposition date 2012-01-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00969 MHC_II_beta Class II histocompatibility antigen, beta domain
B PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4d8pB02
3.10.320.10 Alpha Beta Roll Class II Histocompatibility Antigen, M Beta Chain; Chain B, domain 1 Class II Histocompatibility Antigen, M Beta Chain; Chain B, domain 1 4d8pB01
3QQ3A 3HS0A 1NC2D 2ATPA 4ONFH 4JE4B 1FL6B 3EO1B 3ZE2F 3WO3B 4PGEA 1IZKA 1U8PB 2PO6C 4J3WA 2EEDA 3HN3A 4ZAKD 1CDYA 3S4SA 3HPLB 1BIIA 2VXQH 2QL1A 3ZHKA 4L4VB 1KB9J 1YUHB 3JVGA 4YGVA 3V6OC 5CSZB 1EAPB 4OSUH 4FA8A 1MHPL 4O4YH 3VFRA 5D7LA 3HI5H 1MFCL 4OD2A 5F88A 1YEKL 1AD9B 1LHZA 1XGPB 1RV6X 2R56L 3DIFB 2HG5A 5GQBA 1DFBH 5IUSA 3SQBA 3VCLA 3GHEH 3C8KB 2R4SL 3HG1B 4XP5H 3K4AA 5D7IB 5EH1A 4XXDB 3GMOA 5EIQA 1OP9A 1UVQB 4FZ8H 3PWLB 3QNZB 4UDUA 2WM0A 1T66C 2GTZA 5D70H 2VZUA 3U9PH 2MMXA 4BK4A 4AIZB 3BYYA 5KVMC 2XYCA 3DMMC 4P2QE 4PYGA 1YEHH 2F5BH 1S5IL 3VWKA 1RUQH 3BT2L 3QUZC 3FT4B 5CGYC 5FDYA 2ZSWB 4NCC1 5LGKA 1QACA 4NGHH 4MHHI 1KJMA 4ODXB 4RAVB 4S11A 1EJOH 1OP5H 4M6ML 1FSKC 2IANE 1IAKA 1MCFA 1XH3A 5HDLA 3U46A 2I9TB 4TTDC 1GC1C 2V2TA 2PR4H 4K7PX 2B1HL 4G7VL 4PJHF 3I3EA 5AAMA 4LAQL 1S78D 4EI6B 1AKJB 3GMRB 1NCNA 4KDVA 3T65A 2XWJA 3DBXA 1MLBB 2ZSVB 3O3UN 1I7RA 1B90A 2DQFA 3G6JB 1B2WL 2YMXL 4PJGA 4PRID 2UV3A 1PZ5B 4P2CG 5AWNH 3CVIL 3WMSA 1JGDA 1NGWB 4KHTL 1NGQH 4QRUA 1QBLH 5IMMA 3RUGB 2VXSH 1XGQA 5C09D 3TBSA 3T2QA 3A67L 5CD3B 1MRFH 2GK0B 4KVNL 5J13C 1FO0A 5JXEA 4G8GD 4D0BA 5TFSH 2ZCKL 4KMTH 3U0WH 3ROLB 4ZDHA 4I5BB 2GJZB 1WEJH 5D1QC 2AJXH 2VC2L 1N4XL 1KPUB 5TDPA 3SE8H 2QEJA 3S34H 4PS4L 3GSNL 1U8JA 3MC0A 4JHWH 3JTSB 4L8DB 3GIZL 4S10A 2XN9A 5DJ6A 4WHTB 5IP4A 1NGYB 4KZEL 3CFCL 1OGAB 3VXRD 4NKOB 4X6EA 4P0DA 1JHLH 3I6KB 5I30L 4U1NA 2GKIA 3D85D 4PB9H 2Y1VA 4ORZC 3VXQA 4UU9B 4ZD3H 3WSQL 2OJZL 3RKDD 4LSVL 3JVGC 3WJLA 4MXQD 3EW3B 5IBUG 4L3CA 3BX7C 4ISVA 4LDEB 4EBQH 2ICWB 2NLJB 4UBDC 3VDCA 2JF1A 4HGWB 5BZDA 4PJFB 1CQYA 1IGML 3CX2A 3OR6A 1CG9B 4QHUB 5JLZA 1E4XI 4KAQH 4U6YB 3SDXA 3H2WA 2P8MB 1KENH 2BP3A 4P2OC 4PLJD 3HI6H 3G5XB 4PTUB 5CUSH 3FRPG 1DBBL 1X5YA 4R26H 1S9XA 1WZ1L 2BOBB 1A3LH 2M26A 1NMAH 3MRHA 1A3RH 1UA6L 1NUFA 1EHLH 4GS7C 3B9KD 4D3CH 3D6GA 1S7SB 1WLHA 1PG7H 2ZUWA 2QADD 2YZ8A 4U33A 5LGHH 1YPZE 2XV6B 3O41B 3LKRB 4HQQL 4JRYA 1RIUH 4M9OA 2G2RA 2BVPB 4L4TE 3VWKC 1QBAA 3T4YB 2QQKH 4UZGA 5FYJD 4X9IA 4JFOB 1IM3A 5D96B 4M4PA 2D7NA 2P45B 1HSAA 4KTEL 2IC2A 4WHYG 1HHKA 4MZ2A 4HGMA 1BECA 4HW6A 2VWEE 4KK5C 5HYSG 4N8VA 3IRPX 5DZLA 3LDBC 3LS5L 3RWCB 1CDGA 1YJDH 1OWRM 2WP3O 1N3NB 2HFFA 4MJID 5JXAH 4WI8A 4YBHA 4RFEB 5CP3H 2FX8H 2DYPB 2O5XH 1T3FB 1UCBL 1FYTE 4K7PY 4P4KA 3O0RH 4J4PA 3ZE2E 1EBAA 1U58B 3MBXL 5EN2A 4LP4A 2PKDA 3FN0L 1SY6A 3RWFA 3DROA 5JW4R 2HLFD 3TV3H 1JYWA 5K33A 2IBBA 3SKMA 3GSUA 5F70A 1BM3L 4KI5C 4AMKL 1U8KA 1KJ2B 1S7TB 2W0KA 2XZQL 2CDEA 1NBZA 3C5ZA 5FO7B 3B9EA 3STLB 2EXWD 3MLVH 3WFZA 4MJ5B 1TQBC 3ARDB 4L8BB 4MSWA 1EEUA 2C3VA 4OUUB 4P46A 5GS2D 3MBEC 2VISA 3VI3E 4JFDD 3WUWA 1FZKB 4ZUVA 4NQDD 4LIQE 3HE7B 4KY1H 1K2DA 2AXFA 5F1IB 3TN0A 4G8IB 3L7EA 4F7PB 1WIUA 1YEFH 3IFOA 1WCBB 1AR1D 5E6ID 4YHNB 4KK8D 5C9JB 4ODWA 3HMXL 1JZ5A 1P7HL 2ARJB 2FB4H 1U3HD 2RHEA 3WJLC 1WWCA 2E9WA 4LCIH 4M8QB 2AV1A 3U2SB 3GJFB 5KANI 2ZUYA 1F3JA 1DQDL 5T1LA 3VI4F 5IJKA 3D39A 3K4DA 4AQ1B 2AABL 3DV6B 1RZFH 1Q9LA 1QD0A 2R23A 4HWNA 5JNYB 5EBLA 3L5IA 1WV7T 2NX5B 2XICA 4Z78B 5IFJA 1TIUA 1TQCC 4N1CA 3QP3A 4APQD 4EXKA 3D0LB 5FB8B 5HXMA 4OIBA 1ZTXH 1M05B 4N0CC 4Q74A 3ZHDA 4WUUD 4P2QA 4TSCH 2V9TA 4M9PA 3ZKNC 1FHGA 1TZGL 2YRPA 5DD5L 4J23A 4JFHE 4GRLA 4QHKJ 1BQSA 2CXGA 2FO4A 15C8H 2HVKB 3OKMB 2V2WA 3UTSD 5FYKD 5F1SA 1CIDA 2OQJB 3RPIB 1P84J 3GKWH 3HNVH 4XB7A 4YLQT 1UYWL 5A16B 4XCYA 1X5XA 4PJCB 3VXMB 4MCZB 3RVXC 1FVDB 4OZ4B 5L88L 3FQTA 3GEWB 4MNGB 5E2UH 1KFAH 3GMPA 2V7HA 5C0DA 1CE1H 1T1XB 5ACMA 1WBXB 1H5BB 2BVQA 5FF6A 3DHMA 1DQML 9CGTA 2WWMC 5GIRB 4WCYH 5E7FA 4OGAC 4NOBA 5MEND 4NZTH 4LARL 3V0AC 3CSPA 2Z31A 4P4KC 1B3JA 1RD6A 4J4PC 2A1WH 2IGFL 1OAKL 4P9ML 4KJPC 4ZOAA 3K46A 4JFFD 4NQSB 1WTGT 4MVBD 5C3TA 3IDNA 4QYOB 4DKEL 5DMKA 5BS0D 1K4DB 2QV2A 3HE6D 1QSFB 3B9VA 1B0RA 4LLMA 2NZIA 4EI5A 1ES0B 3CDFA 2X89D 3C5ZC 1H0DB 3LSOA 3MRDB 4LSTL 4R8WL 4R0LA 5K9KB 2BK8A 2VQTA 4P46C 3VXUB 2FZ3A 1LK3L 2JB6B 5HGBB 5DJCB 3TO4A 4YPGB 3RU8L 1GC1L 5J6GA 3O8XD 4M5ZH 4L9DA 5F7HA 2YPKB 1RVFH 1XR9B 2ZG1A 4N0UB 1QRND 2JJVA 4Y4KB 3RL1B 3MJ9L 5GS2H 1J88A 1M7IB 1TNMA 1U3YA 3TBWB 3K2UL 3HAEH 4R7DA 3VFMB 3H3PL 1EEYB 2XZCH 4MCYB 2BC4B 4M4RA 5HJ3A 4Z7QE 1KPRA 1T2XA 4DW2H 2OP4H 5FFLA 3U36B 3MRGA 3MOBL 3IS0X 3MV8D 1VFAA 2OYPA 3PV6B 3RX7A 4HHAB 4GAJH 1HILA 3V6ZB 4YHYC 2JIXA 1BHGA 2E7HA 4POZD 4WI6A 1ADQL 1A6VL 2BHYA 3TFKD 4ZS7H 5IJKC 3QIUA 2APWA 3QBTB 3DWTA 4JO4L 5EOCJ 4NM8L 3SDYL 2PYFA 1F4HA 3VXPA 3EDEA 3HCVB 5F9OL 2BFVH 4NKDB 5IB1B 4DTGH 1WISA 1XF3A 3ZTNH 4KQ4H 5JHLH 4PRIE 2DMCA 2VERN 5ACZB 4F15C 4NQUA 4B53A 1WITA 5FA3B 2EIDA 4LHUB 3D3VD 3I75A 4XAWL 5C09E 4QHMA 4JFED 1E27A 5K9JL 1F8TL 4L4TA 3C09C 4GRLC 4G8GE 4HV8B 1A6UH 4JKLA 3T77B 4KZDL 5IVZA 5JPNB 2DWEB 5L0QC 3Q5TA 4IMLA 5FUZH 3RZCD 1JNJA 5IBLC 3NN8A 3QEUA 2FHCA 1PBYA 1D5ZB 4XRCB 1Z9OA 1WBZA 1E28B 1FZOB 2FHFA 5I73C 3IJHA 2UY6A 2WBJC 3ULSA 4PRNB 3L7FB 1FPTH 4O00A 4QRSB 3QQ4B 3VXRE 3IU3B 2YXMA 3H8NA 2H6PB 4HX1B 2F8XC 3QXDA 5ALBL 3QDJB 2HRLA 4MYWB 3CZFA 2YC1B 2E7LC 4RMVA 1OAXL 2DD8H 3O4LA 5MEPA 2VL5B 3L3HB 1VGEL 2UUDH 3O45B 1BEYH 1Z2KA 2Z31C 1MCBA 1WZLA 3F7YA 2DM7A 1OARL 2WBWB 3QCVL 1U8OB 4QWWD 5JW4Q 1JZ8A 4EVNA 1BAFH 5INDA 1OD9A 1Q9WB 4UMGA 1NAMH 3QI9A 1NUGA 1MQ8A 4CGTA 4HXBL 1NL0H 4EI5C 1IGJA 5FA4B 2VQ1B 2C3XA 5KOMC 1BQLL 2VH5L 1U92A 4R0LC 5EIIB 1CK0L 5C07E 2A77L 3P2TA 1FJ1A 1C5DB 3CDGB 4G7YL 3QUXD 1FGVL 1MJUH 4U05A 3SDDA 3UROR 4U6TA 3TO4C 4PRHE 4MA8H 5KOVC 2AXGB 2FL5A 5DJDA 5EOTA 1DEEA 1G7QA 2I07A 5H8DA 1T7ZA 3WFHA 2UVFA 2Y07H 2FGWL 2WIMA 2QQQA 4OFVA 1BD2E 5L7XH 1YEEH 3GB7A 1J8KA 2K7PA 4OQ1A 1JPSL 2VZOA 35C8H 2C3GA 1BVKB 3H42L 1G0XA 1OAZL 5E2TH 5C2BL 1FNSH 4GKNB 2BY0A 5CSGA 3N1QC 4IM8A 3R8BB 3QIUC 4R96B 4K7FB 4QOKA 1SJEB 2GJJA 4HJGB 3VG0H 5L2KB 1MRCL 4XP9H 3FMGL 3O2DH 4MJIE 3OGOE 3Q1SH 3CD4A 5DJ2A 1G6RA 5T33L 3MREB 3NCEB 5T1KA 1OB1A 5ISZD 3HC4H 3DSFH 4PJHA 1A6WH 4MA1C 2XNAA 1CZ8H 1MH5A 3KXFB 4N9GA 5EU5B 2A74B 4NQCD 1DL7L 2A9NL 1OGTA 4PP1D 1MFBL 1EHAA 3BGFC 5TE7L 3UAJC 4DKFH 1PEWA 3PV7A 3EDDA 1UXWA 5AZ2H 1R3KA 1JGUH 4GRWB 1BBJA 4PRAA 3LQZB 2ZOKB 3EBAA 2ARJQ 3MV9B 2Z35B 4YZFE 1GRWA 1OF2A 3CX5K 2VWEC 4JFDE 5EO9A 3GBNH 3VGGA 4MJ6B 1RZ8B 5E00B 2E7CA 4H1LA 3DRTB 4HLZH 4TNVF 3FFCB 5DEGB 4ZUUA 2R1YA 5HHXL 1DQJB 5D2NA 4PJ7F 4WU5B 3ZYJA 5TE4H 3DTXB 5FKAA 3ROOB 1J1PH 4D94A 1PKOA 1QA9A 5HPMB 1AD0A 5TDNB 2JJSA 3BMVA 4MJ2A 1U91B 4CRPA 4HWUA 2A83B 3MLUH 3PWUA 3SPVA 2NZ9C 3GM8A 3RL2B 2GUOB 4HF5L 1MLCB 2IQ9L 5EZIL 3QAZC 1VCAA 3ME0A 4YXLH 4B5EA 2R1XB 4GKZB 1FBIL 4K94C 1U8MB 3G5YB 3ZYIA 4OF6A 5C0IA 4FQ2L 3QI9C 1ORSA 3GK8L 3MUJA 5LQBH 4Z5RB 2LABA 5DEFA 4JB9L 4XCNA 3IDXH 5GPRA 1PW3A 4WUUE 4X9FA 3BZFB 4JFPB 5CHNB 1BMGA 5EU4B 3D87B 3FJTA 3SDDC 4NT6A 1JFQH 1V3MA 1CICD 3FB5A 4RFOL 3VFPA 3UTSE 5FYKE 4NO2B 1NDGA 3EOBB 2VXVL 3GJFK 3FN3A 2EH8L 4ZPTB 5TJWK 4QRPE 1C08B 3RI5F 4OLWL 5JQHC 3O3AA 4YBQD 2EDOA 1W8OA 1K6QH 4NQEB 3MLZH 2GW5A 2PTTB 4K55A 2ICES 3C5SB 4GH7B 3PDOA 5HVFB 1RZKC 3MOQA 1NEZB 4QXGH 4LCWB 3MV7A 4PRIA 5MENE 1KTKE 2F54B 4ZO7A 4E41D 5HGDB 4YUEL 5F96H 3B9DA 4WI3A 4XP4H 5D1XD 2I5YH 3UC0H 4KKNA 2DM3A 2DLGA 1PDKA 4HMCA 4JFFE 4Y19B 1FE8H 3CUPA 3KYKH 4HKZA 4PJBF 2OTWA 4LBEB 1FIGL 1HEZB 4YO0A 4Y4HB 5GSRA 1PQZB 5BS0E 1JPST 4GMSL 1R5VB 3BN3B 4XBPA 2ADIB 1N8ZB 4M5YH 4M93B 3QNXA 4UOJA 1NCAL 4LVOC 1NAKL 4ODUA 3LD8C 1T5WA 4GW5A 2GCYB 1IFHL 1RUKL 1GYAA 3TIEB 5EA0H 3PHQA 5IHZA 3EYUH 3VXRA 4QTIH 4ZYKB 3QG6B 5H2BA 1IEAA 3X12A 5TF1L 4RIRB 1QRNE 3QIWB 3D85A 3MCKA 4DN3H 2VL4A 2CRMA 4QNPF 1R3HB 5E70A 3X3GL 1CGSH 2QKIA 3C2AL 5B8CA 4QXUH 1HNGA 1ZS8B 7FABL 5I1JH 2L7JA 5I75C 1EXUA 3IFLH 5AEAA 3BDXA 3HC3H 4HK0A 1U9KA 1KIRA 3PWPB 2BSSA 2NW2A 4LLWA 1HH9B 4D0DA 5IKCB 1NKRA 3ZKXB 2AXJA 2BMKB 3MACH 1JIBA 3T2PA 4N8VG 3T0DA 5KSBB 1CFVL 1YEJH 2ZOLA 5DLML 4FQIH 4HUUA 4JPWL 2FX7L 4NQVB 1PKQB 4G6KL 1R3LB 1I9EA 3O9WB 3QDMD 4YDKH 4H5SB 5ICZB 1K8IA 3TT3L 4AM0A 3D3VE 2VITB 4UTBL 1RUML 3L5XL 2P7TB 1JPTL 4FQQA 4JFEE 3GMMB 1EMTH 3QG7H 4ZG1A 4X5XB 5E8OB 2X6MA 4X5WA 3QUMA 5CJ8A 3OL2A 4JJ5B 5JPMB 1C12B 3HR5B 4BQ6A 4JFYA 1WFUA 4PJAB 3BSZL 3TPKA 3DYPA 4F33B 1KC5H 1YY9D 3TA3D 2VTFA 4HUXA 3BP5B 1FLRH 1A7QH 2Q8BH 5C8JA 3QCUH 3BWAA 4W70A 4YHML 5JDJA 2YPLD 3QPQD 4NJAH 4NO3A 5E2VH 3SGKA 2LVEA 2YA2A 3L3DB 4G9FD 1NSNL 5IB4B 3LZFH 3WUWG 1RK1B 1DSFH 1S78C 1OCWH 2FCBA 3VG9B 4XX1E 1S7VA 1MEXL 4ZXBB 1PGRB 1BF8A 5KTEH 1E4WL 2FEDD 3WJJA 1W0VA 5IB5B 4JZJB 3HMWH 3F7RA 4XVJL 4S0SD 1NBYA 3T04D 2XQYK 4TUJB 1A3QA 4HIEB 2DWDA 4Y16B 4NZUH 4PG9B 4LLYA 5FO8A 4LCYB 5CINL 4IS6B 3W9EB 1MRDH 1QFWL 4ZO8A 5D7SL 5F1KC 1JCKA 4WI5A 5EC2B 2VLKB 3WXWH 3KPRB 1FYHB 3VH8A 3BEWB 3JXAA 4G6FD 1XF5A 1I3RA 1R0AL 3CVHH 3L3KA 5IMLA 1T0MB 1TETH 4OLUL 1ZLWK 4QRTB 5D1ZB 3O2VH 4JDVA 4X0KA 2H32A 1JVKA 5C1MB 3KPNA 2DICA 4QO1A 5F21B 4NQDA 3O11A 4Q6IA 4P5MA 2XA8L 3ZSTA 1AFVH 1CDIA 3ARXA 3OKEB 1UM4H 1OP3K 1FZJB 3C08L 5E6IA 4J1UB 1T80A 2CXKA 5BO1H 2ZCLH 4OZFB 2AQ3A 4NQTA 3H6JA 4A6YA 1U3HA 1REIA 3OB8A 3RKDC 3S36X 2EXYD 4GT7A 4W4NA 5F7KC 5B8CC 2F58H 3LS4H 4MXQC 4IRZH 2AJZB 5E4EB 5ESQA 5IF0A 4EJ1C 3BDYH 4M7JL 2QHLA 4P3DA 2G9HB 4OTXH 3QUKA 4GMTL 5HHQA 3AB0B 4YHPA 4IRJD 1BFOB 4CN1A 3N1PC 4AEIL 2EYRB 4XMKL 2G60L 2IADB 1NGPH 4YQXH 5I1GH 1MCRA 4N90D 3QCTH 5HYJE 1D3CA 1XCTB 4PLJC 1BQHA 4APQA 1MHEB 1UGNA 3KYMB 4OM1H 3RFZC 4ONFL 1UWXH 4FFWD 3TM6A 2CO6B 5ISZE 4HD9A 1P6FA 2XY1A 4PJ8D 1T1ZB 4U1GB 4JZOA 5E08H 4XNXH 1OAYH 4NQCE 4KRNA 5JW4M 1F13A 2OMNA 5DGRA 1NCUA 3UJIH 1F11B 2FIRT 4LLQA 4AH2B 1BVZA 1HYRC 2FEEL 4JGUA 3HI5L 4WJ5B 1O7SA 3AGVA 1F2QA 3S3PA 1KXTB 3O3EB 3AAZB 3IDGB 3ALWA 1DFBL 1URLA 1IC7L 4WEBL 3NA9H 4WO4A 1LO2L 1T03H 1KIQA 2QLVB 3WNKA 3DUSA 4G42A 3FOLB 3SGKC 3SGDI 2J8UB 2PNDA 5C0GA 3VFSB 2MQCA 4U7SA 4L3ED 4FZ8L 4OGYH 3T0BA 3HC0B 3VXNA 1IKFL 3LPGA 4YAQA 2CH8A 3WJJC 5MENA 4K94L 1PY4A 5IB3A 1P4IH 4V1DB 3DRQB 3BUYB 3T3MF 4MX7B 2OTPA 3B2VH 4R7NB 4C57C 3D18A 4JM2F 2ITDA 2ZUTA 2XFXB 1SEBB 4K71B 1YEHL 5ALCH 1BZ9A 4JFFA 5I8OH 2A6IA 1INDL 5HGHA 5IT2L 1IM9A 2HLFC 4X6BA 4QNPE 4JQIH 1A4KA 3MFFA 1UWGH 3HE6A 1YYML 4NHUB 4ZMAT 4LIQL 1CDHA 4MD0B 5CZXD 4DAGH 4NUJA 4CNIA 1KUMA 2EXWC 1JPFB 3REWB 3DGGA 2DQDH 5DK0B 3CMGA 4NYLB 5HDBF 5A2LH 5I0DA 4NP4L 4POUB 2RBLA 3O8XA 4JFXA 3RZWA 3FO1B 1QRNA 4Q6IC 1F6AB 3RWIB 5DRWA 4TNWF 3FQNA 4MDJB 4U1MB 5E8DL 3C6SB 4C4KO 3BKJH 1AR1C 4PUBH 4UIKH 4KK8C 1QSZA 5E6IC 5AWNL 1VACA 3H9HB 1RZKL 2ZUQB 1U3HC 3MV8A 2QQLH 1BLNA 2W65A 4P59H 4HUVB 4NJ9H 2YEZA 2E6JA 3MRKA 4HIXL 4OD1H 2KQNA 4KMTL 1IQWL 1HHIB 5B39A 4P23A 3FT2B 4RISH 3QXAB 3U7YL 4P48A 3CLFL 4BH7B 1T5XB 5M7QA 1BWMA 4EKXA 3GZKA 4APQC 2Z93A 3F8UB 2Z4QA 5DHYA 1OHQA 4FOMA 4E41E 3IT8D 5CJOH 3MGTA 4U1IA 5ICYB 1QVOA 5CJXA 4XH2B 3V7AE 1AI1H 2OTUA 1ZA6A 3DI3B 4XP1L 1R3JB 1ZT7A 1QZ1A 4Q9RL 4WW2B 1ZKAA 5F97E 3RWJB 4MAYB 3HHRB 2WUBH 3MNVB 4O02H 2BRRH 4UV7L 1FNEB 1CD1B 2AV7B 4U2YA 3B3IB 1W8NA 1NGXB 1S3KH 5FOJA 2NW3B 3VGEA 5CZVL 2E8ZA 4Y5YB 4UNVA 4M43L 1C16A 3RNQA 3RGVA 3V0VA 4BELD 3L1OH 4WO4C 5I8KH 3IDUA 3RVVD 3KYOB 3AROA 5GISL 3HI6L 1NGZB 2I60H 3ARFB 2GFBB 2J2ZA 3IKCA 4L4JA 3OHXB 1LEIB 1YQVH 4S1QL 1YA5A 3L5WA 1VFOA 3RNKB 2HTLD 2X4OA 2FATL 1P4BL 4RFNC 2PXYA 5HYIA 2HRPH 3MLRH 2F5AH 1QKZL 2BSRA 2H9GA 5IBUB 4DVRH 4OCLC 5CEYB 3WFDH 4PJ7A 4MVBC 3MCLH 5D2LB 1X7QA 3V7MA 4XC3L 3HKFA 4ZTPH 5J0BA 5AUMA 1UB6A 4PJDF 3HE6C 1EVTC 4QXTB 4Y2DB 2NXZB 4Y88A 4WY7L 1M7DB 3LEYH 3MLXL 3P40A 3KPQA 3TO2A 1RJYA 1G6VK 1BZ7B 5DQJB 1DVFB 3QUXA 2A6DB 2Y5TB 4UILL 5EUKA 1MVUA 1YYLH 2HWZL 2JE8A 3LV3A 1CDCA 3O8XC 4F80A 2QBWA 5JXAL 1TNNA 2VLLB 2O5XL 4GBXA 4TPRL 1UFUA 2CUIA 3PG2A 3DVGB 4M1CD 3Q3GB 5DO2D 2X44D 3H9SB 4WWKA 4NBXB 2JCCF 1IAIM 2PCPA 5JO5A 1HINH 4ELMB 4LCUA 2YPLE 4WDIB 1ZT4B 4PBVC 3E2HC 3ZMRA 1DQLH 1C1EL 4POZC 4G9FE 2PN5A 4QY8B 1IGYA 1R5IB 4I0KA 4MD4A 1KYOK 4H1LG 5HYSB 3MRBA 4PRDA 5EB9A 4DZ8A 2X70A 2OR9L 4PLNC 3LKPB 3I6GB 1KCSL 4K3EL 4ZTOL 4WI2A 2B4CC 3BJLA 1OWWA 1F3RB 3UO1L 3MRIA 1Q0YH 3VFGH 3C8DA 5CJXC 1BJ8A 2MCPH 1I8MB 1NC4B 1KJ3L 3KPLA 5JMOC 4CJ0A 3ARGB 3G6AA 3RZCC 2DKMA 2YUVA 3T08A 4PJ5B 4LGPB 3ILQD 1FNGA 2J6EA 4PJBA 1G7LA 3LKOA 4PLKD 4X8JA 4NNXA 4HS3B 2XQBL 1VADA 5HHPA 4FTVD 1WFTA 3CPLA 1M6OA 1LDPH 3NH7L 4U1LA 4PJIF 4MXWH 1I1AA 3FB7B 3O4OB 5BRZE 5GZND 4ODVH 1F4WL 3QEQA 5DWUL 5HDBE 1AXTL 3UTTB 4MA3B 4JKWA 4TSCL 4OZHB 4BZYA 4XPGH 5DRXA 5GRUL 1NJ9A 4IHOA 1NQBA 2EE9A 4JGMA 4H8WH 3HZVA 2Q76A 2ZKHH 3P30H 1CR9H 4QWWC 5CMAA 4BFBD 3QB7C 4N90E 4M3JA 3HNVL 1N59B 5KW9L 4LRNL 4RNRB 4WFGD 4ZO6A 2NY1B 5C0AD 5FYJL 3QUML 1FL5B 4LVNC 1ZLUK 3O6FB 1NBQA 3TLRA 3QUXC 4PRPD 5J89A 1CICA 1HHHA 2P43B 1PG7X 2VSDA 4TVPD 5JTWA 3RVWD 3RJQB 5GS3A 1NFDE 3EYVB 3CXHK 4WCYL 2XTJD 3LN9A 4GBXC 1EFXB 2PTUA 3I2CL 3FO2A 1J11A 3P9MA 1IVLA 3NZHH 4XBGB 1DANT 1MWAA 3CFEB 2R4RL 3DARA 3NIDE 4OZGB 1B4RA 1LP9F 2OL3A 5DI8B 1RHHA 3BZ4B 4F57L 3ULUH 1IILE 5DZNA 3PHSA 3W2DL 4MQ7A 4RWYH 3UTZA 2CLZA 1S8DB 2DB8A 2HP4A 4Y1AD 4L3EE 4M6NH 3TBVA 4PR5B 1RZIA 1CL7L 3ZYZA 4NO5A 1O7VA 2APBA 3V5DA 2NY3B 3AREB 2HTKD 4E41A 5EWIH 5CWSB 2W60B 4YE4H 1TVHB 4AEEA 4M5ZL 2H26B 1RVFL 5E8EA 5C0ND 1I8IB 3FONB 4PP1C 1U8QA 3LQAH 1IL1A 4DW2L 4PBXA 1ZANH 3T1WA 3DXAD 5D9SB 2X4RB 1RZJH 5EC1B 5IW1A 4K2UL 5FHAH 2OCFD 1LGVA 5GS1A 1CLZH 5JW3L 2FWOA 2BCKA 2VNCA 3BI9X 1CF8H 3CK0H 4HWZB 1SJXA 4PJDE 5DJAA 4OIIL 2A73A 4DTGL 3A6BH 2UWEB 2F53D 3VRIA 4FQCH 1FL3B 2F74B 4LVHB 1W72A 3IXAB 4R6UA 2AI0L 1LK2B 3KYNB 3TVMD 2ICWI 2UZIH 4PP2B 2Y7QB 3BH8B 3EYFB 4XGZB 3SKUD 1FZMB 1IGTA 3T3PF 2EC8A 5EO1B 1GL4B 4FFZH 4WI7A 4KROB 2W91A 3KJ4B 3DX6B 3G08A 4LFHD 2SEBB 4AENB 1A9EA 4MMZC 1CE6B 5ENWB 2Y06H 2BERA 1T7VA 1J0ZA 2X4TA 1G7HA 3V5HA 4TQEL 5BW7A 4YFLF 4E5XA 3S88H 3BQUD 2EE6A 3CFKB 4U2ZA 3QDMA 5K9QG 5BZWA 5FYKL 5BMFL 4WW1B 4U0QB 2X09A 4MNQB 5GGUB 4MWFB 1G1YA 3QWOA 5IGXH 4XNZC 4JM4L 4KDTC 1OP5K 2AEPL 3QXUA 1CICC 4K23H 5GS0D 1L7TL 1P53A 3VH8G 4HT1H 1R24B 3TA3A 4LASL 4XMLH 1MIEL 4OLYH 1BJMA 4V2BA 5IMKB 5H94A 5BJTB 4G9FA 3MGOB 4JN1H 3ALXA 4YBQC 4KQ3H 3EYOB 1E6OH 2YN3A 4L8SB 3VJ6B 2ILLA 3EOTH 1FIEA 4XHJD 1A2YA 3E6FB 4QHNA 4DN4L 3CFJA 4I77L 1S7UA 1A8JH 4Q9CA 3JWDH 4WIQA 4RAUA 5FHBL 5GGQL 3VFOB 5HGAB 3RA7H 4K9EH 5IEHB 4U1JB 3TZVD 3F65A 5GGSB 3MRRA 4MA8L 5D1XC 5E99H 3BYTA 3QZWA 3MYJB 5DK2B 1IMHC 5ECJE 3MUGB 1QR1B 5A2IH 1GZQB 3KPMB 5L7XL 1QTYT 4RSVA 1XGYH 5CBAB 2AAVA 4JM2A 1WJ3A 1SVCP 3H7LA 4PJXF 4XNYH 1BQHG 3RWEA 3SGEI 3PIQB 1FNSL 3QFDB 3MRJB 1WWAX 3UYRH 1LO5A 1QLRA 3OJ2C 1D9KD 3B6SA 5C0EB 1XGRA 3OR7A 3RWDB 5GS1C 2HJKB 2N1KA 4UI2A 2YXFA 1WC7A 3MO1B 3VG0L 4XP9L 1CGTA 2JK5B 3PHOB 3Q1SL 1BFSA 2IH1A 1C5BH 5MERB 2BNUB 2MPAH 5DT1L 1DUZA 4G6MH 4MS8D 3V95A 1XZ0A 3HC4L 5F8QC 3ULUE 1FC2D 3GSXA 5DVNA 1N5YH 1CZ8L 3UJJH 5LJYH 4MQXD 3U7WL 1FRGL 3W9DA 5ICXB 5LKNA 3GSQB 4YIQB 1YEDB 4ODTH 5I66A 2B4CL 4N9OB 5ADPL 3PWVB 3ZKQD 1TDQA 4NRYB 4OQTA 5GGTA 2VXTL 3QQ3B 4RWHA 2ATPB 5JDSA 4Y5XA 3S5LG 4HS6A 3VFWA 4F7MA 3GJEA 4H25B 3RBSA 1S7XA 4Z7UB 5DZOA 3TGXA 4N5ED 3BZDA 2HMID 4X4ZA 1CXKA 3WFCL 5DRZA 1LP9E 2YOCA 1BIIB 2BSTA 3Q5OA 4PJ8A 1F4XL 1Q94B 3HLAA 4GG6E 1JPGB 1CLCA 1FAIL 5D7LB 5F7NC 4J3OC 3Q6FA 4OD2B 5F88B 25C8H 1F97A 2FIKB 4N0YH 4UIMA 5DS8A 1FCCA 1WZMA 5J4MA 3VCLB 2A9ML 3MLUL 2R69H 1YY9C 3REVA 1QNZH 3TA3C 4PG2A 4L4VD 1E4XL 4PY8J 1D5BA 5GS0H 4IMKA 4FMKA 3SJVE 3TF7C 3QPQC 1P7QB 4IOFD 4UDUB 3SBWA 3OXRB 3FB8A 3OX8A 2GTZB 3KLAA 3VDBA 1XGTB 4I2XE 3EFDH 3E1F1 4GS7B 4L3EA 4FTVE 2A6KA 5EUOF 3LH2H 4G6JL 1AQDA 3ARBB 4W6WB 2FEDC 1NMCC 5EU6D 2EE3A 1BFVL 1X5AA 3HG1D 3QXVA 5F6IB 5CD5D 1XF1A 1KB9K 5I1EH 1H8NA 2V2XA 4W4OA 2ICEA 3V52H 1F58L 1IAKB 2V2TB 1JGVH 4HWBA 3EOAB 4NM4H 3LDBB 2D31A 4WFGE 1ZGLM 2HJFB 3LEVL 2IF7A 1AGEB 3JZ7A 1W2KT 4JM2C 5C0AE 3T65B 3T3PE 2XWJB 4ZSOE 5B4MD 1K6QL 1XF4B 4BSJA 1I7RB 4CVXA 2DAVA 4FP8L 3IF1B 4EIZC 2DQFB 1WGOA 4PJDA 1X5GA 3MQIA 4PRPE 5FAAA 1FN4A 4TVPE 1A5FH 1JGDB 1EGJA 5GRJL 3BE1L 5BXFA 2VZ3A 1WVZA 5IMMB 2XTJE 3QO1A 1IAII 3EJZD 4PGDA 5EPMA 5I74B 1AKJD 1MCQA 4XP4L 1FO0B 2EXYC 2I5YL 4D0BB 4DGYL 1EH9A 2DLEA 4ZDHB 3KYKL 3DUUA 3E8UH 4MZ3A 1IRAY 3HNSH 2VJXA 4K3JH 3OKDA 4KWUA 1GVIA 1U8JB 3Q0HA 3TJEL 4IRJC 2XN9B 3W81A 3FB6A 5DJ6B 1KN4H 4Y1AE 1UWEL 4U1HA 4JO1H 1L6ZA 1KELH 3U30B 1DLFH 4ZFOL 2JCCA 1MCPL 2X05A 1FFPA 1JWSB 3GNMH 1U6AH 4JY6A 4JHAL 1A0QL 2HT3D 4U1NB 3EYUL 4FNLH 1Z9SA 4QTIL 2IPKA 5A3ID 2E6PA 4PJ8C 1ZLSH 3T2NL 2HLAB 4DN3L 4DVBA 5FCUL 5BVPL 1J0IA 2CDGA 4ISVB 2CK0L 1G7JB 3L3IA 3QO0A 1T7YA 4N0RA 4QXUL 1FFNA 5C6TH 1OGAD 3EUUA 3VGAB 4PJEB 3DXAE 5JLZB 3IFLL 3SDXB 2H45A 2R39A 3S37H 1PYWA 3PJSB 1Y6NR 4PG2C 4CVUA 3MACL 4IMKC 2VR5A 1S9XB 1YEJL 1JV5A 1RULH 4BM7A 3MRHB 5KVFH 2VAJA 1I8LA 3GMNA 4Q6YA 3NGBC 2F53E 1ITBB 2ZZUT 1I1FA 1Z9LA 4PJXE 3QHFH 3KPPB 3WDHA 3AU1A 4YDKL 5JUEL 1LEKB 4ODHH 2DQEH 4GKSA 1KTDB 4F58H 4XCCH 1KB5H 1Q0XH 1N5AB 4P3CH 1DBKH 5JZ7D 3QG7L 1EMTL 1O0VA 3ZTJG 4L5FH 4PJIA 3JTTA 1RIVH 4BZ2H 3L5HA 4Y2OA 4W4OC 5DR5H 2HFEA 3I84A 3VD4A 1MNUL 3VA6A 5HDQH 4I13B 2H3NA 5I1AA 5SV3A 1TXKA 5CZXC 4ALAH 4N8VB 1A7QL 1ZV5A 2Q8BL 5T1MA 3L95B 4NJAL 3DO3A 1EERB 1NLBL 3OKKB 4H0IA 4XMPH 4KVCH 5T5FL 1H3PL 2RFXA 1ED3A 3KHQA 1OCWL 2EIEA 5FUOH 3WLBB 1Y0LA 3V2AR 3WHE1 5GGSY 1TPXC 1NLDL 1T1WA 2OL3L 3G6JF 3VXSD 3PXHA 5EN2B 1CD8A 4OLZH 4JKPH 1P4LA 2X1QA 5I76B 3WL9B 1ZT1A 4JQVA 1OTSD 4OB5L 3RUGF 3MMEB 3QPXL 5TDOA 5ESAA 3UPRB 2DI8A 1OTUD 4FQXB 3GSUB 4WTXA 3IJYB 4OT1H 4NN6C 4YBLC 1NBZB 4GSDH 4S1RL 2DYPD 1HQ4A 5EOQH 1G7IB 5GRVK 2BNQE 4MD5A 4MSWB 2C3VB 1DE4B 2EKSB 4MMXC 2MFNA 2EDHA 3CVHL 3IRZA 2VISB 4YHKL 3WUWB 3SDAB 2ZCHL 4XWOD 3O2VL 5BVJA 3TWCL 4ZUVB 2J6EH 3BISA 4EDXB 5DMIH 1Q72H 1T04A 3D9AH 1K2DB 1LP9A 1QBMH 3ZKSD 4NHCH 4YWGL 3TN0B 5I1LA 3L7EB 3T8XB 1EJ6A 3IFOB 1MFEH 1AFVL 5FEBA 1IGFH 1IBGL 1KTLB 3ARDD 3NPZB 2IWGA 5BO1L 1VKXB 2DLFL 1RFDL 3PABB 2O61B 4OZIF 5F89A 1K8DA 1F3JB 1D5XB 5T1LB 2F58L 3D39B 3LS4L 5MHSD 1IC4H 3HE7D 5DQDH 3RY4A 4PJFF 5BOPA 1B4JH 5DHVH 2R23B 4CN4A 4OTXL 5J11B 1W72L 5E8PA 5EBLB 2CK2A 5B38A 4XTRD 4AQOA 1QHPA 4NZJA 4WI9A 5I1GL 5B3JF 3RVVC 4TSAH 3JWOH 4I2XA 2YK1H 4M7ZC 4AIXA 4FTVA 3BGMA 2UUDK 3SGJC 4R4ND 2D2OA 2CPCA 5FO9A 2CIKA 1I8LC 4OM1L 5TH2A 4MQTB 5IV2B 5A43C 4KTDL 4G43A 1V3KA 2HTLC 4XNXL 2NX5D 4QGTA 5BCAA 2V2WB 3C9NB 3UJIL 3QYCA 4QF1A 1X4XA 1FAKT 4Z7OE 1MQKH 4D8PA 1T22B 1ETZA 4UQ3B 5CSBA 3SO5A 5F3BA 5AYQA 3OXSA 3B8YA 3FQTB 2V7HB 5C0DB 4HPOH 4JANA 3VD3A 1HKLL 5C0AA 1ODAA 2VAAB 4KI1A 4LQ1A 2BVQB 4HCRH 4HKJA 2ADGA 1LO0H 5IESL 2HN7A 3LKQA 1KJVB 4M6OH 3FTGA 2I24N 3MLYH 4PRPA 3EDJA 1Z5LB 2Z31B 3VXMD 2ENSA 4HC1A 3OV6A 1YECH 1LE5A 1JHTB 2R29H 1JI2A 2W9LA 4M1CC 2CDFA 2O93L 4ZS6D 5DO2C 5LG1A 2DKSA 1MCSA 3FOMA 3IDNB 4JO3H 4GKOA 4JQVC 4ONGL 4LKXA 3HNTH 4LLMB 1B0RB 3RY6A 3ZDZE 4L4VE 4PIRF 4EI5B 1Q9KA 1AJ7H 3ARUA 3LSOB 4J3UA 1ZA3A 1P84K 4Y1AA 1RJZA 4P2YA 2NNAA 1LILA 2VDPL 3FL7A 2B1AL 4WHDA 4JN2B 3OAYH 1CFNB 2DQDL 5F9WB 5GZOD 4XI5D 5J6GB 5HHVH 3HG1E 5DHXB 1UKQA 5F72S 3QJHA 3AS3A 3U4EB 5D7IE 4HIHA 3BZEB 4RGND 1QSFD 3WD5H 2J88L 3K0WA 2DQIH 5E94B 1A02N 3QWRA 2VDOH 3FQXA 2EIBA 1EK3A 5IM7A 1KPRB 3WIIL 3QA3A 4E9LA 2CD0A 2KZ1B 3HUJF 4XNQA 4LPTA 1VFAB 4WFHD 1MHHB 4GXUN 3BKJL 4BFGA 4NKIL 3VXUD 1ZHNA 1JK8A 1MCOL 2FECI 1CVRA 2X4PA 2R2HA 2CGRH 1QFPA 4NJ9L 5LAXA 4R3SA 3HRPA 1MELA 3DGCR 3ILQC 4XBEL 2JB5L 4HZLA 3C6LD 4Y8DC 4JPIA 5F7EH 4PLKC 3S3SA 2GITA 2GJ6B 3IAQA 3GUTB 4P57B 1GJIA 4OV6F 1KGCD 2X7LB 2C1OA 3MA9H 5MI0C 1EO5A 2F53A 4PV9A 2HT2D 1VGKA 1A9BB 4PJXA 3M1BA 4ORGB 4OQTL 1U93A 5GGTL 2OSLA 4JEGB 5GZNC 1KCVL 1E27B 4P2RD 1GGUA 3R0NA 2Q8AH 5F6HI 1SHMA 3M8OL 3HZYA 3FT3A 4GAGH 3NVQA 3QEUB 4EEEA 3I85A 3G6JE 2HKFH 2WUBL 2YD3A 4OCYL 1FP5A 3I3BA 1QFOA 1PX3A 4X5LA 5C0FA 4AYFA 1ONQA 5EIVA 1RAMA 3L9RA 4PJCF 2VLRB 3RUGE 1S3KL 5BQ7A 4FABL 3SQOH 3RP1A 2ADJA 3BQUA 1Z3GH 2LQRA 3CXDH 1U8HB 3ES6B 2FX9H 3U6RA 3CZFB 3N9GL 5DTFA 3T0WA 3BP4B 1IQDA 3IXTA 3O4LB 4XVUD 2AJSH 5MEPB 2NY2D 2OJEA 5KVGL 1AHWB 2NY5C 3WN5A 3W11D 4U1KB 1QRKA 3RVWC 4RZCA 2XTJC 3F7YB 1OGAE 3MXVL 4CUCA 5CCKL 3MLRL 4Q2ZB 4EVNB 1KCKA 1KBGL 3BPOC 4DVRL 4U6HB 1AXSA 3WKMH 4QRRA 1IT9L 3MCLL 3RY6C 4HH8A 4X98A 3V4VL 4RRPA 2EDBA 1DBMH 3AC0A 2IFFL 4X99A 4OCWH 1KEML 3N85L 4Y4FD 5E2JA 4PJFE 1EO8H 1JGLL 1I1YA 3SDDB 5I18H 2BVUA 3UBXI 3VD9A 4ZNCD 1Z9MA 5DJYA 4ZODA 2FL5B 5DJDB 5EOTB 2DTMH 5IR1A 3TZVA 2HTKC 1DEEB 1YYLL 1G7QB 1R6VA 2I07B 3WIHA 5B3JE 2CRYA 2YSSA 2OBGA 5C08B 5EUOA 3B5GA 4G9DB 2R0WH 3X3FH 3P4NB 5C0NC 1XR8B 5CP7A 2VUOA 2X42A 4PD4K 2VDLH 3CC5A 2QHRH 3VA2C 3HZMA 4ZUWB 5EORH 4LOUD 4Z76A 4NBZB 5C0RL 4GLRH 4YX2H 4X7TA 4QOKB 4NC2B 2BDNL 1P2CA 1D9KA 4JRWA 5A2FA 5DJ2B 1G6RB 5KN5A 2HFTA 3RIFK 1S7RA 1DP0A 1KULA 2VXUL 4PJHB 3UJTH 4TUOA 1G9MH 4N9GB 4K3GA 1IARB 4NFDA 1GCFA 2YBRA 1NCCL 1Q0YL 3LKSA 3TVMC 4OFPA 3VFGL 4M03A 2YUXA 2ZWLT 5DFWH 5L2KD 4Z18A 3VRLE 1UXWB 1R3KB 2B0SH 4LVOB 1J1OH 1AGCA 4LF3A 1WICA 4FQLL 4IOIB 1TTGA 3QDGB 2WNGA 5AD0B 3KXFD 2I26N 3S35L 1OF2B 2A6JA 2BY2A 4GQPH 3ET9F 2ENYA 2FJHA 2X4UB 4H1LB 1I7ZA 1V7ML 3BQUC 4ZUUB 3O6MH 4M7LL 4K8RD 3IFPB 5D2NB 2JKXA 2VKWA 5FKAB 1I8KA 2H8PA 4F7CA 1MF2H 3IDYB 1JP5A 1LDPL 2Z8SA 3BGAA 1TJIH 4MXWL 5E1AA 3EO1A 2R0KL 4NWUH 3SPVB 1CYGA 5GGVL 5GS0C 4EQ3A 4WGVB 4U4BA 5MHSE 4XPGL 1JNNL 3ZDXF 4DK3A 4YC2C 3FFCD 2IPTL 4UB0H 3IJSB 1X5FA 4J7RA 4L4VA 1YUHA 2NTFB 4IIQB 4X80H 5C0IB 3NFSH 3P30L 4FXKA 4J8RA 1A7BA 1ORSB 1YNTA 4ODSH 1CS6A 3PGFH 3LCYA 2FEEI 1XGPA 2Q7NA 2VRAA 4X6CF 5DEFB 4ZFZA 3V6FB 1SEQH 4EOWH 4IJ3C 3C8KA 3VGDA 5EU6A 3HG1A 4OFYD 3KPSB 2GY7B 4XNMB 3VFNA 2ORBL 1NEUA 4XVTL 2NX5E 3TZVC 3VFPB 1OSPL 3ZL4L 3ULVD 2C5DC 4U6XB 5DD3L 3QNZA 3WKNA 1NDGB 4I8DA 4LLDA 5FDWB 4AIZA 5JIKA 3VWJA 1I9IL 3O3AB 3NZHL 4HJJH 3W39A 3CDYA 1LO4H 4LP5A 2ZSWA 4KUZL 3ULUL 3PDOB 2HH0H 4RWYL 4X83A 3QJFA 5KS9F 1D9KC 2P46B 4ODXA 3R8QA 3KJ6H 3MV7B 4PRIB 1I85A 4PJCE 4ZOEA 3VXME 2FRGP 2IALA 1DANU 3CMOL 3QDHA 4Z95L 4MNGE 4KHXH 3DURA 3QULB 4HFUL 4NQED 2FSEB 5KSUA 1GGIL 4HKZB 4EI6A 4MS8C 1AKJA 3GMRA 3S7GA 5DA4A 1VFBA 5GSRB 4I18A 4OKDA 2BNRA 4HEPG 1MLBA 2ZSVA 3IDIA 4MQXC 2V9QA 5I1HH 5C3LD 3G6JA 3QNXB 1WIPA 3MRLA 4ODUB 4M48L 2F54D 1PZ5A 2X5PA 4GW5B 4YK4C 1UWXK 3ESVF 1INQA 3RUGA 3PHQB 4PGCB 4Y19D 5CD3A 2UZXB 3VXRB 5H37G 1NUNB 1L6XA 5H2BB 4Y4HD 4EN3A 5KVDL 3X12B 5EO0B 5D8JH 4N5EC 2HMIC 4R9HA 4I5BA 3MCKB 1CLZL 4NNPH 4RX4D 4CU8A 5E2WL 1FVEB 1QSFE 4CDGC 1I9JL 1A1MB 1U0QA 1VSCA 2QKIB 4U6VL 3WFEH 32C2B 5B8CB 4U31A 1CDBA 3Q48A 3JTSA 3A6BL 1MFAH 4L8DA 3FKUS 1L0XA 4WHTA 1UKTA 3TC9A 1F42A 4K8RH 1NCDH 2H1PL 4OLVH 3VXUE 4BKLB 5J57B 4FQ1L 3CFBA 2IBZX 4GRWH 2UZIL 2EDLA 4LLWB 2NW2B 4D0DB 5JOFB 1G7PA 3I6KA 3U4AA 4N0UE 4IOSD 2X4SA 43C9A 3QIWD 3GI9H 4JRXA 4PB0L 1T2JA 4FFZL 4XPHL 1MAMH 2ZOLB 5J6HB 4ETQA 5SX5H 3PQYA 4OZIA 3MZTA 3ULVF 4IOFC 2NLJA 3VD5A 2Y06L 3UYOD 4D9RD 2Y36H 2YD1A 1WAAF 1KGCE 4HGWA 4PLOB 4EDWH 4PJFA 4M7LT 3PWPD 4M61A 4AM0B 4U6YA 1QPPA 1JYNA 1EPFA 1JNLL 4FQQB 2HT4D 4N1HB 1B0WA 3KGRA 2ED9A 3G5XA 5IGXL 4HLJA 4Z7WF 2BSED 1ACZA 5BV7C 1N64H 1T4KA 5CD5C 4JFYB 5LWYH 1BF2A 1RY7B 2ED7A 4N1EA 4K23L 4YR6A 5J3HC 3EDKA 3O9WD 1RUPH 1YMHA 2E8YA 4HUXB 2NY6B 3BWAB 1S7SA 4NO3B 1IC5H 5B21A 4PJ9D 5H35B 4TVPL 2NY5L 1ZLVH 1YQ2A 4YHZH 1HH6B 2WK2A 3T4YA 1S7VB 1S7WA 2VLJA 3NOIA 4YNYA 5B4MC 1CD9B 1U2HA 5CJQH 3IGAB 2R2BA 3MOAH 2N7AA 3VXSA 2DWDB 4GAYA 5DJ8A 2X9YA 2AJYH 1I85C 1U36A 4KKBD 3GBLA 4LLYB 5GJTH 5FO8B 2IAND 5JW5B 3EJJX 5T3ZD 4LPWA 1P5VA 3RA7L 1P5UA 5HDOA 43CAB 5TQ2L 3EJZC 3S97C 4LLVB 3QDJE 5E99L 1TZHA 4ZXBD 4XB8A 4I18C 3VH8B 4JDTL 5EDXA 2DYPA 1UM6L 1TCRB 1XF5B 1T3FA 3LVEA 3L3KB 5IMLB 5B38G 2N56A 3UZQA 4UUJA 2E27H 1U58A 4IRSD 4JLRA 4Y16D 3GO1H 5FYLH 4JDVB 1XGYL 2LU4A 3KPNB 4XNYL 3M45A 5DJZB 4ERSL 1UACH 4NQDB 2FNBA 5EFIA 4Q6IB 1F2XK 4P5MB 3V4PH 3KPRD 4LEOB 2EE2A 3U7AA 1CLYL 4NIKB 1I7UA 4EN3C 5CKGA 1D5IH 2HT3C 5E6IB 3STLA 5A3IC 1YDPB 4A6YB 1N7ML 3NIFF 4NKMA 1DUYB 5DUPH 5D1ZD 3TH4T 5DVOA 5ESQB 1VENA 3K8LA 1N5YL 3U9UB 4DQOL 4P3DB 4R2GB 3QUKB 5HHQB 3HE7A 4XWGL 1QFUL 3FQUA 5F1IA 1J10A 4JY4B 1ORQA 4G8IA 4F7PA 4WHCA 4OAWA 3T4AB 3HUJA 1BQHB 3RAJH 4APQB 4FFYH 1S5HA 1VPOH 1V3JA 3QR2A 4OLXH 2IBZY 4C58B 3U2SA 3GJFA 1NH6A 3ZKMD 1NMBH 4S2SA 3CGTA 1MAKA 3RVTD 2MNUA 1EVUA 1EUTA 3TYFB 4JZOB 2CIIB 2AK1H 5GRYA 1DBJH 3ORJA 3OKYA 1S9WA 4RBPH 4I4WB 4LLQB 1A7PH 3HMXA 5L2KE 2KL6A 4B0MM 2XZAH 1CFSB 4YHLL 2VDML 4TULH 3D0LA 5FB8A 2FD6H 5JZ7C 4N0YL 2QSTA 3WXVH 2Y25A 4PJAF 5C7XH 1NANH 1X9QA 3NAAH 5HVWA 4WO4B 3KXFE 2YHGA 1KIQB 2MHAA 3DUSB 2R69L 1LO3L 7CGTA 1FGNH 1P69B 2HVKA 4WUKL 3OKMA 5GS0L 3ZE1E 5C0GB 3S5LB 2WV3A 5KZCD 2X9XA 3KR3H 3VXNB 3KPOB 3EFDL 4YAQB 5A16A 4GW1A 3LH2L 4PJCA 5DD6B 3VXMA 2BXZA 1HE7A 3D18B 4MNGA 5IBTH 1BZ9B 4MAUH 4GQ9H 5CIPA 3QDAA 2A6IB 3I9GL 5DD0H 4OCSH 5HGHB 1BQUA 4H0HB 1T1XA 3P0YL 5L6YH 1IM9B 1OTSC 1A4KB 3FFCE 3HE6B 1L0YA 1OTUC 2UVEA 4YPJA 1N6VA 1HXYB 5GIRA 5KAQF 4C83A 4CL7A 4LQFH 4NUJB 3V6OA 4Z0BL 1CTOA 4CNIB 4U3HA 2VDRL 5I9QC 1I3GL 4QRQB 3DGGB 4V1DD 2DQHH 4YDIL 1FYTD 1FORH 3WIHL 4GXVL 3NFNA 2AJUH 1I9RH 2AKRA 1MCWM 4UNTA 5HY9B 4EUPG 5TPWH 3Q6GH 4JFXB 3P11H 4XWOC 5IG7A 2ATKA 5E0QA 3G6DH 3GHBH 2DQUL 3O3DB 5CLTA 5DRWB 2NY4B 2X4NB 3FQNB 1ES0A 1H0DA 1UT9A 3X14A 3ULVE 3MRDA 3VXOA 4HAGA 4F7EB 5ITBL 1WAAE 4EUPH 1VACB 3O6KH 4XCEA 4K7PL 2I9LA 3ARDC 3KVQA 3MV8B 1BLNB 1MJJB 4JHBA 4XPBH 5GHWL 1KIPB 1XIWB 1MIML 2JB6A 5K9OA 4L8CB 5DJCA 2YEZB 2J4WH 3MRKB 3DMMA 3PP3H 4N0UA 3HE7C 3RL1A 4P23B 1M7IA 3E8UL 1CU4H 5JOPD 1C8PA 1YNLH 4F37K 3C6LA 2ZPKH 4CVZA 1A7NH 4K3JL 4MCYA 2BC4A 1DN0A 4ODBD 4XTRC 1ZSDA 3PWJB 3HPJA 3U36A 5DMGD 3IVKB 2Z93B 4JO1L 1KELL 1KLUB 3PV6A 3V6ZA 5JMRA 1SM3H 1T1YA 4R4NC 1RU9H 4DEPC 2AEQH 3MGTB 5KVEL 4I3GA 1U6AL 2P5WB 4NQEE 3MJ9A 2OTUB 1Z0MA 1JRHI 1ZT7B 4P2RA 2RQ8A 5MEQA 2JELH 1GH7A 1HXMA 3AXLA 5FYLE 1YPZF 5IB1A 2NXYB 4NCC2 5E6YA 2D7PA 4AG4H 5AYUL 4LCWE 4KK6C 4PGZA 4PBWD 2A0LC 2F54E 4UV4L 5C6TL 4XP6L 3DETD 1FG9C 4RRPG 1ADQA 5C0BB 3B83A 1F4YL 1C16B 3RNQB 1JF1A 3RGVB 1A7RH 3NCBB 3K81A 2R0LH 2PW1B 4Y19E 5ELIA 1F02I 4MAYD 1LE9A 5JPNA 3GI8H 4TTGA 4HPYL 3UTQA 3ILPB 1T0NA 3O2WL 4JVUA 5KVFL 1D5ZA 5C0JA 1QP1A 1E28A 4HSQA 2E7BA 3W5MA 1C5CL 2PXYB 5JR1H 4PRNA 2OZ4H 2K9UA 4M8VA 1AY1L 3QQ4A 2DQEL 4PJ7B 4ZS6C 4B7IA 1LEGB 1ACYL 5I0ZA 1ZHLA 1DBKL 3P9LB 5AUMB 4KKLD 3WBDA 3GBML 1UB6B 4UT9L 3NIFE 2EC9U 1RIVL 4XCFH 4BZ2L 2W92A 4DCQB 5HD8C 3QNYA 5BV7L 3O45A 5DR5L 1RK0A 5TGBA 4D9RE 4Y4FA 5JHDA 3DO7A 5I1IL 4S1SL 4HIJA 3TO2B 1RJYB 5C0CA 4HS8L 5ANMA 1H15A 3PWPE 4XMPL 1MVUB 4KVCL 3MLWL 3K80A 1KB5B 2ESVB 5GZOC 3PL6B 4XI5C 3AS0A 3VI3F 2R9HD 3BKML 4GBXB 2AK4A 5KSBE 3GMQA 4P2OA 4Y2DD 4RGNC 5IHUH 1JWMB 2VQ1A 4OM0H 4LCCA 4MB4A 4X6CA 2NXZD 4WWKB 1PKQE 3F12B 4OJFH 2XKNB 1UEMA 4OLZL 1QHOA 2E9BA 4HKXA 5I6XB 5DVMA 5JO5B 3CDGA 1DVFD 4RGOH 1UH4A 5CKAA 1L4IA 4LSQL 2MQ3A 1OAQH 4OT1L 4P5TB 4C56A 1WQVT 3RDTB 5DRNA 4LDLB 4GSDL 3VE0B 4Y5VB 2CLRB 4Z6AT 1AIFA 4WI4A 5LBSH 4PRDB 2EDXA 3C6LC 3QISA 4G8FA 3H9SD 2YZ1A 3TJHD 4DZ8B 4PJAE 3U0PB 3C2SA 3PP4H 2WQ8A 2Y4SA 3A6CL 1BVKA 3SOBH 4LLUA 4CBPA 4HWEH 4JZNB 4DUXA 3MRIB 1TFHA 4GKNA 3FQRA 1GHFH 3INUH 3D9AL 1N6QL 5T3ZE 4YXHH 4NHCL 1ZOXA 1SJEA 1MFEL 4HJGA 5KS9A 2CKBA 3MJ8B 4QHKI 4WW2F 1DDHB 3U79A 1H9VA 3OPZH 4XC1H 4X4ME 1XF2A 2YKLH 2DJ4A 2R8SH 1FNGB 3AS1A 3BRFA 2VB5A 3V0WH 3KXFA 4PJBB 1G7LB 1IC4L 3LKOB 4NQXB 5EU5A 4X8JB 4M62H 2VLKE 4G5ZH 5HHPB 1CGUA 4O2CA 3KPRE 1NC4D 3SKJL 2LAGB 3CPLB 3CH1A 2IG2L 1JYVA 1II4E 4U1LB 1I1AB 5GGRB 3V8OA 3ARGD 2MOVA 5IQ9A 1WIOA 3QEQB 4XVUC 3QRGL 4CMMA 4TRPL 5DYOA 1AO7B 2RB8A 5DVKA 2NY2C 1GGBL 4JFZH 5DHVB 3MBEA 4JG1H 3IDJA 3W11C 1NJ9B 1CIUA 1UJ3B 4O2EB 5HVHC 4F3FA 4MJ6A 4KMQA 3HZVB 5E00A 1MHPH 1FH5L 5IIEA 2WANA 3FFCA 1MFCH 4WU5A 3OZ9L 1YEKH 2QSCL 4QT5B 3KHOA 2R56H 3S37X 1QQDA 5HPMA 3UTTD 2APVA 5TDNA 5IHLB 1RZ7L 1U91A 1U42A 1MCNA 2R4SH 2A83A 3HFML 3MA7A 5F9DC 5IJVA 3GKZA 2GUOA 4Y4FC 1MLCA 4BQCA 4OFYA 5IMOA 1ZMYA 1HHHB 2R1XA 1BOGA 1U8MA 4B7LA 4LEXH 2DMKA 3QHZH 1WAAA 5MP6L 3FO2B 3GRWA 3P9MB 2CMRL 2NY1D 4LCCC 1YECL 2APTA 1MI5B 1S5IH 4X4YA 1Q1JL 1MWAB 3BZFA 1VDGA 3O6FD 4JFPA 4Z7QF 5CHNA 2OL3B 5D5MB 2G5RA 5EU4A 1MUJB 4U3XA 1CXFA 1RHHB 5C07D 2DQTH 4Z7WA 2IPUG 1OAUL 4MQ7B 3UTZB 4LOUC 3EHBC 2CLZB 2B39A 4PRHD 2Z91A 1RIHL 4M6MH 3U4BH 2LTQB 1EFXD 4KJWC 4NO2A 1G9NC 3EOBA 4Q0XL 2IAMA 2B1HH 4NO5B 2IJ0C 4G7VH 4OGXL 3BKYH 1BD2D 4LAQH 5DK3A 2DLHA 2VMFA 4KJYB 4WEUD 4X9BA 2PTTA 5CFHA 4OLEA 5IOPA 2J8UE 3C5SA 1B2WH 2YMXH 3BP6B 4NRXA 4I48A 1PLGL 3E6HA 1IL1B 3K8KA 3CVIH 4PTTB 4KHTH 4NDMA 4WHYH 1DTUA 1NEZA 1QLEH 4X7SH 3RJDA 1IEBB 1KJ2L 2NY3D 2F54A 3ARED 3K1KC 3A67H 1E0OB 4V1DE 4HBCL 5I19H 4P9HC 4CVWA 2R0ZL 2ZCKH 4Y19A 2P44B 2P48B 3QSKB 2XT1B 1S9YB 1E4JA 1HEZA 2FWOB 2BCKB 4LU5L 2VC2H 2AJVL 2DDQL 5DJAB 4PS4H 3GSNH 5ACLA 2A73B 1R5VA 5EG6C 2ADIA 3GIZH 4X7EC 3VRIB 4K8RC 1VA9A 5ID0A 1IGIL 2RIKA 4JJHA 4KZEH 3CFCH 4URTB 2YWZA 1I3UA 2ZJSH 4J6RL 5I30H 4NO0D 1D6VH 4E0RB 1OM3L 3QG6A 2EYTB 2Q8AL 3WSQH 2OJZH 4LSVH 2Z92A 3U1SL 5JOPE 4ZO9A 2AERT 4GG8B 2MTPA 3P9WB 4ONHA 1DQQB 2WUCL 2X4TB 1ZS8A 1IGMH 1KLGA 4E5XB 2YPVH 3QDMB 3DYOA 3SQOL 3BD3A 3PWPA 4DUVA 1Z3GL 2OX5A 4KROD 3CXDL 4NN5C 2FX9L 1I75A 1WZ1H 1HIML 1O5DT 2W9EL 5I1KL 1UA6H 3C5JB 1ZHKB 4UOW1 4DJMA 3ULVC 2VDNH 1PKQA 1EEQA 3Q5YA 3O9WA 2V5RA 5ICZA 5H94B 4PJ9A 2BRQA 5B3NA 1U8IA 2P7TA 4OZGF 5JIHA 2VZ1A 3LY6A 2HFGL 3TEUA 2GAZA 2FR4A 5I17A 4AL8H 1KCRH 1CFTA 4KTEH 4X5XA 3RHWK 4KU1A 2C7UA 2OMBA 1A2YB 4QHNB 4JJ5A 3CFJB 5FKPB 4PJAA 1DBML 3BPCA 1GOHA 3BPLC 4UINH 2IAMC 4RAUB 4KJQD 3RTQD 3LS5H 1HOCB 5A2JH 4N68A 4XPFH 2IANA 1WTLA 2BVYA 2WBJA 4QRPD 3RIAK 3WS6A 4O9HL 3L3DA 3MRRB 5IB4A 3QHTC 1GPOL 2DL2A 1UCBH 4ZXBA 2LAAA 3TPUB 5IB5A 3MBXH 4R4BB 4JZJA 3UBXA 1I4FB 4CMHC 2E7LA 3BIKA 3FN0H 4JM2B 4TUJA 3CSBA 4Y7MA 1JWUB 4HZAA 2VDLL 4IRSA 4Y16A 4PG9A 4LCYA 12E8H 2QTEA 4IS6A 3W9EA 4AMKH 1QLRB 5I8EA 1RUAL 3B6SB 5EC2A 4YX2L 1XGRB 2EO1A 3OR7B 5I1CL 1UZ6F 3KPRA 2K1MA 4YZFF 1WC7B 5D2LE 2AEWA 1KPVB 4Y4HC 3UPAA 4O2FB 3BEWA 2H41A 2VYRE 1JJUA 4HIIB 1ZGLA 4Q97A 4ZUSA 3K2MC 3UJTL 3GSXB 3P77A 5D1ZA 1G9ML 3ARSA 5T3XD 1IAIL 4H26A 4UAOC 2W0PA 2YD2A 2AP2A 3MUY1 3STZB 3OKEA 4WTZA 4Q7DA 4KPHL 4BUGA 1J1OL 4P4RA 4OZFA 4MB5A 4Y5XB 4HS6B 3VFWB 3BVNB 3H9SE 3QIBD 2CUHA 5GGRY 5DRZB 2LV4A 3BPNB 2BSTB 4PJ8B 5T1DL 2G9HA 4ELME 1IE5A 1P1ZA 3SKOA 2F8VA 1JMZA 1BFOA 1JRHH 1J0HA 3Q6FB 3ZKXC 2HT4C 3OBAA 1XCTA 4X6DB 2XXMB 5DS8B 3QEGL 1MHEA 4XNUL 3KYMA 5DD5H 5F71A 4G80B 4R97B 3BXNA 3O9WC 1AP2A 4GW4B 4L9LB 1T1ZA 2EKJA 4PJ9C 5D7LD 4UBDD 1YPZA 3I50L 3FB8B 3OX8B 1F11A 3B43A 2DIBA 1YNKL 3KLAB 4X80L 3VXTA 4NWTH 2A6KB 3BH9A 3SE9L 2BHUA 3PGFL 1AQDB 3O3EA 1TTFA 3AAZA 3IDGA 4BQ9A 2NY7L 1U95A 1SEQL 1MPAL 2LVCA 3PE9A 5IK3A 3NCYP 1DJSA 4KKBC 3FOLA 1MFDL 3WS6C 1CBVL 1P7QD 1DQMH 3F62A 1KG0A 2ICEB 3HC0A 4LARH 3VG9C 3ARBD 4ZXBC 2DQJH 2IGFH 1OAKH 4P9MH 1N0XL 3MJ7A 2D31B 2I25N 4JZJC 3OGCB 3UTTE 5D72L 4MX7A 4R7NA 1FYTA 4HMEA 4OZHE 5DURB 4DKEH 1SEBA 1LWRA 4IRSC 4Y16C 4JKKA 1I7TA 3L3OA 1LO4L 1KEGL 1TPXB 4F8TA 1FN4B 4LSTH 3T09A 4L1HA 4X6FB 5BXFB 3DX7B 4KK5D 4I1NB 4LSRL 1UM5L 5I16B 1LK3H 4PGDB 5EPMB 5IVXF 3K4ZA 1CGXA 4JR9L 3RU8H 1GC1H 1G9NL 4NYLA 1JNHB 5D1ZC 2V7NA 3VRJB 3WS3A 3K2UH 1PEZA 3FCTB 2DLTA 2VDQL 2XPGB 4MLIA 3DVIA 4GUPA 1F6AA 2X4QB 5I1HL 5J7CC 4U1MA 4U1HB 1X5ZA 3MOBH 5T3XH 3EIFA 2JCCB 4KGJA 1FFPB 2ITCA 4KI5D 1A6VH 2CKBL 2W0FA 5JXED 1VERA 4JY6B 3BD5A 1OPGL 5K59E 4Z7UF 4HUVA 4AIOA 5E4EC 3BAEL 3ZKMC 3SDYH 4OZGE 2IPKB 3F5WB 1Y6KR 4HJ0D 3D2UD 1T6VN 3AB0C 3FT2A 3MXWL 1B88A 4P9HL 4DVBB 4RDQG 1IJ9A 1XFPA 3NA4A 3QO0B 3L3IB 3BIAX 5DJ0A 3WFEL 4BH8A 5FUCE 3SO3B 2GTWA 5DD1L 1M7XA 1MFAL 5HYJD 3ELAT 5JORA 2V17L 1JMXA 1DBAH 3S4SG 4FZEL 4XAWH 1V5JA 3B5HA 4K8RL 3MLPA 5K9JH 1PYWB 1F8TH 1UCTA 2EDKA 5D93B 3ZLQC 3CSYB 4FQHA 5HTSA 1ZHBA 4I0PB 1R3JA 3GI9L 4MDIB 4YEFA 3I02B 4WW2A 4Z9KB 3T1FA 3MNVA 2FBJL 3VGFA 3GMNB 2D03H 3JV0A 3B3IA 2M1KA 4TVSa 3AU1B 1NGXA 1RQ5A 5DSCB 3GSWA 4Y5YA 4UT6L 5ALBH 1UZ6E 3IU4L 1NC2A 4LRIA 4HH9B 1E6JH 3P4MB 1OAXH 3V9FA 4PJIB 3JTTB 3PNWB 2GFBA 3FHQA 1VGEH 2UWEE 4ZAKA 3OHXA 1YMMB 5JQ6L 5LWYL 1LEIA 5J8OA 5I1AB 3OAYK 2IQAA 5IB2A 5JA9A 3RNKA 1ZAGA 1CXIA 5T1MB 3V79C 4NRZA 3QCVH 2KKQA 3ULVL 4TOYL 1AGDA 3BKCL 3EYSH 3GRWL 1RURL 3QFJB 4TSBH 1ED3B 4F2MA 4K71C 5CEYA 3L6FB 2MKLC 3RVXD 3K1DA 1MJ8L 4N8CL 1BQLH 2VH5H 1EAJA 1T1WB 5SWZB 3B4NA 1GIGL 4Y2DA 3EZ8A 5FM5M 1HQRA 3K74B 1CK0H 4OBSA 2A77H 3D25A 1P4LB 4G7YH 1FGVH 3TBYA 3THML 2AJYL 5TDOB 2P8LA 5ESAB 3FRPA 4TUKL 2WWMD 1DVFA 2XG5A 4H20L 4MNQE 1HQ4B 4DK6A 4I3SL 1J5OH 3BMWA 2FGWH 1YEIL 4MD5B 4ZFFA 2EDWA 1S9VA 2G75B 2WINA 5HHOB 2VLLA 1JPSH 3Q3GA 3RX5A 4FXGB 3H42H 5EOCH 3VMNA 1UEYA 3H9SA 1OAZH 1JGEA 2E27L 2OLDA 3GO1L 4PREA 5FYLL 6FABL 1T04B 2ZUQC 4FQXD 5DMGC 1BJ1J 1QLFB 3FFDA 1HHJB 4WDIA 5I1LB 3BRGC 2HKHL 1TVDA 5CZKA 2D0GA 2FO1A 1ERNA 5KG9B 3DJ9A 2IMNA 5B22A 5CP3A 1QPXA 5T33H 1R5IA 1FO0H 1ZVSA 3LHPL 4R4FH 1A4JB 4JO2L 2NY0C 4UT7L 5F89B 1HDMA 1K8DB 3SDAD 5EZOL 1UXSB 2FJFB 3EO0A 3BN9C 2GYSA 4PJEF 1JYXA 2A9NH 3TN0D 1H3XA 1F3DJ 4OCXL 1HZHH 1MFBH 3DETC 4NUGL 2CJUL 2FECL 4U0RB 5B38B 5TE7H 2YS4A 2CSPA 3MODH 1SVZA 5J06A 1NC4A 4I2XB 5C09A 3N1MC 4LSUH 1LNUB 4WW2C 5DFTA 4MAYC 3RAJL 1J87A 4HAFA 3FZUD 1VPOL 3S36L 3D48R 4G8GA 3WFBH 2CIKB 1Y6MR 5T1LD 5M95B 3ARGA 2AVGA 2XIDA 3D39D 2ADFL 3RIFF 1G84A 2P49B 5DQ9A 5SWQA 3MRPA 2YD5A 4G43B 1CFBA 3JV6B 4GJTB 5KJRH 3VFTB 4Y5YC 2FJGB 5T3XE 1BBDL 4HS3A 3VFVB 5HHXH 5KSVB 1A7PL 3KNBA 4LRIC 2P5EB 5F9JA 4QF1B 1KNOA 4D8PB 5J56B 2WIIA 3RWGA 4ZAKC 4KKLC 3MLSL 5IVXE 1W0WA 4Z7NF 3UTTA 4MA3A 3FRUB 4HF5H 5FK9B 3ARZA 2IQ9H 2VDKL 5EZIH 4LNRA 2OXHA 3RGHA 1FBIH 4RMUA 4C59B 1MOEA 4FQ2H 3TBTB 4G3YL 3FTGB 4NSKB 3G5VB 3FO9B 1NDMB 3SCMB 1OY3B 2R9HC 5CEZD 1X5IA 1I1CA 4Y2DC 4X7FC 4WV1A 4Z7UE 1EZVX 1E4KA 2NXZC 1P7KB 3FOMB 1FL5A 1AR2A 1CT8B 2QQNL 3GSOB 4NOFA 1Q9KB 3T0EB 1DVFC 5C07A 3B9KA 4RFOH 2GIYA 4XT1C 3EOYG 5D7LE 1ZA3B 2VXVH 2Y72A 4JPKH 4PRHA 5T3ZL 1EEZA 1HSBA 2Q20A 1EFXA 2NYYD 2DQHL 4OLWH 2XRAL 4XZUA 3MYZA 1FORL 4XBGA 3TJHC 1BD2A 5ADOL 5DUML 4MLSA 3GIVA 3O6LL 1UG9A 4HIHB 3CFEA 4OZGA 5EZLA 5DI8A 3P11L 3FQXB 1SY6H 2VZTA 3MJGX 1YJDC 2EEAA 4XNQB 3MROB 2GSGB 3O6KL 1ZEAL 1ZHNB 3STBA 3WE6A 1UQSA 4KV5E 4MJIA 1NCWL 4XPBL 4R90H 3TT1L 3MRMB 5LAXB 2W60A 3KWWA 1FIGH 2J4WL 1JF5A 4S1DD 4M1DL 4HZLB 2EDYA 3VW3L 4GMSH 3HR6A 2GT9B 1F6FB 1CI5A 3DX8A 1UB5B 1I8IA 2ZPKL 3FONA 3GGWA 1NAKH 2D4DA 4EUPB 4PV9B 1VGKB 3S9DB 4YDJA 3M1BB 1IFHH 3RWHA 1RUKH 1QSEB 5FIEA 3ARGC 4N0FA 1RMFL 2OSLB 5ERWA 1TCMA 4F9PC 1BFTA 1BIHA 3R1GL 1RU9L 2AEQL 2F19L 4HXAH 1T2QL 2W9DL 4OD3H 4NO0A 3GMLA 4KRPB 3HAEA 4OI9A 3HZYB 3FT3B 2GJ6D 3TCLB 1A6ZB 4HWZA 1ITCA 4JFDA 3T0AA 1A6AB 3EZJB 1ONQB 2IH3B 7FABH 2F74A 4P5KA 4DUWA 3IXAA 5BQ7B 3O4OC 3IFNH 1LK2A 5L9DL 3TH3T 1NFIA 2ADJB 5BRZD 5IFHL 4KI5E 4PP2A 2Y7QA 3LOWA 4XGZA 1JI1A 5EO1A 5DTFB 2D7OA 4W68A 3LMJL 1IQDB 4NC0B 3DX6A 5DLMH 4AENA 3DVNA 3PWNA 2OJEB 1FFQA 5C6WH 2FX7H 2XN9E 5ENWA 4G6KH 3NTCL 3WN5B 1CTNA 1UZ8B 1NBVH 3QXWA 2VLRD 3TH2T 4QHLA 1INEL 4FN0A 4MA7H 4YC2B 5TE6H 4I3RL 4WV1C 3UBXG 1ZWIA 1RUMH 2NY1C 4LPVA 5EBWB 1JPTH 2OZ4L 4OI7A 2L7UA 1E4KC 1BJ1H 3OKNA 5CEZH 2VN4A 3DLQR 4FFVD 3S6CA 3O4LD 4QRRB 4WUUA 3LEXA 3O6FC 4I9WE 4X98B 4MNHB 3MRCA 3WV0A 3B9KC 2QADC 4X99B 2VXQL 1EZVY 5L2JB 3C60B 2OXGA 5KAQG 3G5ZB 4O51A 2CQVA 1I1YB 4YHMH 4OSUL 1F00I 4PJEE 4O4YL 3UTSA 3SDXE 1HI6A 1Q9OA 1NSNH 5DJYB 3RTQA 2WQRA 5IR1B 5JOEA 2H2SD 1J7VR 5BJTA 4QRPA 3MGOA 1V3LA 1MEXH 2YSSB 5SWSB 3GHEL 4YDVB 5EUOB 1E4WH 5ESVB 4L8SA 3VJ6A 4XVJH 5LGJA 4XP5L 1OQXA 2E5EA 3G04A 5FUCC 3PGCB 3UMTA 3CC5B 2N7BA 5EU3A 1D6EA 3HZMB 5CINH 5LXGH 3WO4C 5LCVH 1QFWH 2O26U 3MGAA 5D7SH 2Q6WA 2DQCH 3VFOA 5D70L 2NY3C 3U9PL 4RGOL 4X7TB 3AREC 5IEHA 2GSIB 5BOZG 3BHBB 3SDCB 5GGSA 1ZVHA 4Z8FH 1P2CB 1D9KB 1NAMA 5ITFA 5C08D 4HUNB 2F5BL 3OJDA 5SX4H 3MUGA 1R0AH 1QR1A 1S7RB 1RUQL 2H2PD 3RVUD 1OVZA 4OLUH 3KPMA 4Z7NE 5BS0A 4TUOB 1Y18B 1QBBA 3LRSB 4HUMB 4XXCA 3SOBL 4NGHL 2X89A 4HWEL 3WHE0 1EJOL 4HDIA 2XA8H 3LKSB 4QOKD 3INUL 2O5ZH 2PR4L 2KDGA 4FQPA 4IDLA 3IAGC 1OSZA 1MCHA 2HJKA 4AZ8A 4YDLB 5SX5K 4O5LH 4NN7B 3MO1A 1AGCB 4LF3B 4JVPA 4YK4B 3PHOA 3VMPA 3OPZL 1J86A 2PF6A 5IVXA 5HSFA 3FO0H 1ND0B 3TNMA 4OV5A 2R8SL 4M7JH 3QIBA 5IROA 3V0WL 5I15H 2FJHB 3H7BA 4GMTH 3N0PB 2WZPD 3SE4C 2V5MA 3M17A 1I7ZB 1GZPA 1QR4A 1NGQL 4AEIH 2G60H 5ICXA 1QBLL 4JFQA 3P73B 3MRNB 4YIQA 1YEDA 5IVNA 2VXSL 3PWVA 3R06B 4QCIB 1I8KB 3O2DA 1MRFL 2H8PB 4F7CB 4KROC 4FRWA 4LSPH 3DVFA 2VR4A 5TFSL 3QDGD 2X10A 1J9CT 5E1AB 3U0WL 1CGWA 2Q7YB 1WEJL 4H25A 4JREB 1MCCA 2AJXL 3NIGE 4Z7UA 3P0GB 3SE8L 3WIFB 3S34L 1ZLVK 4JFZL 3GM0A 4JHWL 1NFDF 4JG1L 1AH1A 4JDZA 5I2IB 2ZUVA 1Q94A 3MUZ1 1JPGA 5IVOA 5HVGB 4N5UA 4FXKB 5HPOA 4J8RB 2XTLA 1YNTB 3GDBA 5CBEB 3D3VA 1VHPA 1JHLL 3W0WB 2FIKA 2X40A 4JFEA 3NIDF 4PB9L 3GSVA 4CN6A 5AAWA 4ZFZB 4Z7VB 1IC7H 4WEBH 4ZD3L 3D39E 1LO2H 4DOHB 5EU6B 3RZCA 3VFNB 2C4XA 5GSVB 1FFOB 4EBQL 1ZXQA 1OOAA 4KJQC 5BV7B 3RTQC 5IEKB 5JIIA 3DUHA 3OJVC 1P7QA 3OXRA 2EYSB 4KAQL 2X41A 1MHCB 1IKFH 4LLDB 1XGTA 2OI9C 4LEXL 4UQ2B 1T83A 4L8SC 1KENL 3QHZL 4K94H 4JG0H 3VWJB 3ARBA 1FVCA 5CUSL 3ECBB 4R26L 3KPSD 5DDHB 2YR3A 1A3LL 3W39B 1NMAL 3P3YA 1INDH 1A3RL 5IT2H 4CAGA 1EHLL 2DQTL 4D3CL 5F7WC 1YYMH 5LGHL 1PG7L 2C4FU 4ZOCA 4LIQH 1WT5A 3QJFB 3VFUA 1N2RA 5I71B 2Y23A 3OF6D 3QUYB 1AGFA 3U4BL 1RIUL 2IALB 2V5SA 5KBNC 2QQKL 5HHMB 3EOAA 3BKYL 5CEZE 3DURB 3LN5B 2HJFA 4NP4H 5KSUB 2AW2A 1AGEA 3IETB 4XXCC 2BHZA 1AXIB 1VFBB 1KCUH 4I18B 1TVBB 2BNRB 1XF4A 3IDIB 3T2OA 5E8DH 3IF1A 1K5NA 2XWTA 4CJ1A 4WENB 3MV7D 3MRLB 3VDAA 4RCAA 1RZKH 1YJDL 5DUBB 1QLEL 5ABDE 1INQB 4X7SL 3RBGA 1QO3A 3AUVA 2FX8L 1G6RH 1YN6A 5I19L 4HIXH 3O0RL 4EN3B 3QIBC 5IROC 3ULUD 4RBPK 1IQWH 1SBSH 3U7YH 3UCRA 3F7VB 1X4ZA 3CLFH 3D2UA 1J05B 3QH3B 1BZQK 5JA8B 1VFMA 3TV3L 1M71A 2WWKO 1FCGA 2UZYB 3N50A 3TFKC 4WRLA 1QYGH 5HYJA 3CFBB 1JWSA 3MLVL 1J8HB 1G7PB 2X4SB 2ZJSL 43C9B 4PY7A 4XP1H 1D6VL 4JRXB 4LPCA 4Q9RH 4XPTH 2X1XR 5CLWA 5ISZA 1K4CA 3OKOA 3GSNB 4ETQB 2HLAA 4UV7H 4F37F 2XZZA 1FDLH 3PQYB 4KY1L 4OZIB 1A64A 1G7JA 4NQCA 4H1LH 4ZFOA 5CZVH 1YEFL 3GSRA 4PJEA 4M43H 2YPVL 4M61B 5E9DB 4B50A 4M3KB 2FB4L 1A47A 1QEWB 3S96B 3MRQB 4NZRH 4LCIL 3PJSA 5GISH 4TYUA 5C92A 3ARPA 4X9GA 4J3TA 1T4KB 2GJ6E 3SJVD 1RZFL 4YR6B 4ZPVA 4S1QH 2VZVA 5FECB 1YMHB 3HI1B 4JHZA 1T83C 2VDNL 2FATH 3V8CA 1P4BH 4ZNEE 3KPPA 1GOFA 1QKZH 3ARBC 1SYVB 3MRFA 1TMCB 1LEKA 3LN4B 1ZTXL 1KTDA 2Z8WC 6CGTA 4XC3H 1N5AA 1S7WB 2VLJB 4YNYB 5F6IC 4ETYA 4AL8L 1KCRL 1WT5C 2R2BB 15C8L 2R2EA 2NY6D 1U3ZA 3VXSB 4GAYB 5DJ8B 4WY7H 3JSSA 5T5NF 4UINL 2VLRE 5L8JB 2Y5EA 3MLXH 3CDCA 2L0DA 5J1SC 3GKWL 3L95A 4XPFL 3RPKA 3OKKA 3K3QA 3PP3K 4UILH 2NR6D 2HWZH 1TZHB 1WZKA 1CFQA 3ULUF 1XAUA 5E2UL 5I9QB 3O4LE 3WLBA 1KFAL 4TPRH 4ZUTA 1CE1L 5FCSH 3MJ6A 4UUJB 5J12B 4KDTA 1EDQA 5CEXA 4JLRB 1PD6A 2BVOB 2E9JA 2F9BT 5I76A 3WL9A 5EFIB 3FQWA 3MMEA 3UPRA 4NZTL 12E8L 4FQXA 5I74C 1C1EH 5ETUA 1LD9B 3IJYA 1I7UB 5JXEC 2A1WL 1G7IA 4AT6A 2ZNXA 3QQ9D 3EFFB 1ZK9A 3NCMA 4HJ0C 4NKMB 2WAHA 1DE4A 2EKSA 4H88H 2OR9H 2PYEB 4KDWA 1KCSH 4K3EH 4GG6F 4ZTOH 3SDAA 3U30C 3PDGA 1JUFB 1MCIA 3MLTB 1YY8B 3UO1H 4EDXA 3OJMB 2C3HA 2VOTA 3FQUB 3UP1A 1ORQB 1FV1A 4QXWA 3T8XA 2EIZA 1I1RA 1KJ3H 2DRUA 2EDJA 4OAWB 5E56A 4PGBB 2BOCA 3CCHA 3HUJB 3CFDA 3PXJA 5DA0B 3TESA 1KTLA 5D1XA 1S5HB 4NPYA 5C08E 4PY8I 1IAOB 4KRLB 3CVHA 4KXZH 1VKXA 2O61A 3PABA 5GJSH 4UDTB 4DEPB 4S2SB 4CADA 1D5XA 5E8NB 4R2GD 2XZCL 3VGAC 4JAMA 5KSAB 1AE6H 1S9WB 2OP4L 3C8HA 2XQBH 3T0XA 4QOKE 2R1WB 3JUZA 3JV5A 4RQQA 4GAJL 3U83A 1JRHL 3NFPB 3HRZB 2CUMA 1SYSA 3H9ZA 1KT2A 3NH7H 4ZS7L 4CKVX 1F4WH 5DWUH 2X1WL 1AXTH 5F7YC 4PJHE 5HI5D 3UTPD 1H3GA 1CVSC 2BFVL 5GRUH 4BA8A 1A6TA 5GRVL 5IV2A 2MHAB 3MNZB 3ARQA 3ZTNL 4KQ4L 1P6AB 5JHLL 1JF6A 3C9NA 3TYGH 4ESKA 5KW9H 4WWID 4LRNH 4NWTL 1MCKA 4GW1B 5ID1A 3TIDB 1T22A 1A6UL 4UQ3A 3QDGE 5J9PB 4HFWA 4WO4D 5FYJH 3QUMH 2YN5A 1JBJA 5FUZL 3DV4B 4HKBA 5CIPB 3PGDB 2VAAA 2PO6B 2YWYA 5D7JD 4DZBB 1Z6JT 5EZJA 2FHBA 3AM8A 5D2NE 3WNPA 1KJVA 4C83B 5C71A 1FPTL 5AZEH 4GRMB 1Z5LA 3I2CH 1OLLA 4F7TA 2DQJL 4QTHB 3GFUA 4WGWB 3NFNB 2J8OA 5IW3A 4Z77A 1JHTA 2AKRB 4CW1A 2YD8A 2DD8L 4B41A 2R4RH 1IM9D 4FG6D 5IG7B 4F57H 2ATKB 5E5MA 1XGUB 3W2DH 8FABB 1B6UA 1BEYL 4FQXC 4RGNB 2D4FA 3KLDA 3X14B 2YPLA 3VXOB 3SY0A 1PX4A 2DM2A 1YEGH 1CL7H 3HAEG 4XCEB 5I1DA 2I9LB 4KKCD 2BNQD 1BAFL 3CFIC 1NAML 2EO9A 2I27N 5HYQB 4JN2A 5D7KD 5K9OB 4LHJB 5EBMA 1CFNA 4FMFA 1NL0L 3SDAC 3DMMB 3O3BA 2WLZA 3KPSE 5D6CB 3U4EA 3KPTA 3BZEA 1S7QB 2NY4D 3C6LB 3QUZB 2H32H 5E94A 3TN0C 4CVZB 3JV4B 1GGYA 1DN0B 1MJUL 3OG4B 1ZSDB 3HPJB 2ZG3A 5T3XL 1MHHA 4K2UH 3BUTA 1FSKB 1XIWD 1JZ4A 1T1YB 3MCG1 2Y07L 3FZUC 4A6YH 4CDHA 3V5KB 3DX9B 1JN6A 1YEEL 2VABA 4P23D 5JW3H 4P2RB 3WEXB 5MEQB 35C8L