4E41B

Structural basis for the recognition of mutant self by a tumor-specific, mhc class ii-restricted t cell receptor g4
Total Genus 37
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
37
sequence length
187
structure length
179
Chain Sequence
RPRFLWQLKFECHFFNGTERVRLLERCIYNQEESVRFDSDVGEYRAVTELGRPDAEYWNSQKDLLEQRRAAVDTYCRHNYGVGESFTVQRRVEPKVTVYPSNLLVCSVSGFYPGSIEVRWFRNGQEEKAGVVSTGLIQNGDWTFQTLVMLETVPRSGEVYTCQVEHPSVTSPLTVEWRA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Immune system
molecule keywords HLA class II histocompatibility antigen, DR alpha chain
publication title Structural basis for the recognition of mutant self by a tumor-specific, MHC class II-restricted T cell receptor G4
rcsb
source organism Homo sapiens
total genus 37
structure length 179
sequence length 187
chains with identical sequence G
ec nomenclature
pdb deposition date 2012-03-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00969 MHC_II_beta Class II histocompatibility antigen, beta domain
B PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4e41B02
3.10.320.10 Alpha Beta Roll Class II Histocompatibility Antigen, M Beta Chain; Chain B, domain 1 Class II Histocompatibility Antigen, M Beta Chain; Chain B, domain 1 4e41B01
5J0BA 4ODSL 1MFDH 5HPMB 4LHQB 3WFBH 4MXQD 3T0EC 2QQQA 4M7KL 2Y72A 1G6RB 2W0PA 2AJSH 2X89D 1UB5A 1KLFA 3MA9L 3D1MC 4H1LB 2WAHA 7FABH 2R56L 3DXAD 3V0WL 1P7QA 4G80A 1GPOL 1QSFA 4AIOA 4YDJB 4GRWF 5JDSB 4OB5H 4LF3B 2MHAA 5F7HA 2NTSP 3UDWC 1FGVL 1JWUA 4EN3B 4KKCD 3LHPL 1BD2B 3BD3A 4XMKH 4JM2C 5EU6A 4NNPH 4PGCB 1FL6B 2DOCA 2A73B 3IS1X 4CVZA 3BO8A 4OGYL 2X1QA 3W82A 1ZA3B 1NLDL 1PLGL 2H2PD 1BFSA 3UJIL 4JG0L 2FGWH 3O6FD 3EO9L 5CSZA 4V2CB 4YDVB 1T80A 4CVXB 3ZDYF 5I8OH 5INDA 1YN7A 4UTBH 5F9JA 3VD3A 4N0UA 4JGMA 1I9IH 1RV6X 3QQ3B 1H8OA 5JPNB 3DYMA 3R1GL 3U2SB 2FBJL 4JRYA 1SJVA 2E8YA 4N8VG 3CU1A 5BZWA 4U1SA 4H8WC 1NEZB 3WIHA 3IU4H 3CUPB 3AAZB 1ZA6A 4UDTB 1M4KA 4QT5A 4XPHH 2BXYA 2DQFA 1NC4B 3ES6A 3QUYA 4XVUC 1K5NB 3PDOA 3SKOA 1U2HA 1CT8B 1QD0A 5CFHA 4UV7L 3SCMC 2NYYD 2NY4C 5E94A 1MCIA 25C8L 3O8XD 1I7UA 2V5YA 1RUQH 4L4TA 5JHDE 5C2BL 1RZJH 1J1XL 1JRHL 4OLZL 4FQJH 4Y0GA 2ORBL 3D5OF 1UXSB 3CX5K 5DQ9B 3U1SH 4OLEA 3QXAB 5T3ZE 4RX4A 5JHDB 1JV5A 5HGAB 1RK1B 3BISA 3HAEG 2VDML 3DHJA 5C0BE 5DEGA 1HHHA 2Z91B 4F15B 5EBWB 3LQZA 3VFUA 5C0BB 4NQXB 1M7XA 1JGVL 2XN9D 1YNKL 1XGQA 4DN4H 3MO1B 4XH2B 5DD0L 4Z76A 4G3YH 4XP9H 1JNLH 1KJ3H 2EYSB 1P9MA 2QHLA 3W9DA 1VESA 1ZLUH 4NUJA 5DJDA 3F8UB 4XBEH 3WFHA 2BNQD 4Q6IB 1OTSD 3CH1B 3T0XA 5IF0B 4PRBA 3NFPB 4PJGA 2OJEB 4HG4J 2K7PA 3EOBA 1ORSB 3ZKXC 1KXQE 4UOW1 1WLHA 2O5XH 3O3EA 4PRIA 1M71B 3JWOC 5CEYB 1JNHA 2PUQT 4BSVA 3VD9A 1VFMA 2Q1EA 4ODWB 5HDBE 1BVLA 1CDHA 4PGZA 4XAWH 3FTGA 4OZGE 5EIIB 4LARH 3SDXA 1BQLH 1HDMB 1FG2A 1UEMA 5TPWH 4YHYB 4HS3A 4C59B 1B0GB 1NDMB 1S7SB 2X70B 3I6LD 4I0CC 1H15A 4OZGB 4U0QB 1Y0LB 4YBHA 5TGBB 3QCTL 2JJTA 2NTFA 3R06B 3IDXH 3PV6A 4HIIA 3QT2A 5J4MA 5ICZA 3EOAB 4RA0C 3L5XH 4NUGH 1IAOB 3SE8L 4Q0XL 4F7PB 5AYUL 5FKPB 3D85D 3TNNA 1VFUA 3T77A 4XHQA 1ZEAH 2JCCA 1MCLA 4PB0H 1CXLA 4Q9BA 5IHZB 3RP1A 1JF6A 1IBGL 5IB1B 3MRLB 3O4OB 2AJVL 4CRPA 1OAQH 2DQDH 2HTLC 2O26U 2YZ1A 5DO2D 4PBXA 3S36L 5JOEA 3G5YB 4P2RA 1T2JA 5IVOA 3ZHKA 1WEJL 1EBAA 2B20A 4OBRA 5C0RL 4HCRH 5E2TH 5SWZA 2OTUB 3DXAE 4KVNH 5DWUH 1L0XA 3BH9A 4J1UB 1E4KC 4XNZC 3JUZA 4AEHL 3LAFA 3WSQL 3HZVB 3T1FB 3DXAB 4LBEA 3WDHA 3P40A 1TIUA 2RHEA 4KI5D 4UQ2B 2HMID 3RU8L 5JW4N 2FZ3A 4X6DE 1SBBA 1G7JA 5FV1L 1QRNA 4JCMA 4D9RE 2X1OA 3ZDZE 1X6LA 5L0QC 4NC0B 3M8OH 4OAWA 1YJDC 4JFXB 4OI9A 4X6DB 4JM4H 2Z31A 3ARGA 2CKBB 5BS0E 5D71H 4PRHA 4LLVA 2X2YA 3O6FB 2ICWA 5C0GB 4FMFA 5BS0B 4HQQH 1MEXH 3LKRA 1KULA 3V8OA 3ARED 4EQ2A 3RVWC 1LDSA 1A4KA 2ICWJ 2MCPL 1AHWC 3A6BL 2A38A 1R24B 3L95B 1RZKL 3BMWA 4WDIB 4XNXH 1LNUA 1TNNA 4CVUA 3BHBA 4J7RA 4OLUH 1T1WA 3PL6B 2E8ZA 2P5ED 1JPFB 2FO1A 2X4QA 1JK8A 3HNSH 4GAJH 4RMSA 4OKVA 1BIHA 1RZ8B 4MNQD 4ZO7A 3S4SA 1MFDL 4H25A 1MJUL 4J3OC 1OWRM 1I1FA 4ZPTB 1Q0XL 3FONA 3O2VH 3U4EA 2QHRL 4KK5C 2EECA 6FABL 2EYTA 1XIWA 3U0PA 4NBYB 1CD1B 1N59B 4NRXB 1IM3A 1L7IH 5CJXC 5AD0B 3TN0D 1BZQK 2X5PA 5BVJA 1I1AA 5JW5A 1IL1A 3VXRA 1AD9A 4PLJD 5HVWA 1G9MH 2HTKC 1OM3H 3CFEA 3WNMA 2XN9E 1PZ5A 1QTYT 4LNVA 5D7JD 1I1CA 5FA4B 2XN9B 5MEQB 5DZOA 4KDTA 4X4XA 1VCAA 4P59H 4QCIB 5D8JH 2E27L 2BNQE 1PYWA 4U6XB 1P4BL 2PCPA 4GS7C 5GISL 4Z7VA 3ULSA 2FEEI 5C0IA 4CMMA 2BNQB 4IS6B 5I8OL 5TE4H 1I9IL 3QDJE 4YO0A 1D5XA 3I9GH 1CFVL 1HQ4A 2GI7A 5DMIH 1CFNB 3KPLA 3QDJB 1HSAB 1MUJA 4LP4A 1CL7H 1EHAA 5HYIA 5I8KH 1JZ5A 2EH8H 2BMKA 4UB0H 1A1MB 2EDNA 3HLAA 1T1ZA 3IU4L 4R0LC 1YN6A 3FQXA 4OBSA 2O5ZH 2VL5A 3QPQC 1MHEA 3F62A 1OP3K 4AQ1B 4YAQB 4YQXH 2UV3A 3K2UH 4QF1A 3RWJA 4MAYB 5FUCC 3W2DH 4XVSH 4PJEE 4G42A 3QBTB 4DEPC 1RUQL 4U7SA 4S0SD 3QEHB 3QEQB 3MRGB 2NW2B 5GGUB 4RMWA 3EYVB 3WNOA 2CO6B 3FHQA 4IRZL 4PJEB 1S9KC 4OCNC 4MJ6A 3S97C 3TZVB 4NWTL 1A1OB 5HHNB 2FBOJ 4HIHA 3SBWA 1OWWA 3S37H 2I9TB 1FV1A 2V7HB 4HKXA 1QFUH 4MYWB 5C0CD 3VU2A 1YMMA 4Y5XB 1AQDB 3TBVA 5I1LB 4DN4L 1CLYH 4RRPG 1QLFB 3FQWA 3VGGA 5K9QG 2P8PA 1MAJA 2X4RA 4G3YL 1TPXB 1JNLL 5CP7B 3FAWA 1KJ3L 2LU3A 2FR4A 2YWYA 1GJIA 5IMMA 3SGDH 3L3HA 3T2NL 1U6AH 4GMTL 2BDNL 3GGWB 3GM0A 5SWQA 4QNPE 1FFOA 4XHJD 2R0KH 2VLRD 4PLOB 3HHRB 1A7BA 3REVB 2IALB 4CN1A 3GB7B 3QNYB 4K71C 5ID1A 5ICXB 1S7XB 2Z93A 4XMLH 5L6YH 4KI5E 4X5WA 1DVFA 4LMQI 3N06B 4XAWL 2QSVA 5C86A 2FYYA 2LTQB 2VLMD 5TPWL 1JGEA 3MLUH 2LAGB 1P84J 1TTGA 3WLBA 2HRPH 3T0BA 5IEKA 1QO3B 3H9YA 1K4CA 2IQAA 4L1HA 4L4JA 3TJEH 4WW1A 4HK0A 2EDQA 4XBGB 5ACZA 2ITCB 4UUJA 3C5ZB 4OT1H 2IAMD 1F4WH 3DSFH 2IADB 3ABZA 3IDXL 4LNRB 3TH4T 3IKCB 1PEWA 5ECJE 5H37G 5SX4I 1YQ2A 1LE9A 4LPVA 4OJFL 3KPMB 4PJIE 3U36B 2QKIB 2E7CA 3PJSA 4J2XA 2Q7YA 4PJIB 3KLSA 3NIFE 3QXDB 4P4KA 1NGYB 3N1PC 4PB0L 1FZKB 4HFWB 2B2XH 2P5EE 1YEKL 4F33B 3DYOA 4FMKA 1OAQL 1A9EA 1QQDA 2DQDL 3AS0A 4MNQE 2XZCL 3K8KA 2V5RA 1ZHLB 4ELKA 2IPTH 1KTKE 4MNQB 4QXGH 1U3JA 1YPZE 3LRGA 2IANA 3QPXH 1D5BA 2AKRB 1I7RA 1KTRL 5E2TL 5DHYA 5I73B 4PG2C 5DWUL 5CUSH 1DE4A 3QUZB 5ILTH 2D03H 3WNNA 1Q9LB 2M2DA 1U3HB 3QIWC 3OZ9H 1Q8MA 4JREC 2CLVB 1VPOH 4NIKB 4AIZB 4DK6A 4F57H 1KCRL 3BJ91 3IDYC 1ONQA 4QXTB 4OZHA 3TN0B 5IIEA 3VXTB 1LP9E 4CU8A 4U1NA 4XB7A 3ARBC 1YY9C 1TVDA 2C1OA 3VE0A 2H32H 5KSBF 2BOCB 3GKZA 5A40E 3M8OL 1ZXQA 5HVHB 4JM4L 3PP4H 5HDQH 3WXWL 1Y18A 1LK3H 5GGSB 5L9DH 1H3UA 3HZMA 4MCYA 5F9OL 1EJOH 1OLLA 5GGTA 3MV7A 3H9ZA 2MWCA 2ATPA 1IGCL 2Y4SA 1MEXL 3ZMRA 4X5XA 2VXUH 4LLDB 3GIVA 4FG6D 4OIIH 2ZP0T 3SPVB 1OY3B 2RCSH 1QHOA 3SKNB 1B6UA 5FGBC 1ZLVK 5BW7A 2WMPA 5D7SH 4WUUD 1CE1H 4JPVH 4R6UA 3MCKB 3OKDB 3MRNB 4DAGL 3HMXA 4NP4L 5DEFA 3L7FB 2J7LA 1CD9B 1RUAL 4KMTH 4PY7B 2NXYC 2XWJB 2B5IB 4CNIB 1Z0MA 2YUZA 2H6PA 3FRPA 3GSQB 3ZDXE 3G6AB 3I75B 5BZDB 4KKAC 3U82B 1ZT7A 3DX9A 5CGMA 1QZ1A 3T4YB 2X7LB 3O2VL 5IJKC 4X7TA 3V4PH 1AGBA 4U3XA 5DR5H 5IB3B 5T3XH 2J8UA 3B3IB 4D3CH 3AY4C 3REWA 1FVEA 4ORGB 4Z5RA 4MNGE 2CIIA 3TA3D 1IGYB 1VGKB 3FB7A 4I2XE 4ODTH 4JFEE 2X09A 5CBAB 4Y7MA 4MNGB 1GC1L 4KK8D 3TVMC 3DSNA 1BZ7B 3DVNA 4PJ7A 3K0WA 1OM3L 3FRUA 5C0CE 4LGRB 1R5IB 3RGHA 1K6QH 4K3EL 3SJVA 4JFEB 4GRLD 3ZKNC 2GTWA 5T1KA 3AXLB 3IFLH 4TQEH 1F02I 1FNSH 1SYVA 4OCXH 2JJSA 5ACMA 5I9QC 3VXMD 4U1LB 4Y4KC 3LQAC 4G6KH 2A9NH 4Z0XA 4C57C 4BA8A 3MFFA 4CVWA 3Q48A 3WIIH 4JAMA 4Y8DC 1RZIB 3T3MF 2NY5H 4QTHB 5TE4L 4PG9B 4CN6A 2VLRE 3I9GL 4R96A 5INCB 3STZB 4O00A 3FCTB 5DMIL 1S3KL 5KVMC 3ZE2E 3HE7A 2NY2C 4HUXA 2VLRB 1M6OA 1MQKH 3CMOH 1UG9A 3KYNB 4C56A 5I8KL 2EH8L 1BBJB 4P2OD 2WIMA 1SJXA 4E5XA 1UWEH 2CGRH 4WWKD 1EXUA 5F6IB 5FYJD 2VLME 4DZ8A 2M26A 2J8OA 3RTQB 3CSGA 4X4ME 1PFCA 3K2UL 2FDBP 5H2BA 1A7RH 1KCSH 1XGPB 3IFOA 5DD1L 5GGQL 4R4BB 3MBEC 1M7DA 4Z7OE 1CR9H 4XCCH 1JL8A 3KJ6L 4NFCA 4RGND 4J3VA 4F3FA 3O2DA 1KB5B 2EYRA 1S5HA 3JV6B 3PWLB 5KZCD 3B6SB 1A3LH 4R9HA 1FFRA 3DPBA 4S1QH 5HYJA 2F54A 2JJWA 5DRWA 4KK6C 4W4OC 3HE6C 2EDOA 2LABA 4Y16C 3UROR 5FB8B 1S7QA 1FVCA 1BJMA 4GW1B 2E9BA 4R2GD 4JRXA 2BHZA 1BECA 2EXWC 5C08A 4LSTH 3VFMA 4N0FB 4F2MB 3D39A 4TTDC 1HXYB 2X4OA 3V0VB 3RUGF 1FFNB 1KJ2A 3LMJL 3JV5A 3DETC 4LMQE 5AZ2H 4FZ8L 4R7DB 4O2CA 1PQZB 4HLZG 1G9NL 2WNGA 3QHFH 5GZNC 5GSRA 5HDBF 3PNWA 5M95B 5C0JA 8FABA 3NIGF 4XP4L 2R0KL 4NJAH 1KIPB 1CIDA 5HVFB 2GYSA 4JFDA 1JFQH 5IV2B 1RUKH 1A6PA 3QZWA 2ADGA 3GNMH 3GBLA 1DLFH 4U6YB 4Y19B 5ETUB 5L6YL 5MP6H 5MEPA 2YUVA 3NTCL 2GSGA 1RJYB 4HH9B 1H9VA 3DTXA 5BXFA 3V4VH 1AGFA 3EO1B 3BKJH 1NMAH 1RK0A 5CWSA 5JA9A 2R2HA 5FHBL 5L2JA 2R1XA 4EN3C 4EOWH 2HRPL 2YEZB 4LEXH 4IOIB 1CXEA 4BZYA 3L9RA 5ELIA 1WQVT 3AM8A 4KUZH 4YR6B 1N2RA 3WE6B 1OSZB 4K94C 1LO4H 1YEHH 3DSFL 5LXGL 2BC4B 2AJ3A 4NCDA 3QA3B 5H35A 2GT9B 4FQQB 3LRSA 1TJGL 4ZYKA 3QUKB 1OAKH 1F6AB 3MJ9A 1AC0A 1AR2A 1PSKL 1IGJB 3OQ3B 3CJJA 2HLAA 1U8OB 2KQMA 1ITBB 5HGHA 1ZWIA 1U8HA 3KJ4B 5F7UA 4B50A 4Y1AD 4CW1A 3EDKA 2CIKB 3SDDD 4OI7A 3TBWA 2W65B 5FCUH 5HDLA 4HGMA 1UJ3B 1G1YA 4PJHF 2Q86B 1CYGA 2AI0H 3DRTA 5I1CH 2IPTL 3X11B 1VACB 4QXGL 3CPLA 2R4SH 5ESAA 4OUUB 3EHBD 3CFKB 2Y07H 1QR1B 5CUSL 4PP2A 3VGBA 4RQQA 2D03L 3C5JA 5HI3D 4M6OH 2XNAB 3OZ9L 3DMMA 2BXZA 1VPOL 4F57L 3VXNB 2APXA 2H8PA 5DMGD 2FWOA 4HEPG 4P46B 2GJ6B 5LWYH 3IETB 2EEAA 4X6CE 5IT2L 3KLHC 2OLDA 2EEDA 4F15C 3P0GB 4X6CB 5A2LH 3SGKA 4NO5B 5AAMA 1R3LB 4MQ7B 1KELL 2R0ZL 3PP4L 5HDQL 5JZ7C 5D1QA 4M6AA 5I15L 5IBTL 2FD6H 5L9DL 3VXUE 3GSNB 3D3VE 1EJOL 4QHKI 2QQLH 4XPFH 2D7PA 1ZT1B 1K4DA 2EDXA 4HAGA 3VXUB 1A14H 3D3VB 2ITDA 3IDJA 3S5LB 4M1CD 4OIIL 4H20L 4Q6IC 4NKIH 1HNGA 2RCSL 3NABH 3RWCA 4L9DA 3VXOB 2ZOLB 1HHKA 3DECA 1JGDA 2HYMA 4XCNA 2J12B 2A83B 2QR0B 1B4JL 3KNBB 4X9FA 3JTTB 1F4YH 1IGML 2R2BA 3GJFH 4XNUH 2NY3D 5FYJE 4PRPE 3MREA 1RIVH 4P2OB 5HGGS 4YX2L 4KV5F 4PRPB 3MJGX 4KPHH 1U8IA 3BSZH 3BH8A 4DN3H 2OX5A 3OJDB 3IJHB 5K9KB 4YHYC 5T1LA 4OI8A 3V4PL 1J1OH 4AJ0A 1ED3A 3LQMA 4RGNE 1CLCA 3BGFB 1TLKA 3P73A 4D3CL 3BZEA 2Q76B 5JIHA 1G7LA 1Q94A 3LKNA 3U6RB 5TDPA 3TCLA 4RGNB 5CZVH 5DK0B 1ETZA 3NA4A 3MMEA 1TVHA 4ODTL 2BJMH 5F7MC 3TIEA 2BVQB 3UTSA 4CJ0A 2V9QA 3K8LA 2XV6B 2VLLB 4AENA 4PJFF 3QDME 4BH8B 4M3KB 3E6HA 4J3XA 2NW3B 4XBPB 1TQBC 2FATH 1B6DA 2VLJA 4PJAA 3QDMB 2YPVH 2BVUA 4XXCA 3MRIA 1RIUH 2F58H 1SQ2N 1HINL 5K9OA 1D9KA 4FFYH 4G6KL 4GAYA 4PJBA 1LGVA 5MEND 1U58A 3O4OC 2VXVH 5B8CB 4F7MB 1A6VL 1MELA 2E9IA 2ED9A 3WIIL 2D7OA 4J6RH 3HUJE 3B2VH 3FHAA 3D0VA 5L8KB 2FHBA 3NACL 2FHFA 4QGTA 4L3EA 3VJ6B 3HC0B 3HUJB 4Q9RH 3CXHK 1MCEA 5AUMB 1I4FA 1YDPA 4KY1L 4JKWA 2BVPA 1KCUH 2BY2A 2OSLA 5CHNB 4UBDC 2PW2A 1UWEL 1MCNA 2CGRL 2DQEH 1NCDH 1QVOA 2IBBA 4JKMA 4W6XB 4YGAB 5FYKU 3DO3A 5D1ZA 4PGBB 1J8HA 4G6ML 2WUBH 2GAZA 2NZIA 4FXGA 4FQHB 1XGRB 5HHQB 1A7RL 1KCSL 3EYOA 4JM2A 1DBMH 2GFBA 1ZVSA 3D69A 5I17A 3WCYA 3RHWK 1YC7A 1OB1B 1CR9L 1NDGA 4G8IA 4PS4H 5DD6B 4BSWA 1TDQA 1CGXA 4XCCL 4EZMA 5C6TL 4H0HB 4DKEL 5HXMA 1N4XH 2WUCH 4ISVA 3RX7A 2R4RH 5FYKH 4R4FH 3OHXA 1A3LL 4OIBA 4HWEL 1CN4A 3LIZH 3O6FC 2EDBA 1A6ZA 1T0MB 1WUNT 3GDBA 5F7EH 5JNYA 1D6VH 3WD5L 3BZFB 5DQJB 4YBQC 3VGEA 2APBA 4MA1B 3LD8B 1FZJB 3I2CH 4Y1AE 3VFWA 3BRDA 4LSTL 3WS3A 5LKNA 4QNPF 4CADA 1OTTC 1IKFL 2BOBA 3HZYA 4NO0A 4Y1AB 3TYFB 4HWNA 5E7FA 4UOW0 3PGDA 1QSFE 3PL6C 5FOBA 1IEAA 2GIYA 43CAB 3FOMB 3ROLB 4OIAA 5DS8B 1K8IB 1QSFB 3MJ9L 4JG1H 3OKOB 5FKAA 1KF9B 3NMEA 4HXBH 1MLCA 4LCUB 3KPOA 4GOSA 3SCMA 3RPIB 5F7FA 4PB9H 2XY1A 3F6IA 1JFQL 3C6LD 2ZKHL 1RUKL 4P23D 2B1AH 3GNML 1DLFL 5JORB 4CDGC 2NYYC 3HZKA 3VH8G 5GS0L 3MLTA 1RJCA 5MP6L 4O02L 2P47B 1G7QB 2P8MB 3W39B 4I5BA 1DLHB 3SDCD 3V4VL 3WEXB 4MX7B 3N9GL 3BKJL 1NMAL 3CXDL 2YS4A 4NO3A 4EOWL 4GRMB 3MRQA 4QRQB 4PJIF 4N9GA 1FC1A 4G7YL 4LEXL 4TUOA 2DLIA 1EEUA 3G5ZA 2ZZUT 3GZKA 4MJ5B 2NY0B 1BQUA 4UIMA 5KANG 2KH2B 4KMQA 2VJXA 1QRKA 4NZRH 1DUYB 1ZHKB 1R3KA 3MLYH 4GRWH 4TSBH 3CZJA 3DVGB 5C0FA 4JRYB 2X4SA 1ITCA 2X44D 2QADB 3GBNL 4K3JH 1QBAA 1YUHA 1NUGA 1OTSC 5BZWB 3W11D 1JTPA 3VRLF 4OQTH 5KW9H 4HPYL 3KXFE 3KWWA 1KNOA 4MMZC 4OZIE 3S7GA 3QO1B 3L5WB 3ES6B 1T04B 2AQ3A 3UJJL 3KXFB 3V52L 4OV5A 2NY3B 4AK1A 5E94B 3VXQA 4OZIB 1JUFA 2F53A 2FJHB 2UY7A 3RWFA 2EO1A 1G7MB 3U48A 3BPLB 4GT7A 1KFAH 3HS0A 2R4SL 5IOPB 3QRGL 1JV5B 1JGUH 5D7LD 1Z5LB 2Y07L 4NFBA 1VA9A 4MAYC 5HI5C 5K59F 1H3XA 4KJQD 4LSSH 3BD4A 4KQ3H 4I9WE 1WK0A 1OW0C 4WFHD 3VFUB 4P2CG 2FJGA 3H6JA 1MCDA 3BD5A 5HD8D 4MJ2A 1JYVA 2RFXB 2VERN 1VKXA 1NGWA 3TZVC 5KJRL 5IVZA 1IC5H 3ZT7A 1DBKH 3Q0HA 3C09B 5KVFL 1NFDE 3GKWL 4NUJB 5F1NB 2XXCB 4KZDH 5ITBH 3AC0A 1FSKB 4Y5XC 3G04A 3TBSA 3MJ6A 1WFUA 5D2LA 1J11A 3CFDA 2G2RA 4OF7A 1FL5A 2AK4D 4U1IA 3WL9B 4U1MB 1LD9A 3FB6B 4PJCE 3EOBB 4PJ5E 3MROB 1TPXC 3TPUA 3O3EB 4XPFL 5I8EA 2HKHL 2PTTA 4P48A 2GSIA 3OXRA 1MHHA 4PJCB 4PJ5B 1A1NB 1A14L 1RU9H 5D1XA 3SDXE 1RULL 4RCAA 5I1DB 5GIRA 4NOFA 3LEYH 3SDXB 2E6JA 1GHFL 4Y2DB 1E4KA 1OF2B 4MSWB 4XNUL 5HJ3A 1GZPB 1RIVL 1DQQB 1ODAA 3Q2CA 4YZFE 1TVBA 5T33L 3DARA 1H3GA 3BPCA 1I1YA 4I3SH 3CVIH 3BSZL 5IK3A 4FFWD 4DN3L 4TSCL 1REIA 3FB5A 4KI5C 2LTQC 2FJFA 3ULUD 1J1OL 1RUPH 2VH5H 4XZUB 3S98A 5ICZB 1HHJA 5MI0B 4CN4A 3SE4C 4ZAKD 3C5ZC 3RNQA 3ZSTA 1UKQA 1GZQA 2JCCB 4BUHA 2DWEB 1N64H 4DTGH 3KHOA 1HH9A 1E28B 1C5DB 3TBYB 3LY6A 15C8H 1TQCB 4QTIH 4HC1A 4L4VD 4N8VB 4U3CA 5GXBB 3D87B 4QRUA 3TJHD 2A77L 4GKOA 1AHWA 3ZL4L 3WIFB 1I3RA 4L3CB 2FATL 4P2RB 3LN4A 1ZSDA 2FL5B 5DJYA 1RIUL 2AABH 3GMMB 3ZE2F 2UZIL 3GI9H 1MI5D 5CZXD 4POUB 2E7HA 4J6RL 1H8SA 2HT2D 4F7EB 3BH9B 5IJVA 4Z8FL 2WP3T 2AEWA 4UQ3A 1V7NL 3ALWA 2APWA 4YHPB 3MCG1 1F8TH 4OUOA 4MMXC 1MPAL 4PP1D 3HAEB 1FNGB 2BZDA 1FHGA 3BZDA 5I73C 1KCUL 4UNUA 4U1HB 2FZ3B 4XPTH 5GQBA 1R0AH 1IAIM 1WTGT 4P23B 3QUZC 3IB4A 4NRZA 2DQEL 3HCVB 1A7NL 4H8WL 4PGJA 5CJXA 1U3HC 3S3PA 3F7YB 3LN5A 4WI7A 2FX8H 2NNAA 1VENA 4X9GA 1K3IA 5E2UH 2P43B 3TN0C 1S5IH 1DBML 3TFKD 2LVCA 4PV8A 4YFLI 1NGPH 4CMHB 1N5YL 4LLVB 2QV2A 5C9JA 4WJ5A 4PS4L 1A22B 3NZ8B 3QP3A 5ALCH 3HRPA 4OD1L 1HYSD 3H9SD 2G9HA 5DYOB 1N4XL 5HVHC 2WUCL 4M6NH 2R4RL 5K9QI 4FTVA 5FYKL 4R4FL 3DV6A 4HDIA 3RNKA 4XNQA 3ZKSD 3RZWA 2G5RA 4XC1L 1LNUB 4N90D 4J3TA 5F7EL 3C5SA 4HKJB 3ZKMD 5ADOH 1D6VL 4LDLB 2HJLB 3E6FB 1X44A 4NQSB 2F15A 3I2CL 4GKNB 4M93B 2G75B 2VQ1A 3U0TB 1G7PA 1JIBA 3QJFA 3FONB 3U4EB 4UILL 3SDYH 1P7HL 4R0LA 5B3JF 3HR5A 3O3AB 2ESVD 3GI8H 1NAKH 2NY7H 1U8KA 3LV3A 2B5IC 1AP2B 1FQ9C 1PKOA 4HXBL 1IM3B 4S2SB 4KAQL 5EU3B 1CFTA 4RGOH 4U1GB 5CD5D 3JWOL 1A6TA 1AD9B 2B1AL 4W4NA 3IXAA 4WFHE 2VZVA 2X1WL 3BI9X 3CFEB 3FO9A 4D9QD 4KHXH 4GG6A 3G6JE 4HGWB 3OR7A 2OTPA 3MRHB 5KAQF 1GSMA 2VNCA 5EO0B 4DFHA 3G6JB 2B4CC 1NPUA 1BZ9A 4YFEA 3EIFA 4YHOH 3PWVB 1N7MH 1SM3H 2AK4E 3D6GA 1INEH 1HWHB 1CQYA 2PW1B 5DRXA 3HFMH 3S88H 1BLNB 5JW4M 1Z9MA 2AK4B 2AV1A 2XQYG 1SVCP 3PV7A 4TVPL 1U2CA 3FMGH 3BUYA 5EDXA 4RAVA 4MVBD 1Q9KA 4K3JL 3L3KA 1C5BH 1E27B 1OGTA 1N5AB 4LRIC 1DN2A 5KW9L 4QHNA 2VL5B 1XH3A 1UM5H 1JP5A 1PKQA 2IBZY 4Z95L 4FZEH 3L3JA 3ARZA 3CH8A 4N0RA 1UEYA 2FO4B 4G9FA 5F6IC 3RTQC 3ARDA 1JHLH 5FGCE 2H26B 2HVJA 4LSSL 4P2QA 5FGCB 3V9FA 3ME0A 4QOKD 3BKYH 5IHBA 3L5JA 4Y4HD 2N56A 1FZMA 4JN1H 2OL3A 4WHTA 3RVVD 4X9HA 5E1HB 1YEFL 2GEEA 2IAMC 3O9WD 4IDJH 3LKOB 1K8DA 1XF5A 2ZCHL 4L4VE 4AEEA 1KPUB 2X4RB 4E41E 5IGXH 1IC5L 3RWGA 3QDGE 4L4VB 4TN9A 4KZDL 1EFQA 1I9RH 2HRLA 1MCPH 4G43A 4E41B 2PYEA 1FDLH 3QDGB 3EYFB 3IFNL 4M7ZB 1MHCA 4WI3A 1MI5E 3L6FB 4OCSH 1O5DT 2B1HH 4EUPH 1L9MA 5D96B 3H2WA 1V3KA 1MI5B 4YXKL 1KTDB 1J0JA 4V2BA 5ID1B 1UCBH 1I8MA 4X7SH 4HC1L 1RU9L 2Z93B 1UXWB 3C87A 4GLRI 3OJVC 1DVFB 3HPJA 3ILQC 4JHBA 3QUMA 2BY1A 1WSST 3UZVB 1IGTB 5JHLH 1JI2A 5E70A 3FT4A 3RWHA 3D25A 2DKMA 2DTMH 4AEIL 4PRAB 3MRRA 1ZVYA 1INQB 2RGSA 1P7KB 5I1EH 1EPFA 3CVIL 4UUJB 5DHVA 1AIFB 1FL3B 2VDOL 1BX2A 1UACH 3ARBA 1PX4A 3BIKB 1YQVH 4WW2B 4A2LA 1LE9B 4HT1H 2FSEB 1ZHBB 4HX1A 1WZLA 3PJSB 4Z7NF 1OD7A 4KJWD 4RFEB 4ACPA 5EORH 3QFJE 5B39A 1H5BA 2XIDA 1N64L 2JE8A 3FFCA 4N90E 3RKPA 1QPXA 2B39A 2MOVA 4OFDA 5DFVC 5EC2B 4N1EA 3QFJB 1S9WA 4QTIL 2P7TA 1JPSH 4PLKC 5E9DE 3T0DA 2ERJB 1EERB 1BFVH 3F7QA 4MWFA 1B9ZA 5FGBA 4X0KB 3BOVA 4JO1H 5E9DB 1QSED 4NQEE 1D5ZA 4ELKB 3QFDB 2I25N 5DUMH 2AABL 1PG7W 3NZHH 2CXKA 3KJ4C 1DANT 3GI9L 3S96B 1U8JB 1I7RB 2BSRA 3B2UC 4NQEB 4XX1G 2ESVE 3U4BH 1T0NA 3RWEA 1MCRA 3FQTA 3NIDE 1UJ3C 2VSCA 3QCUH 1AR1C 1L4IA 2ESVB 2GK0A 3WHE1 4RMVA 4F37K 2ATKB 4NN6B 3MXWL 5IJKA 2DQJH 3RL1B 3EFFA 3OR6A 3AY4A 3KYMA 4XPTL 1R0AL 1F6LL 5J6GA 2DLTA 3VE0B 5JOPD 5E6YA 1KCVL 2IPKB 1AXIB 5F3HA 1OP3H 1ZT4A 2FX8L 3TVMA 1RIHH 4KJYA 5EBMB 5E2UL 2R1WA 5I1JL 5C09D 2WINA 4P46C 3G5XA 4XNMB 2XRAH 4KK8C 5B38G 4MCYB 1OAXH 1T7YA 3ULVF 3MUHL 5ALCL 5BOPA 3A6OA 2ATPB 2F5AH 5JTWA 1FRGH 3GIVB 4P0DA 4M6NL 2W59A 4HG4K 4DKFH 3TO4D 5FUZL 2C5DC 4EJ1C 1PZUB 2DQTL 4LLUB 4DVRH 3SY0B 3WN5A 3T08A 5I1GL 1TZIA 3MLVL 5KSAA 4LGPB 5DT1L 1BOGA 5ADOL 1F3JB 5D4QA 1T5XA 4O9HL 3UBXG 3I02A 3UEZA 2JK5A 5GS2D 5DMKB 1NAMH 5CJQH 4B7IA 4C83A 3VFTA 5HHOA 1A6UL 1ZT7B 3MLZL 1FLTX 3LRHA 1AGBB 3B9EA 4ZO6A 4W6YB 2J8UB 4P2OC 4C55A 3CIQA 4ZNEA 4HFUH 4GAFB 3BKMH 1V7MH 2GUOA 5FECB 4ZDHA 2FRGP 4Z5RB 3B8YA 3EW3B 1RVFH 2CIIB 3LB6D 3CLFL 3MBEA 5D5MA 3SJVE 2FIKA 4S10A 3BN3B 3X13B 2R15A 5AWNL 2AJYH 2VDRL 3FRUB 3BGFC 3O4LD 2EE3A 1KLGA 4Y4FD 3SJVB 4V1DE 1QBBA 5GRUH 1MFAH 4O58H 4RGNC 3NCMA 2LU7A 3IF1A 1JRHI 2HKFH 3C60D 2MTPA 4V1DB 3P9WB 4NC1C 1NC2B 1K2DA 4W4OA 1Q72H 3HE6A 4Y16A 3RIFK 4Q2ZA 4Z7WA 1RPQA 1CDCA 5CINH 2CR6A 5D6CB 1NCBH 1CDJA 1N7ML 1SM3L 4JAMB 1Y6KR 2QSCH 3QIBD 2UWEA 3HFML 4PJ9A 5FO8B 2VQTA 2P24B 3P2TA 4R96B 1JVKA 2YD4A 1FO0A 4U1JA 2Q87A 3HE7B 3GHEL 5JQHC 1M6OB 1SEQH 4FNLL 5B8CC 3WUWA 4P9HH 4LLMA 1W0WA 1CG9A 5HPMA 5I1HH 4ZFGH 2DQGL 1VHPA 1G6RA 4PD4J 2BCKB 4TYUA 1MWAL 5FGSA 2DDQH 3H3KA 2HA1A 5LBSL 5EOQL 3FQNA 4H1LA 3TWCH 4GBXD 3IFOB 1WIOA 4DCQB 4FZEL 4YDJA 2AXFB 3NOIA 4WTZG 4XB8A 5JDSA 5F7LB 4KTEH 1SJEA 1KTLB 1HK6A 2HJKB 1JHLL 4EN3A 2AK1L 3BT2L 2EYRB 2OZ4A 3QQ4A 5KVGL 1RURL 4IRJD 1FYTD 3QUML 1U93B 4QRTB 4PGCA 3RWIB 3RY6C 5E00B 1EO8H 1QP1A 4PJGF 1NGZB 3EDJA 4CUCA 1MCQA 1S7QB 1FVCB 4JN1L 3DRQB 4IDJL 5C08B 3BEWA 3JTSB 4YGVB 4HS8H 5IGXL 3B5HA 5JW4Q 5ESQB 1KJ2B 3QSKB 5EPMB 5JQ6L 1I9RL 1MCPL 3SDXF 3QQ3A 4O2CB 1FDLL 4MA1C 3U2SA 3LD8C 4RFNB 5SWSE 3ARFD 4WEBH 4JHZA 3PNWB 4LHUD 5A3ID 4NM4L 2YK1H 2P46B 3JVGC 2B1HL 5SWSB 5JLZB 4POZD 4HWBH 1NEZA 1UCBL 2Q8BH 3CUPA 2WP3O 3AAZA 4UDTA 5LQBH 4FN0A 1ZLVH 1I9JH 3HC4L 4ZSOE 3T4AB 1YNLH 2PO6D 1RK0B 1D7FA 1T7VA 5JOPE 1CDUA 5HI4C 3EHBC 5D70L 4XPBH 3NN8B 4PY8I 4BH7B 1WBYB 4ZXBD 5DQ9A 1UXSA 4APQD 4U05A 2EIEA 2JCCF 5JHDA 5I1EL 5HGAA 5EZOL 3VGHA 1KEMH 1C5CH 4WU5B 1RK1A 1CE6B 1UACL 3K4AA 3V7MA 2Z91A 2MQCA 3HPLB 1MRFH 1ND0B 4HT1L 5EBWA 5C0ND 4ZYKB 5C0BA 5BOZG 4NQXA 4UDUB 3S35X 3V5HB 4OCYH 2NY0C 3MO1A 4NQDD 4XH2A 1FGNH 4ZS7H 1J7VR 3TO4B 4PV9A 2EYSA 1U8HB 4ZFOL 1I8KA 4CW1B 4FXKB 4XPAH 4Q6IA 3CH1A 5IF0A 1BFVL 2OJEA 4Z0BH 4X5LA 2QADC 4JO1L 4M1CC 4P5TB 4L9LB 3VDBA 5DUML 2EDYA 1M71A 3JSSA 5CEYA 4JEGB 3MLXH 1BM3H 4JY6A 5CP3A 3U4BL 1NKOA 4OZFH 2NY3C 3QCUL 4JO3H 4XWOD 5J13B 4MS8C 1WICA 5EIIA 3BPLC 5DVLA 3VFOB 3P4NA 1B0GA 1AD0B 2DQJL 1S7SA 2X70A 4OZGA 3O4LE 2FWOB 4N0CD 1Y0LA 1EAJA 1DBJH 2VZSA 5I18H 2SEBB 4YDLB 3R06A 3F7PC 5EU5A 4Y4FB 4ZO8A 2V17H 5HYSG 1WWAX 3MR9B 1RIHL 4M7JH 1A2YB 2B7DT 3C60B 3EOAA 2J8HA 5D1QB 1E6OL 1IAOA 4XWGH 3CNKA 5KVEH 3PHSA 4F7PA 5FKPA 3GM8A 5GGVL 3P0YH 3C09C 4LSUH 3KPPB 4X7FC 3VW3L 4D8PA 1ULVA 1FRGL 3LH2L 4QHMA 1FSKC 5IHZA 5D7IE 4DKFL 4NHCH 5FM5M 3IDIA 5IFAL 4WEUD 4N0YH 3MRLA 1LMKA 4DVRL 1HHKB 3MLRL 4M61A 5D7IB 1OTUD 3AUVA 3G5YA 2IG2H 3MV8D 4J3SA 3GMLA 3GIZH 2XQYK 5L8LB 1QR4A 1OL0A 2VE6B 5CJQL 4XI5D 2OTUA 4URTB 1FBIH 3AFLA 4Y2DC 4J1UA 2Y23A 5T1LB 1ZAGA 2OP4H 3HKFA 3HZVA 5D9SA 3T1FA 3DXAA 1GGIH 4K3GA 4HFUL 3P73B 4RNRB 3BZEB 2YRZA 3G6JF 1G7LB 1WBXB 3LKNB 4UQ2A 2K3TA 1RVFL 2JJTC 2MQ0A 5EB9A 1TVHB 2J1KA 4YHLL 4KMLB 4Z7VF 5J11B 2AJYL 4X6DA 5IESH 4JFXA 5KANI 1S7TB 5MI0C 1GAFH 1E4XH 4U7MA 5GRUL 4G5ZH 3EBAA 1MFAL 4O58L 1IRAY 5TQ0H 1KN4H 3QUYD 3RA7L 2CKBA 1W72H 3P9MA 3UZEA 2WW8A 3TT3H 3SE9H 4L4TD 3STBA 2UVFA 5DD5H 3V6OE 2DM2A 3O6FA 5C0GA 1OOAA 4GG8B 1JPTH 2OZ4L 5K9OB 3VXSE 4EVNB 1D9KB 4GAYB 3MRMA 1KYOK 2W9EH 4LSDA 2WQ8A 1TQCC 5DRNA 3HRZA 4WTWA 3VXSB 4GW4B 4K94L 1R24A 1F97A 3GSRB 3OKLB 1FZOB 2NX5D 3L95A 4S11A 1KGCE 4WDIA 1BGXL 4L3EB 5E8PB 3FQUB 1CXIA 1V3LA 5LGHH 1A6WL 3PL6A 4Y5YB 4ETYA 1OAYH 1RI8A 4NN5B 3EZ8A 2BVPB 2CO7B 3HN3A 3WFEL 4HUNB 2OSLB 2PR4L 1RZ8A 4P9HL 3DBXA 1LO0H 4RMTA 1A4JB 3ULUH 1QVOB 5I1HL 4ZFGL 2EXYD 5D1ZB 1EH9A 1J8HB 3LPGA 1AKJB 2DDQL 4OGAC 1MAMH 3N85H 4ZPTA 3E8UL 4FXGB 4HMDA 2PO6B 3Q3GB 5AAWA 1A3QA 4M8QB 4J4PC 4P23C 4RGMB 2CDEB 2DQIH 4XVTH 1N59A 2W0KA 4BSWB 4UU9A 4QKXB 5AD0A 4GW5B 2C4XA 3IDMB 4FQIH 2IBGA 3DURA 4CMHC 3A67L 4HZLB 4PYGA 3BPNB 4NQDE 5HHMD 1NCUA 4PJXE 1H3WM 5FA4A 2CLRA 1A6ZB 1MQ8A 5GGRB 4YUEH 2XN9A 4LASL 3UTTE 3IDGA 2G5BB 5MERB 3VGFA 2J88H 4H0IA 4NQDB 4PJXB 2GCYB 3CVHH 3MLPA 4QCIA 3M45A 1CFQA 4MXVF 4LPUA 3UYOD 3UTTB 4U6XA 1SHMA 2YD2A 1YC8A 2BNQA 2DIJA 1BVKA 3QI9B 1IEAB 3V6FB 3MLWH 5C07D 4M93C 5DUPH 1V5JA 3FOLB 2BFVH 1HSAA 3QDJA 4GKSB 4K7PY 2IPUG 3W11C 1MLCB 2YBRB 1S9YA 1GH7A 4G7VL 4D9LH 2NY4B 2H9GA 1X3DA 5D7KD 3ARUA 3VWJB 2WBJD 1KBGH 5DD3H 1A1MA 3GSWB 1UA6L 4WO4D 1J05B 5IQ7H 3T8XA 5LQBL 2A6JA 2DD8H 4U6TA 1I9JL 4YAQA 2EC9U 2YUWA 4MAYA 3RL2B 4MA8L 1XGUB 4IBLT 1YNLL 4GMSH 4U1GC 2I27N 4KDWA 3QEHA 3NCJH 3MRGA 3FN9A 4XPBL 2VXSL 5I1AA 1OW0A 4ELME 5GGUA 3EYVA 4PJEA 2WV3A 1B2WL 3BEVA 4UIMB 4ELMB 4K7PH 3ALXA 4I4WB 5SWZD 1PX3A 1D5MB 1TZHB 3HA0A 4HIEB 1A1OA 5HHNA 4OLXH 2RQ8A 5HD8C 2I9TA 3SE3C 3FO0L 4Q58C 2V7HA 5KOVC 5C0FB 2CQVA 5C3TA 4Y5XA 1RAMA 5GPRA 2VQUA 4OCYL 5I19H 1HN1A 1QFWH 2ARJB 2ZSVB 3SO3B 1AI1L 1QLFA 1FGNL 4LPCA 4LOUC 5DDHB 5CP7A 2IGFH 1P5UA 5DI8B 3I84A 3MV8E 1VGEL 4WFGD 3K4ZA 3BRFA 4XPAL 3ARGD 3EJYD 1HZHH 4XP5H 3GGWA 3SKJH 3MV8B 5LCVL 4PRHD 4OZHF 5GRJH 3REVA 4RISL 3GB7A 3QNYA 2AEQL 3MLXL 3QAZB 2X10A 5F6HI 4JO3L 4LHJB 2UY6A 4U2ZA 4MB3A 4NCC2 5TE6L 2FJGB 4J3UA 5F9DC 5EA0H 1HHGA 2V9TA 4A6YH 1QO3A 4JVWA 1Q9OB 1GCFA 2ITCA 4MAUL 3SE4A 3SBWC 3ALPA 3DX8B 4LNRA 2IADA 1AQKL 2V17L 4JRWA 3TNMA 1A0QL 3IKCA 4MD0B 5EUOE 4M7JL 3G04B 3H42H 3TBSB 1OPGH 1X5LA 1T2QH 5D2LB 4XWGL 3U36A 2QKIA 1DQDH 4U1IB 1F45A 1RHFA 5DJ6A 5KVEL 1BFTA 5EUOB 3BIAX 1UWGH 5TDOB 2NX5E 3AREA 4LSUL 1UKSA 4JLRB 1I1AD 3TJHC 3QXDA 1NGYA 3JWDH 1LE5B 1FZKA 5D1XB 4TTGA 5CEXB 3AS2A 3ZE1F 3NPZB 4NHCL 1GOGA 3ROOB 4M7ZC 4F33A 3OB0K 1ZANL 2J8UF 5BVPL 2P5EA 2CDGB 5D96C 4JPWH 3V4UH 5CZXC 2IG2L 3VH8B 4XAKD 1ZHLA 4KRMB 2HT2C 1TVBB 4MNQA 3GIZL 4JGUA 3HNVL 1DQTA 3RY4A 1E0OB 5HSFA 1DVFC 1RFDH 1EGJH 2AKRA 1A6AB 4PJ7F 2WQRA 3T3PE 1YPZA 3QUZA 3TO2B 2NY6B 2FJFB 1Q9LA 2OP4L 2ZCLL 1IAMA 5E8DL 1GGIL 4Q9CA 1HHJB 2NXZD 4EIZC 1CL7I 2CLVA 1IC7H 4AIZA 3KYOB 3TN0A 1QSZA 3VXTA 3RNQB 4QRPE 5L2KD 1LO2L 3TF7C 1DL7H 3BAEH 5HHME 3MGAA 3B83A 2BOCA 4WW2C 3LPFA 1LP9A 2F9BT 4JO2H 4QRPB 5D7JA 5HHMB 4G5ZL 1RZFH 4QRUB 1KN4L 1HYSC 1MHPH 3RWDB 3GSXB 1W72L 3TM6A 1I3RB 5TJWK 5GGSA 3SE9L 1ZSDB 3WUZA 4A2MA 5DD5L 4WU7B 4F9LC 3MUGB 3O3DB 4LLDA 2ERJC 1MH5B 1T3FA 3SPVA 5C07E 3B9DA 3SKNA 5CKGA 4K7FB 5D7KE 2AEIT 5C07B 1T22B 2DJ4A 3S34L 5BMFH 1OAYL 3MCKA 3OKDA 3MRNA 4BUGA 4L8SB 2OXGA 3L7FA 3WHXB 2FIRT 4PY7A 3MCLL 5GRZA 2XWJA 4U3HA 1ZLSH 4LVNB 2BVYA 4NRZB 4YHKL 3G6AA 1DUZA 5BZDA 3MRPB 1NH6A 2VZUA 1MAML 4NN6C 3T4YA 5J7CC 3KPSE 3MRFB 4AMKH 1MJJB 1VFBA 1CD8A 5IB3A 5CD5C 3B3IA 1FJ1B 1KC5L 3QR2A 4DJMA 4EDXA 3MNVA 4ORGA 4U6VH 3KPSB 2VR4A 4S1DD 1SVZA 4FTVE 4KTYA 1IGYA 1VGKA 5DA4A 4FQIL 5B4MD 5CBAA 5JW4R 4MNGA 1MJ8H 5I6XB 1BZ7A 4FTVB 1UFUA 1R5IA 4DGIH 4I2XA 2DM4A 4JFEA 2XZAH 1DN0B 3W0WD 1UCTA 2EICA 1DSFH 3AXLA 5C0CA 2OJZH 3VGAB 8CGTA 3MXVH 1U8MB 3CVHL 4U1LA 3ET9F 3EYSL 1X5HA 5F1IA 4L3AA 1G7PB 4HJ0D 3VWKD 3WNPA 1AY1H 3BGMB 4DVBA 1U41A 3SN6N 5KN5B 4QTHA 2WLZA 4PG9A 1QFPA 5E2JA 4LRIA 2UZXB 4U4BA 5ALBH 1U8PA 4MVBC 3VI4F 3MLWL 5INCA 3STZA 4X80H 3FCTA 2D0GA 3OB8A 5DUPL 2VRAA 5E8OB 2VLRA 3CFBB 4X83A 3KYNA 4QY8B 1CFTB 2OMNA 1BBJA 4FA8A 2BSTB 1KBGL 1JJUA 1MJ7H 3GSVA 3RTQA 1S9VB 2DD8L 4J3WA 4HUUA 4X98B 4GG6B 4M5YH 4FP8H 3OR7B 1CBVH 1XGPA 5IEHB 4R4BA 1XGYL 2DYPB 4X4MA 4JKKA 3NCJL 3EUUA 3GHBH 5F7DB 2PYFB 1NGQL 4G8FB 1BZ9B 5HYFA 1KB5A 4OFYA 2IAMA 1I75A 3U46B 2DIAA 3H7BB 1XF2A 1FN4B 3JV6A 3RVVC 2VIRA 3PWLA 3B6SA 4OLXL 2E6QA 4I77H 4UT6L 4Y8AA 4M02A 1EVUA 1OGAD 5FB8A 1CWVA 3GJFK 4GW1A 1OCWL 5TQ2H 3VRJB 1FORL 5I19L 3LS5L 4D2NA 5IVXE 3EKCA 2V5MA 4QEGA 4ODSH 4N0FA 4F2MA 5J6HB 3WYRA 1HXYA 2IGFL 3O0RL 2I5YH 3V0VA 1FFNA 4JFZH 2EZ0D 3CZFB 3CX5J 4XAKE 5IVXB 1EK3A 3HE7C 1I9EA 2I07B 4R7DA 2GTZA 2FNBA 1HZHL 1PQZA 2R56H 3V0WH 3RGVB 2XKUA 4F58L 3MV7D 4K9EC 1KIPA 3OJ2C 5GRJL 4M48L 1FGVH 3AMLA 5CGYD 3ARDB 1P1ZB 4L5FH 4MD4B 3IS0X 3WHE0 3LHPH 2VXQL 4JDTL 3ELAT 2HFGL 3ESUF 1KN2L 1XEDA 4HH9A 4HPOH 2NXZB 4ALAL 2XXMB 2DN7A 4NDMB 3EO1A 4EUPG 1SY6H 4GUPB 4I0PD 1S7VA 1FZMB 5EA0L 4NKMB 5LVEA 3IJYB 4XP1L 4A6YL 3QHZL 1X5KA 2YEZA 4JG0H 3BESR 4IOIA 1YMHB 4JKLA 3UX9B 1ADQA 3EO9H 2UYLB 4YR6A 2PYEE 3RJQB 3RWGB 2ENSA 2QQNH 4RMRA 1T21B 3G9VA 3KS0J 2BC4A 3QA3A 4KJWC 1RJLB 2YZ8A 2PYEB 4FQQA 3R1GH 3H42L 1T2QL 2FBJH 1MHCB 3QUKA 3O6ML 4CGTA 3EJZC 1F6AA 3OXSB 3QNXB 3UBXI 1IGJA 2MPAH 1I8MB 4OD3L 4RFNC 1R5VB 1U3YA 1G0YR 2CIKA 5JXEC 1I3GH 2W65A 5SV3A 4UV7H 1UJ3A 5T1MB 5KS9E 3V4UL 5C2BH 2Q86A 1J1XH 3DUHA 5GS3A 5M94B 1F3DJ 2I60L 3X11A 3WJLC 1VACA 1O0VA 5KS9B 1U91B 2P44B 1RFDL 4NKDB 3HC3H 1EGJL 2BRQA 2HFEA 5CKAA 3CFKA 5DHVB 4JJ5B 3MPCA 1T03L 2VDMH 1I8IA 3E2HB 5HHVL 2DRUA 2HWZH 2XNAA 3BDBA 4N68A 5FV2A 4PJAF 5C92A 2D4FA 1NCCL 1YNKH 3VXNA 4KRPB 4S0TD 3MV01 2GY7B 1C12B 4EKXA 1TJHL 3MFGB 4C56D 2NPLX 1DL7L 3IETA 1JMXA 1H5BB 3W0WE 3VFPB 4BELD 4JKPH 3K1DA 4GXUM 3OKMB 4CJ1A 4X6CA 3W0WB 4QRSB 1LO5B 1R3LA 4MQ7A 1RZFL 3RDTB 3IJSB 1OAZL 1BBDL 1UQSB 1MIML 1B4RA 3GSNA 3TO4C 3KLAB 2B4CL 5GGRY 3VWKB 3BRGC 5J1AA 2BSRB 4ESKA 3D3VA 1UZ6E 5T5FL 3S5LA 4LQFL 3F12A 2R9HC 1BMGA 2FEEL 2CKNA 2Y6SD 2ZUWA 4HHAB 4P5TC 2F54D 2A83A 2E7MA 4JM2F 4L9LC 3AS1A 3TBTB 5HTSA 5BMFL 3UJTL 3DGCR 3EFFB 3U0WH 4JRXD 4P2OA 3KR3H 3KYMB 2CUMA 1KCKA 4KRNA 5J6GB 1LVEA 4KQ4H 4PRPA 3QCTH 5J13C 2IPUK 3BE1L 5EZLB 2WIIB 4XCEA 4LCWE 1S7UB 5EG6C 3OJDA 3IJHA 5K9KA 3M17B 2DLGA 4KFZC 3LB6C 2R1WB 4LCWB 1S78C 3SE8H 2Q76A 4Q0XH 4U6VL 3VCLB 3U6RA 1ZLWK 2YA2A 4YDLC 5DK0A 2HT4D 3FZUC 3AROA 4Y4FC 5LG1A 2VL4A 3HNTH 2VAAB 1CDYA 3ARWA 3X12B 1IBGH 2K1MA 3P4MB 4HWUA 2BVQA 3C60C 5D1QC 1MRDH 2WWMD 2X4PB 2VLLA 2XZAL 2VWEC 4BH8A 4Z6AT 2AJVH 3WN5B 1L0QA 1S7WB 2NW3A 1TZIB 5KSAB 1UH2A 4JQVC 4NKOB 3QDMA 2RR3A 3OF6D 1KB5L 3T2PA 1WEJH 1T5XB 1EFXD 5F1SA 3I02B 1BJ1J 4F7MA 3VFTB 4PBVC 1AY1L 2B8OT 4GSDL 1XMWA 4WY7H 1GGBH 5DURD 2PN5A 4AEHH 5ALBL 2A2QT 5E5RB 4TUJB 2AXHA 3VJ6A 3D2UD 3HC0A 5D2NE 3UAJC 3ULVH 3HUJA 2GUOB 3MOAL 4X80L 1U8LB 1XR9B 5AUMA 2C3GA 1OP9A 4JCLA 5EFIB 3RU8H 5F9AC 3GRWA 1A7OH 2GJJA 3RZCD 4TUKL 1MJ7L 4WI9A 4PGBA 4QLRA 4FP8L 4PREB 4FQHA 1XGRA 5HHQA 4H5SB 3GMQB 5GS0D 3KHQA 3UMTA 1JF5A 3RY6A 1OB1A 2I9LB 1TXKA 3GHBL 3BZ4B 3CX2A 5J11C 2MCPH 4OFIA 3QIUD 4QHUB 2H32B 4ODHH 5TE7L 4XX1E 3HTLX 2KKQA 2HG5B 4PJ9B 2V9RA 4I77L 5IMLA 3U4AA 3THML 1IGFH 1NMCB 1T0MA 3DMMD 4U1JB 1C16B 1D9KC 4P5MB 4R4NC 5IBLD 5TQ2L 1I8LA 5DQJA 3V6OC 2MSPA 2ADJB 1FZJA 3I6KA 1WZKA 4JDVA 4QO1A 1PBYA 2BY3A 1MJUH 3JVGA 4I48B 3UPAA 2I5YL 2I24N 4Y1AA 3TYFA 4UTAH 4JFZL 1F00I 4CKVX 1Q0XH 3SDDA 2CLZA 4Y5YC 1V3MA 3FO2B 4L1DA 2QHRH 3P77A 2XPGB 1CGSL 3FOMA 3FQNB 4NN5C 43CAA 3ROLA 6FABH 2ED8A 3O3UN 5DS8A 4POZC 4BZ2H 1K8IA 3OKOA 2YA1A 3QXUA 4LCUA 3WIHH 1SJEB 5D1ZC 3RPIA 3RKDD 1WF5A 4L5FL 4XVJL 4PYHA 5IFHL 3QQ4B 5JPMA 5JORA 4LPWA 12E8L 2PO6C 4NNYB 1NAMA 3G6DH 5IG7B 2P8MA 1G7QA 5T3XE 3CU7A 3W39A 1A9BB 4RGMC 1Z9SA 4OQ1A 4HPOL 1LO3L 1DLHA 3WEXA 5D2LF 4MX7A 1SY6L 1HSBA 3QYCA 4UV4H 3OWEA 4JDZB 4GRMA 4TNVF 1K85A 4QRQA 3BEWB 2E27H 1OARL 1P4BH 4RAUB 4MJ5A 3BUTA 5FO9B 5GISH 3BPNC 2H2SD 3E0GA 2QQNL 5KG9B 1DUYA 1F3RB 4OLYL 3UBXB 1AFVL 1ZHKA 5IROC 1CFVH 4RSVA 1JGLL 3DVGA 1HCFX 2Q7NA 1NCTA 2VDPL 3A6CL 5FIEA 2C3HA 4Q7DA 4ERSH 4ZFFB 3QI9C 4L8CB 2MPAL 4NQCD 3UTSD 2PTVA 5L7XL 3C8HA 1I1RA 4RMUA 3QO1A 3L5WA 3QH3B 1T04A 1I3GL 1PJ9A 2P5WD 2CPCA 3KXFA 2LFGA 4OZIA 2FJHA 3VWJC 3GSUB 3DGGB 1KEGL 4X4YB 1G7MA 5FM5O 4W81A 2CJUH 4IRZH 2DMBA 5E99L 4CU7A 5IOPA 4UT7L 3HC3L 5F1OB 1Z5LA 3BXNB 4M3JA 4K55A 4OF5A 3BGAA 4NOBA 4NWTH 4HUWB 1KJMB 3OAYH 3T0ED 4KJPC 2HWZL 1GGTA 3P0VH 3GUTB 1EEQA 1LEKB 5DJZA 4OZFG 2RFXA 1JTTA 1U9KA 4PV9B 4LP5A 4JKPL 1I8KB 5F1NA 4XTRD 5ESVB 4JANB 3K3QA 3MRCB 5F9WB 4QHKJ 3T2NH 4GMTH 4HLJA 2BDNH 3MGOA 1NFDA 3SO3C 4L8BB 3WL9A 4U1MA 3FB6A 1QYGH 3MROA 4HS6B 3MJ7B 3S36X 5MENA 5GJSH 1T6VN 3ARVA 1J0KA 4PJDE 1JWSB 3QWOB 4PJCA 4PJ5A 1A1NA 4JY6B 5FYLH 4M9PA 5FK9B 1KIRA 1RZKC 3UP1A 3IAQA 2EIZB 1E4WL 4WGWB 4PJDB 3D2UB 3TLRA 5CCKH 5I1DA 4LSPH 3MC0A 1HE7A 3IRPX 5I1IH 3P4NB 4Y2DA 5DFTA 3I3BA 1OF2A 4MSWA 3U0WL 1GZPA 1DQQA 3QAZC 2EDTA 3KR3L 2EE6A 2CDFB 5CLTA 3S8WA 2Q8AL 4KQ4L 3W9EB 4DQOL 3I6GA 3DYPA 5EU5B 1E6JH 4NO0D 1PG7X 3TEUA 1CF8L 1FIGH 4JFFD 2E5EA 2VITB 4XZUA 3HI1B 3FO1A 4OJFH 4RBPH 3UTPE 1T66C 3O6LL 2OQJB 3GRWL 4IDLA 4ZTOH 5FF6A 2YD8A 5IW6B 4S1SL 1SEBB 3D18B 1TQBB 3HNTL 4MQXC 4D8PB 3CCHB 4QHMB 2DWEA 1BF2A 2VLKE 1JYNA 1E28A 1U8NB 1C5DA 4TPRL 3TBYA 2IEPA 3KPQB 5FUOL 1YEKH 1MRDL 3IDIB 1UWXK 2VLKB 2Q3AA 4N8VA 4M61B 2BSED 2XKSA 5FYKD 3WIFA 4U6HB 4L3CA 4M62L 2XZCH 2FL5A 5D1XC 1RZ7H 3GMLB 2YD1A 5I74B 4F80A 4MA7L 1WITA 3GMMA 3TIDB 1FAKT 2IH1B 3LEVL 4YPGA 4F7EA 4WY7L 4GG6F 1GGBL 5D9SB 5LAXA 2A0LC 2GY5A 3ULVL 4YHPA 3FT2B 1KCRH 4K23L 3HAEA 1FNGA 4XNYH 1HOCB 4U1HA 3C6LA 5EU7E 1A5FH 4H0GA 4J4PA 4P23A 1A7OL 2NY6C 5CZKA 3WKMH 1TJIL 3HCVA 1Z9LA 3F7YA 4PTUB 2CUIA 2DLHA 4MHHI 3HR6A 3WXWH 4DOHE 3P9MB 2W9DL 1RZJC 2F53D 5F9OH 1FFPB 1RJZB 3JUYA 3NZ8A 2D7TL 4DOHB 4ONOA 4WGVB 3NPSB 3MRMB 1IGCH 1M7IB 5DYOA 4OM0L 2HLFC 5DRNB 3HRZB 3EYUL 1WC7A 4ODHL 2Z8SA 3OGOE 3ORJA 4WTXA 3I3DA 3S3SA 4MZ2A 3DX7B 1IGFL 5DXWA 3KGRA 1W0VA 4HKJA 4DAGH 2HJLA 3F5WB 4NP4H 3E6FA 3F7VA 5GZOC 3FJTA 3LKSB 4NQSA 2F8VA 2R0WH 1RUAH 4BFIB 4GKNA 4TVPD 4D0BA 2G75A 3DBXB 3U0TA 1Q1JH 4UTAL 4BQ6A 4HJGB 4I1NB 4L8SC 3O3AA 3O8XB 2BRRL 1HYRC 5JIIA 4BZ2L 1AP2A 2XA3A 4LVNC 5EO1B 2O5YH 5HYSB 4UU9B 3GJFB 4S2SA 3WIHL 5EU3A 3T0EE 3DURB 3W81A 1GC1H 3L3DB 4G9DB 5I0ZA 1ERNA 3G6DL 1QKZH 4K3EH 1R3JA 4HGWA 5DVOA 2CLRB 3MRHA 4CBPA 5EO0A 5GSVB 3V2AR 1KLUB 3IDGB 4MJID 4UV4L 3G6JA 1AXTH 3CFJA 4QXWA 1S8DA 2R69H 3SE3A 1CFQB 5I6XC 1CLOL 5DGRA 3WO4B 1D6EB 4ZS6D 4D0CB 4JHWH 4FQCH 1CDIA 3PWVA 3FL7A 4ZOAA 1EZVY 2WLYA 2AXGB 1EMTL 1BVKB 3VGAC 5F8QC 3OAZK 2PW1A 3AB0B 1BLNA 1IE5A 2AK4A 4R8WH 1S3KH 1NGXB 2DQUH 5BV7H 4KGLA 1AGCB 1C1EL 4NGHH 1S9YB 1ES0B 2H9GB 4ERSL 4RIRB 1E27A 3DUUB 1N5AA 3T8XB 3C8KB 4ZD3L 5E1AB 3DV4B 2A6JB 4HIXH 3I6LE 5CIPH 3C6SB 4WI5A 3PDDA 5DD1H 1DANU 5GGQH 3ZE0E 2C1PB 4G8GD 2FECI 4Z78B 2J2ZA 1UB6A 5I1AB 4PPTA 2FO4A 3KJ6H 2CJUL 4JFFE 4YC2B 2VISB 3L1OH 4UIKH 3MGTA 3BEVB 5TFSL 4KKLC 2H26A 2AEPL 3CAFA 4BYHA 2DQCL 2X42A 4ONFH 3MNZB 3EO0A 1WWCA 4ZAKA 3D85B 3P0VL 5GRVL 4Z18A 3INUH 2BVOB 3LKOA 4KK5D 5EZIL 4PTTA 2KUTA 4B0MM 5DJ0B 2AJZB 1KPUA 5FYKE 2X05A 4TNWF 1UT9A 5DF0A 5DTFB 3QWRD 1YECL 4L4VA 2BP3A 3LMJH 3ARTA 3MRKA 4E41A 4FZ8H 1T4KB 2XG5A 1EA9C 2HTKD 3QDGA 3EYFA 1G9NH 1QYGL 2DTSA 2N7AA 4PD4K 3SO5A 4XP4H 3L6FA 3TT1H 4YE4H 1K9TA 3ZTJH 2VUOA 5GJSL 1MI5A 3CMGA 3ARQA 1KTDA 5FYLL 4Z7QE 3MYZA 5J3HC 4Z7UE 1G7HB 1UXWA 3DO7B 1AO7D 2COQA 3NTCH 3RGVC 5CCKL 4LSPL 4Z7UB 2DBLL 2W60B 1IGTA 5I1IL 1TETL 4LVOB 5FHBH 3ARDC 4AYFA 1HHGB 3FFDA 3RVXC 4PRAA 1INQA 1P7KA 2L4OA 2ED7A 4P9MH 4FOMA 1EEYB 5AZEL 3RVUD 1E6JL 4HK3J 2NXZC 2Z0BA 1AIFA 1FL3A 5A2KH 5LXGH 1FIGL 3TNMB 2XWBB 3MJ8B 2HT3C 3BIKA 4WW2A 5DJCB 2FSEA 1TJGH 1UENA 1ZHBA 3QPQD 5DJ6B 4ZTOL 1YY8B 3NA9H 1ORQB 4C4KT 2FEDD 4RFEA 2Z8WC 4OLWH 2Z92B 3AREB 1G9MC 1PSKH 5EC2A 4F9LA 4GRWE 3QFJA 3PHQB 4P57B 4TVPE 4WNQB 4YDKH 1MNUL 3FAXA 2P5EB 5GGTH 1LEIB 1CDGA 1N3NA 3OG6B 4GRWB 4X0KA 5E9DA 1UZ8B 1Z0NA 3N0PB 3QFDA 2EC9T 1RZ7L 3P4OA 4X6BB 5D5MF 3S96A 1U8JA 1WWBX 1X4XA 4NQEA 3V6ZB 4K8RH 4WUKH 1YPZB 1NCAL 2YWZA 3KAAA 2ESVA 1KENL 1NQBA 4R26H 2ATKA 3STLA 3RL1A 4JQIL 5J9PA 4XNYL 3ZDYE 1A5FL 4Z7WF 5IT2H 3OV6A 3E2HC 4K2UH 3WKML 1RHHB 2IPKA 1LP9B 4QYOB 4MJIE 2UWEF 5D7JB 2XY2A 3QJHA 3SDAD 4S1DC 4RRPA 2F74A 1KELH 2R0ZH 1X7QB 5KBNC 4KRPC 5EBMA 4MJIB 5HYQB 5I15H 5IBTH 2ICEB 4XNMA 4WCYH 1H5BC 1BIIA 3ZHDA 5EOCJ 4HEME 3DNKA 4XGZB 1T3FB 3QG6B 3RDTC 4H20H 4AQOA 3AMKA 3NCEB 4P2QD 1TCRA 4LLUA 4QGYA 3SY0A 1B4JH 2FB4H 5JR1H 1IGMH 2DM7A 4HJ0C 3VWKC 5IB4B 4JFQA 1F3JA 4JFHD 1QNZL 1JTOA 4F7TB 4YX2H 1BQHG 2R0WL 4EQ3A 4G6FD 5DMKA 1DUZB 1JE6A 4RA3A 1Q1JL 4G8GE 3GJEB 2X4NA 4LAQH 3H3BC 3QG7H 1VFBB 4Y88A 4EDXB 5IWLC 4NWUL 2W91A 3BP6B 3MNVB 3Q5TA 4YXHH 3VD4A 5FECA 2O5YL 3MA7B 3T0VA 5EUKB 2YMXL 2YD5A 5IHUH 4HGKC 3X13A 2MKLC 2W9LA 1F6FB 3GMOA 3DOSA 1QKZL 1FVDB 4I2XB 5A16B 3EZJB 1FNEA 2Y25A 4M1DL 4Y4HA 3NCBB 5C0CB 4AG4H 3SEPA 1XT5A 1KUMA 3O81A 4V1DA 3KVQA 2A9MH 3O2DH 1AXTL 1NC2A 1R5WB 2BHUA 2R69L 3QIWD 3S37X 4RWYL 1HINH 3DX6B 3EDEA 5F1IB 1NMBL 2UUDK 4PRNB 5CBEB 4JHWL 1HNFA 1V05A 1CFSB 4FQCL 5E95B 3BP7A 5D6CA 5TF0A 1A6VH 3WN5C 4DVBB 3ARBD 1R3IH 5KSAC 3NACH 4JZOB 5FO8A 2P24A 1U8PB 5DMYA 4R8WL 2DQUL 4KY1H 5BV7L 4NGHL 2BVTA 1AO7E 1ZTXH 2EZ0C 4OGZA 2P4AB 2JB6B 3V5KB 2IFFH 3QQ9D 2EDWA 3I85A 2CSPA 3GSVB 3HB3C 1CGWA 4LRNL 3IXTB 4G6MH 2BCKA 4HUUB 4HIXL 2FLBT 3OB0H 1HI6A 5JMRA 5I16B 4ONHB 3NH7H 4DCQA 2AXFA 1A3RH 1NBQA 2CMRL 5C6TH 4DKEH 5ANMA 5KAQG 1KTLA 4MJ4A 2HJKA 3NFNB 3L1OL 1HEZA 2IAMB 4UIKL 5I66B 2EDHA 2QJDA 1XF2B 2R8SL 1U93A 2NXYD 2YA0A 4QRTA 1U0QA 2VIRB 3RWIA 1F58L 4HWEH 4KKAD 5E00A 5FHAH 1NGZA 4ONFL 4GJTB 3TV3H 1JPGB 3FT3B 3WD5H 4FQ1H 4KZEL 3DRQA 3UXFA 3VDCA 3INUL 3EAKA 5DRZB 3PGCB 5EZJB 4LEOB 4OLVL 5ISZD 3JTSA 4YGVA 4PJ9C 1IKFH 32C2A 1QA9A 3U9PH 3EDFA 5ESQA 1NMCC 3BN9D 5EPMA 5ABDE 1WBZB 1SBSH 2GTZB 3R8BB 3G08B 3RI5F 2RJMA 5E2WH 3MJ9H 1NLBL 5JXEA 1P4LB 4OZGF 5FA3B 1FH5L 3H3PH 3TT1L 4YE4L 4X7CC 5SWSA 2A74B 2HH0L 5JLZA 3LCYA 4LLAA 2ZKHH 5J12B 2BNUA 5FO7B 3WJLA 4Y4KD 1KT2B 5GS0H 3MLSH 5IFJA 4O02H 1RUML 2XZQH 3T4AA 1QFHA 3BJLA 3N9GH 4WWID 4HIJA 3CXDH 1IFHL 1S7VB 2NY1D 3DI3B 2QQKL 3NN8A 4BH7A 1WBYA 4ZSOA 5C8JB 4HH8A 4G7YH 5JW3H 4BKLB 3DI2B 2WWKT 3E3QE 4P9ML 3Q6GH 4WU5A 2OK0L 5HHOD 3OGCB 1CE6A 3H0TB 3AU1B 4KVCL 3G5VB 3TCXA 3CSYB 3ZSSA 3HPLA 3IU3B 1ND0A 4OZ4B 5CD3B 4UDUA 3NA9L 3V5HA 3MV11 4IMLA 4OLWL 1P6AB 3GBNH 2NLJA 4WUUE 1BF8A 2VABB 3TO4A 1QHPA 5CJ8A 2O93L 3PWNA 4HPYH 1L6XA 3ECBB 1XCTB 1AC6A 4R3SB 2PXYD 5EOCL 4WUUB 4FXKA 4K3HA 1J10A 4NN7B 4YDKL 3UJJH 3V52H 5GGTL 1AXSB 3MSPA 1VB9A 5E6ID 4P5TA 1MY7A 3WKNA 4L9LA 3F58H 2KPNA 2Y6SC 3QRGH 1HXMB 4LHUG 2HFEB 2EXWD 3LKPA 2NY5C 2J4WH 4K8RL 4WUKL 4X6DF 1JNJA 4KK9D 1I8IB 5GS1A 5ITFB 3ZDZF 1EUUA 5ERWB 4Q74A 4HW6A 2D9QB 3HMXL 2D4DA 3O6KL 4ZUSB 3VFOA 4R26L 2VO5A 4WV1B 3ZT5A 3DETD 3T65A 3TA3B 2IJ0C 1AD0A 5C1MB 4MD5B 2Z9TA 1UM4H 3MYJB 4MLSA 3QEUB 1NUDA 4K2UL 2SEBA 4LLWB 4EDWL 5KJRH 3O4LA 4MCZB 4Y4FA 5KVFH 4GRLB 4D94A 3GKWH 5F89A 4KTDL 35C8L 3VXME 3MR9A 2XT1B 2Q6WB 4XXDB 3S6CA 3RFZC 1A2YA 3C60A 5IB2B 3VXMB 4WCYL 3UTZB 5I30L 2EO9A 4ZG1A 2HKHH 2WWMC 4G6JH 3P11L 3GMRB 3KPPA 4JQVA 4RDQF 2ZUSA 1UVQB 5J1AB 1YYML 4EN3D 1C7SA 1P4IL 5F9WC 3VFRB 1BD2D 4KHTL 4YHMH 1NCWH 2JIXD 3C2SA 4UZGA 3F12B 2FH8A 5E0QA 5CAYB 1RULH 3WFCL 1VFAB 5J1TC 3M1BB 5D7IA 5D6DC 1GHFH 2YKLH 4LCCB 2FB4L 5JR1L 5FXCH 4MGXA 4JPIB 1I85C 2AGJL 1RZGA 4K3DL 3MOBL 4O4YL 4RFOH 4ZQKB 5T33H 2J6EA 2BSSA 4LVHB 5I71B 1DTUA 4ORZC 4WWKB 2QL1A 4EUPB 2VE6A 4WI6A 4XCEB 4TSCH 4LAQL 1CFBA 1UYWL 3QG7L 3B5TA 3J7HA 4GBXA 4N1CA 5E6ZA 3OKNB 3WJJC 4RNRA 4YXHL 1WBXA 2D31B 3BFOA 1JZ4A 1BJ8A 5LJYH 4AH2B 4LU5L 4K9EL 5IHUL 2W0FB 5KZCB 3RRQA 1S7TA 1NC4D 1GGCH 6CGTA 2A77H 3PXHA 3OG4B 5ISZE 3ZL4H 4X8JB 4AG4L 3GMPA 1CU4H 4R2GB 2F8XC 1BQSA 2A9ML 3O2DL 3CGTA 4GG8A 5ISZB 4EVNA 2C9AA 4OM1H 4UAOB 2UZIH 2BK8A 5D72L 3UO1H 4HAFA 1PVHA 5JHDD 3V6OA 2MKWA 1ACYH 2Y7QA 2ADIA 3OAUH 3VXSA 4GW4A 1R3IL 4Z8FH 3GSRA 3OKLA 3WDIA 1FZOA 4JY4A 4ZFOB 5E8PA 1V7NH 3FQUA 1YEJH 2HFTA 4HJJL 1G0DA 5I74C 1WAAA 1MPAH 4Y5YA 5DVMA 4MXQC 3TP4A 1CQKA 2VUYA 5JZ7D 1ZTXL 4PJEF 5I8CB 1MCOH 2IFFL 3FKUS 1KJ2L 1A4JA 5ENWB 4CU6A 1A7NH 4H8WH 5A2FA 2EDEA 2ENYA 1AKJA 1KACB 2GJZA 2VN4A 3B9KD 2PO6A 3Q3GA 1H3VA 2NY1B 3RKDC 4M8QA 1CK0H 3HMWH 3NH7L 1N5YH 4KKCC 4ZXBA 2CDEA 1A3RL 2VN7A 4FQPA 4GW5A 4OD1H 5EU7C 1IMHC 2GHWB 3IDMA 2WANA 5IUSA 5T5NF 5E5MA 1Z3GL 2H2PC 4HZLA 3L3OA 1DR9A 4XC1H 1N6VA 5IMLB 5FHAL 1J86A 5DJ8A 5GGRA 4PLNC 3TV3L 2G5BA 3B5GA 3NPSC 4LSVL 4C4KO 5MERA 3H9HB 4FQ1L 4NQDA 4PJXA 2GCYA 3O11B 1HIMH 5IROA 3I6KB 3T04D 1ZS8B 3UTTA 1T1YB 4JDVB 3A0OA 5DJAB 3U9PL 4LCIL 4LAJH 1XF1A 2LQRA 4ODXB 3SDDB 5E4EB 2CLZB 4S1RH 3QI9A 1WISA 3P77B 4UILH 4HKBB 2ZUVA 3V6FA 1SBSL 3HG1D 5E6IB 4KI5F 1Q0YL 5E2WL 3SQOL 3DWTA 1T83A 5KSBE 3FOLA 4GKSA 1JZ2A 3GSOB 2YBRA 5J56B 3H3PL 4KAQH 5F72S 3VMPA 1NBZA 3JWOH 3VWJA 1HKLH 3GSWA 5KSVB 1J05A 1FAIL 5JPMB 1XR8B 1NAMB 5EH1A 5CEZH 3MLSL 3O8XC 4NZDA 1U92A 5IW1B 1U95B 3RL2A 2XZQL 1G9EA 1XGUA 1A21A 1RD6A 2IQ9H 3IDNB 1HSBB 3MUZ1 1A8JH 1Z6JT 5EWIL 3KPRD 1KPRB 4YEEA 5IP4A 5JW3L 4L8DA 3VXPB 4BQ9A 4OTXL 1H3TA 4CDHA 4M5ZL 3NAAH 3Q6GL 5KTEH 3DVFA 3DROB 4IIQB 2ARJQ 4ELMA 4I4WA 1I7TA 1SYSA 1D5MA 1TZHA 3NIFF 4HIEA 4UBDD 2HN7B 5CMAB 4TVPH 1YEGL 3WO4C 1WZ1L 1ZLWH 4NQTA 1IC1A 1BD2E 2AVGA 3FQRB 4M4RA 5F88B 4XTRC 2ARJA 2X1PA 2ZSVA 4OCWH 1GIGL 2VXTH 2OR7A 2JIXB 3OTTA 5DDHA 2A6DB 3AB0C 1U36A 1VADB 5DVNA 1E4XI 1YPZF 2R23B 5DI8A 4ETQB 4D9RD 2GW5A 1QOKA 3DUSB 2D7NA 5JOFB 4Z95H 3MV8A 2GQHA 2AXJA 1VFOA 3F58L 3ARSA 3GO1L 4LLYB 5BS0D 4PUBL 2V2WB 4YBQD 1LP9F 2YRLA 3CC5B 2J4WL 4UNVA 1OTTD 1EX0A 4U1KA 2CRYA 2OYPA 2J6EL 4HV8B 4MNHB 4O2EB 3CSPA 4YC2C 5F70A 5IKCA 2CR3A 3PL6D 1YEFH 5DA0B 5DJZB 2ZCHH 3T3ME 1UM4L 1Q9OA 4MQSB 1FCCA 2AQ2A 2FH6A 5SV4A 4NO2B 4MZ3A 4PJ8D 4X4ZA 3DX8A 1YJDH 4MD0A 1UC6A 4QHLB 1QSVA 3BYTA 4HMCA 3IFNH 2BX5A 3MGOB 1NFDB 4BFGA 5MENE 4FQXD 1JN6B 4ZUWB 1DBBL 1XZ0B 4NSKA 5EUOA 5DC0A 1T1XB 4G6JL 5MENB 5TDOA 4YXKH 3MRJB 4JLRA 4KWUA 5DO2C 1LE5A 4HC1H 2WM0A 5CEXA 3PWPD 4XMPH 1NCWL 1KIRB 4YHML 4NNXB 2CK2A 2NX5A 3ROOA 4FABH 3ZDXF 3SOBL 4FHBD 2MNUA 3ESVF 4W70A 2ZG2A 2APTA 2ZUQB 3F7RA 2YKLL 3NFSL 2CDGA 4X99B 5DJXB 3VH8A 4RFOL 1WIPA 4UNTA 4AEIH 5CJBA 3U83A 2CRZA 2HJFA 4ZPVB 3BIBX 4N1HB 3RQ3A 3I6GB 3PWUB 1A6AA 2MQ3A 2VDOH 4DUVA 4LSRL 1J9CT 1N8ZB 3B9KB 3TO2A 4OV6F 2HMIC 4LVOC 2BNRD 3FO1B 3SKUD 2DQHH 2VZ3A 5C70A 1OAUH 5FF6B 3QDJD 3ZTNL 3FN0H 3KYOA 3RUGE 3EYQD 1F11B 4HKZA 2VTFA 2H1PH 1CICD 2DLFL 4J8RB 3RUGB 4QRPA 1JHKL 1BEYH 1LHZA 5CGTA 1X4YA 5JUEH 3NIGE 1GGCL 1KB9J 3S4SG 3PWJB 4MAYD 5HI5D 1G7IB 3RWDA 2EIDA 1CU4L 3GSXA 1GL4B 3AREC 5EC1B 1FPTL 3QEQD 4WU7A 3MUGA 2D7QA 2Y5TB 4OM1L 3VD5A 3UO1L 3O3DA 5IB5B 3HG1E 3VMOA 1MH5A 1GGUA 1ACYL 4YPGB 2V6HA 3OAUL 2O61B 1DCLA 3TZVD 4ODUB 3HG1B 2R1YB 2YD3A 5LAXB 4K7FA 5C07A 1T22A 1YEJL 3QDAA 5DK2B 1SMAA 3MXWH 1QFWI 1XFPA 1HILB 1IGIH 4L8SA 1LDPH 2WBJA 3C6LB 3WHXA 4WO4A 3PHOB 1MCOL 4Z7OF 5K93A 4NZJA 2DI9A 1KCVH 1A7QH 1S9XB 3MRPA 4XPGL 5IMOB 4M6ML 4JY5L 1CGVA 3SDCB 4OZFB 3KPRE 5E56A 3MRFA 1MJJA 3QHTC 5I1JH 1FJ1A 3LVEA 1CK0L 3HMWL 5F44A 4PLJC 3KPRB 3KPSA 2X4UB 2WWKO 4EI6B 5CLWA 3IFPA 3U30B 2PF6A 5D7JC 3WXVL 5K33A 5I76B 4NJ9L 1AE6H 1WC7B 4NM8H 5FUZH 4PJHE 1O7VA 2DQTH 4DUXA 1DN0A 1JI1A 1T6WA 5I1GH 1DEEB 4XCYB 4ZS6C 3MLVH 3B9VA 4PJHB 1W0VB 5DT1H 2OR9H 1U8MA 1PG7L 3F7VB 1HIML 3QXVA 4O9HH 4D0BB 2OS7A 4JB9L 4O5LH 4QRRD 2XQBH 5DLMH 2R29H 1IZKA 3NCYS 2OXHA 2VR5A 4AL8H 3C5ZD 1A6UH 3BGMA 1IEHA 4PRDA 4YK4B 4OCLC 3MLZH 5KN5A 2Y06H 1EO7A 1F90L 4S1RL 1IQWH 4O51B 2VZOA 3NGBB 5D7LE 4EXKA 4ONGL 3U79A 5E8OA 3RBSA 3H8NA 3CFBA 4AEFA 1LK2A 4QY8A 3V8CA 1CDBA 3CLFH 4E9LA 4YHNB 5D7LB 2BSTA 1HKLL 2NR6D 4JZNB 5AWNH 3V79C 4HCRA 5DQDL 2VDRH 5CEZL 2Y5EA 1S9VA 3VFGH 1A47A 4X98A 1R3JB 2LU4A 5SX5H 3RAJH 4Y5VB 2F5BL 2IQ9L 2ADFH 5IEHA 2DYPA 3CFJB 3U7WH 1S8DB 1HQRB 5B21A 1QBMH 5F7DA 2PYFA 1FE8H 2LE9A 4G8FA 3ISWA 1QFOA 4PJ8B 3WFBL 4F9PC 3NAAL 5KTEL 4KKBD 3U46A 2AJSL 3H7BA 1IC4H 5JO5B 1FN4A 4ZFZB 3NCYP 1DQJB 3QUZD 1J8KA 2OL3H 7FABL 1U3HD 4FQXB 1Y6NR 4OB5L 4KV5E 3VRJA 1P2CB 3GHEH 1W72B 3PWPE 5BQ7A 4FNLH 4OCWL 4F7CB 2VXTL 3PWPB 4XMKL 5J6HA 4UMGA 2DQGH 3C2AH 1B0RA 4NNPL 1MWAH 1UWXH 1Q9WB 3CZFA 5IVXA 2IF7A 1IM9D 5LBSH 4XHJC 5EOQH 2I07A 3MUJA 4I18B 3KLDA 4GXUN 5C6WH 3P9LB 3RGVA 1UB6B 4DKAA 4ENED 2FGWL 3LPWA 3QNZA 3ULUE 4PJFE 2BNRE 5F6HJ 4TRPH 1P1ZA 2YSSB 3U7AA 2AK1H 3BT2H 4MD4A 5E5UB 1ZE3C 3L3GB 3MGTB 4C54A 5KVGH 1RURH 1C8PA 4JR9H 3QUMH 4UTBL 4PJFB 4M9OA 2BNRB 4FFZH 3H7LA 4X6CF 5E03A 4P5KA 2BVEA 4NDMA 1XF4B 5DUBB 4GUPA 3ZTJG 3EO0B 3RVUC 4ZAKB 4NKMA 3IJYA 5L2KA 2ID5A 4BFEA 5DHVH 3VFVB 4PTTB 2P8LB 1CICB 4P2YA 1YMHA 2UYLA 3OKKB 4LIQH 3GEWB 4XPHL 1T21A 5LGJB 1YJDL 3QEQE 5JQ6H 3MRKB 1KJVB 1LILA 1RJLA 2FEDC 4F8TA 2XWTA 4LQ1A 3AS3A 5F71A 1KCLA 2QSQA 1RZJL 2W0LA 4FQJL 4YIQB 1MFNA 4NM4H 3U1SL 2H3NB 3OXSA 3QNXA 1OP5K 3CVHB 5EOTB 1N6QH 4XMPL 4UT9H 4FABL 1R5VA 4YPJA 3RBGA 1LEGB 3SGJA 3C9NB 4JFED 1B90A 4BQCA 2DF3A 3HC4H 1PD6A 1MCCA 4NPYB 5T1MA 4AY0A 3T0WA 5D70H 3FFDB 4JHAH 5J12C 1T2XA 3WNKA 2VDKH 5KS9A 1U91A 1NANH 5C0DA 4XP9L 1OVZA 2DJSA 3D0LB 3N1QC 4NKDA 5EZOH 4JJ5A 4DZBB 4R97B 1TITA 4XBEL 3I3EA 3UC0H 3H9SE 2DIBA 5CIPA 2YPLD 3K8MA 2DQHL 1MCFA 1OAUL 4ZOCA 2O5XL 3FN0L 5D93B 4BK4A 4ODVH 1C12A 3H9SB 3R0MA 2AW2A 4P3CH 3SDAC 2H1PL 3E3QC 4RWHA 3VFPA 4TOYH 3RTQD 3OKMA 1BEYL 2JF1A 4QRSA 3W0WA 1LO5A 1NFIB 5JUEL 4LARL 3RDTA 1BQLL 4MDIB 3FRPG 4G6AD 3IJSA 4DGVH 4QRRE 2PKDA 3HUJF 1N3NB 5I75C 2C7UB 5E2VH 2VDLH 4FG6C 1UQSA 3KLAA 4QRRB 3VDAA 3P4OB 3R0NA 1NCNA 3LQAH 3VWKA 4OFYD 2ZWLT 4NN7C 3V6BR 3OAZH 4IM8A 4LLQB 4G8EB 3ILPB 3QUXD 5GGVY 1CS6A 4HHAA 3L7EA 3L5XL 3BWAB 4NUGL 3TYGH 1JBJA 1XF3B 3TBTA 3U9UA 4RMQA 3STLB 1X5FA 1IGIL 4D9QE 5J9PB 1LDPL 5IWLA 1ZEAL 3LKQB 4NYLB 4OF3A 1ZGLB 5EZLA